{ "uniprot_canonical_ac": "O00560-1", "uniprot_ac": "O00560", "uniprot_id": "SDCB1_HUMAN", "mass": { "chemical_mass": 32444.0, "monoisotopic_mass": 32444.0 }, "refseq": { "ac": "NP_001007068", "name": "syntenin-1 isoform 1", "summary": "The protein encoded by this gene was initially identified as a molecule linking syndecan-mediated signaling to the cytoskeleton. The syntenin protein contains tandemly repeated PDZ domains that bind the cytoplasmic, C-terminal domains of a variety of transmembrane proteins. This protein may also affect cytoskeletal-membrane organization, cell adhesion, protein trafficking, and the activation of transcription factors. The protein is primarily localized to membrane-associated adherens junctions and focal adhesions but is also found at the endoplasmic reticulum and nucleus. Alternative splicing results in multiple transcript variants encoding different isoforms. Related pseudogenes have been identified on multiple chromosomes. [provided by RefSeq, Jan 2017].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001007068" }, "gene_names": [ { "name": "SDCBP", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/O00560", "id": "O00560" }, { "name": "MDA-9; MDA9; SDCBP1; ST1; SYCL; TACIP18", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001007068", "id": "NP_001007068" }, { "name": "MDA9", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O00560", "id": "O00560" }, { "name": "SDCBP", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001007068", "id": "NP_001007068" }, { "name": "SYCL", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O00560", "id": "O00560" }, { "name": "hCG_1787561", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O00560", "id": "O00560" } ], "protein_names": [ { "name": "Syntenin-1", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "O00560" }, { "name": "MDA-9", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O00560" }, { "name": "Melanoma differentiation-associated protein 9", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O00560" }, { "name": "Pro-TGF-alpha cytoplasmic domain-interacting protein 18", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O00560" }, { "name": "Scaffold protein Pbp1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O00560" }, { "name": "Syndecan-binding protein 1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O00560" }, { "name": "TACIP18", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O00560" }, { "name": "melanoma differentiation associated protein-9; scaffold protein Pbp1; pro-TGF-alpha cytoplasmic domain-interacting protein 18; syntenin-1; syndecan binding protein (syntenin); syndecan-binding protein 1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001007068", "id": "NP_001007068" }, { "name": "syntenin-1 isoform 1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001007068", "id": "NP_001007068" } ], "function": [ { "annotation": "Anaplasma phagocytophilum Ats-1 enhances exosome secretion through Syntenin-1. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_001007068", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001007068" }, { "database": "PubMed", "id": "37759206", "url": "https://glygen.org/publication/PubMed/37759206" } ] }, { "annotation": "Multifunctional adapter protein involved in diverse array of functions including trafficking of transmembrane proteins, neuro and immunomodulation, exosome biogenesis, and tumorigenesis (PubMed:26291527). Positively regulates TGFB1-mediated SMAD2/3 activation and TGFB1-induced epithelial-to-mesenchymal transition (EMT) and cell migration in various cell types. May increase TGFB1 signaling by enhancing cell-surface expression of TGFR1 by preventing the interaction between TGFR1 and CAV1 and subsequent CAV1-dependent internalization and degradation of TGFR1 (PubMed:25893292). In concert with SDC1/4 and PDCD6IP, regulates exosome biogenesis (PubMed:22660413). Regulates migration, growth, proliferation, and cell cycle progression in a variety of cancer types (PubMed:26539120). In adherens junctions may function to couple syndecans to cytoskeletal proteins or signaling components. Seems to couple transcription factor SOX4 to the IL-5 receptor (IL5RA) (PubMed:11498591). May also play a role in vesicular trafficking (PubMed:11179419). Seems to be required for the targeting of TGFA to the cell surface in the early secretory pathway (PubMed:10230395).", "evidence": [ { "database": "UniProtKB", "id": "O00560", "url": "https://www.uniprot.org/uniprot/O00560#function" }, { "database": "PubMed", "id": "26291527", "url": "https://glygen.org/publication/PubMed/26291527" }, { "database": "PubMed", "id": "11498591", "url": "https://glygen.org/publication/PubMed/11498591" }, { "database": "PubMed", "id": "25893292", "url": "https://glygen.org/publication/PubMed/25893292" }, { "database": "PubMed", "id": "22660413", "url": "https://glygen.org/publication/PubMed/22660413" }, { "database": "PubMed", "id": "11179419", "url": "https://glygen.org/publication/PubMed/11179419" }, { "database": "PubMed", "id": "26539120", "url": "https://glygen.org/publication/PubMed/26539120" }, { "database": "PubMed", "id": "10230395", "url": "https://glygen.org/publication/PubMed/10230395" } ] }, { "annotation": "SDCBP promotes pancreatic cancer progression by preventing YAP1 from beta-TrCP-mediated proteasomal degradation.", "evidence": [ { "database": "RefSeq", "id": "NP_001007068", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001007068" }, { "database": "PubMed", "id": "36828627", "url": "https://glygen.org/publication/PubMed/36828627" } ] }, { "annotation": "Syntenin-1-mediated arthritogenicity is advanced by reprogramming RA metabolic macrophages and Th1 cells.", "evidence": [ { "database": "RefSeq", "id": "NP_001007068", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001007068" }, { "database": "PubMed", "id": "36593091", "url": "https://glygen.org/publication/PubMed/36593091" } ] }, { "annotation": "Syntenin-1-mediated small extracellular vesicles promotes cell growth, migration, and angiogenesis by increasing onco-miRNAs secretion in lung cancer cells. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_001007068", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001007068" }, { "database": "PubMed", "id": "35136055", "url": "https://glygen.org/publication/PubMed/35136055" } ] }, { "annotation": "The Multifunctional Protein Syntenin-1: Regulator of Exosome Biogenesis, Cellular Function, and Tumor Progression. Review article Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_001007068", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001007068" }, { "database": "PubMed", "id": "37298370", "url": "https://glygen.org/publication/PubMed/37298370" } ] }, { "annotation": "The protein encoded by this gene was initially identified as a molecule linking syndecan-mediated signaling to the cytoskeleton. The syntenin protein contains tandemly repeated PDZ domains that bind the cytoplasmic, C-terminal domains of a variety of transmembrane proteins. This protein may also affect cytoskeletal-membrane organization, cell adhesion, protein trafficking, and the activation of transcription factors. The protein is primarily localized to membrane-associated adherens junctions and focal adhesions but is also found at the endoplasmic reticulum and nucleus. Alternative splicing results in multiple transcript variants encoding different isoforms. Related pseudogenes have been identified on multiple chromosomes. [provided by RefSeq, Jan 2017].", "evidence": [ { "database": "RefSeq", "id": "NP_001007068", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001007068" } ] } ], "disease": [], "snv": [], "mutagenesis": [ { "start_pos": 214, "end_pos": 214, "sequence_org": "K", "sequence_mut": "A", "comment": "Disruption of the cooperative binding of C-terminal peptides from FZD7 and phosphatidylinositol-4,5-bisphosphate. Impaired interaction with FZD7 and disruption of the cooperative binding of C-terminal peptides from FZD7 and phosphatidylinositol-4,5-bisphosphate; when associated with A-250.", "evidence": [ { "database": "UniProtKB", "id": "O00560", "url": "https://www.uniprot.org/uniprot/O00560" }, { "database": "PubMed", "id": "27386966", "url": "https://glygen.org/publication/PubMed/27386966" } ] }, { "start_pos": 215, "end_pos": 215, "sequence_org": "N", "sequence_mut": "D", "comment": "Disruption of the cooperative binding of C-terminal peptides from FZD7 and phosphatidylinositol-4,5-bisphosphate.", "evidence": [ { "database": "UniProtKB", "id": "O00560", "url": "https://www.uniprot.org/uniprot/O00560" }, { "database": "PubMed", "id": "27386966", "url": "https://glygen.org/publication/PubMed/27386966" } ] }, { "start_pos": 250, "end_pos": 250, "sequence_org": "K", "sequence_mut": "A", "comment": "Disruption of the cooperative binding of C-terminal peptides from FZD7 and phosphatidylinositol-4,5-bisphosphate. Impaired interaction with FZD7 and disruption of the cooperative binding of C-terminal peptides from FZD7 and phosphatidylinositol-4,5-bisphosphate; when associated with A-214.", "evidence": [ { "database": "UniProtKB", "id": "O00560", "url": "https://www.uniprot.org/uniprot/O00560" }, { "database": "PubMed", "id": "27386966", "url": "https://glygen.org/publication/PubMed/27386966" } ] } ], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "97.31", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000137575", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000137575" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "98.03", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000137575", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000137575" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "98.27", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000137575", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000137575" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "97.18", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000137575", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000137575" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "99.25", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000137575", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000137575" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "98.77", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000137575", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000137575" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "97.44", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000137575", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000137575" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "98.66", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000137575", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000137575" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "98.13", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000137575", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000137575" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "98.81", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000137575", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000137575" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "96.99", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000137575", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000137575" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "96.17", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000137575", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000137575" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "98.75", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000137575", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000137575" } ] } ], "expression_disease": [ { "significant": "No", "trend": "up", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "O00560", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O00560" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "No", "trend": "up", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "O00560", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O00560" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "O00560", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O00560" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "No", "trend": "down", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "O00560", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O00560" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "O00560", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O00560" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "O00560", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O00560" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "O00560", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O00560" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "O00560", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O00560" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "O00560", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O00560" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "O00560", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O00560" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "O00560", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O00560" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "O00560", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O00560" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O00560", "url": "https://www.uniprot.org/uniprot/O00560" } ], "common_name": "Human" } ], "gene": [ { "name": "SDCBP", "url": "https://www.uniprot.org/uniprot/O00560", "locus": { "chromosome": "8", "start_pos": 58582859, "end_pos": 58552924, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000137575", "url": "https://www.ensembl.org/id/ENSG00000137575" } ] } } ], "crossref": [ { "id": "ENSG00000137575", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000137575", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd00136", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00136", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd00992", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00992", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "CHEMBL4739667", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL4739667", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "SDCBP", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=SDCBP", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "6386", "url": "https://www.ncbi.nlm.nih.gov/gene/6386", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "10662", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=10662", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "O00560", "url": "https://www.ebi.ac.uk/intact/interactors/id:O00560*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR001478", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001478", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036034", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036034", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR041489", "url": "https://www.ebi.ac.uk/interpro/entry/IPR041489", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "602217", "url": "http://www.omim.org/entry/602217", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_O00560", "url": "https://www.nextprot.org/entry/NX_O00560", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "O00560", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O00560", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "QFAQSTA", "url": "https://omabrowser.org/oma/group/QFAQSTA/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5395964at2759", "url": "http://www.orthodb.org/?query=5395964at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR12345", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12345", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR12345:SF10", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12345:SF10", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "1N99", "url": "https://www.rcsb.org/structure/1N99", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1NTE", "url": "https://www.rcsb.org/structure/1NTE", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1OBX", "url": "https://www.rcsb.org/structure/1OBX", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1OBY", "url": "https://www.rcsb.org/structure/1OBY", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1OBZ", "url": "https://www.rcsb.org/structure/1OBZ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1R6J", "url": "https://www.rcsb.org/structure/1R6J", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1V1T", "url": "https://www.rcsb.org/structure/1V1T", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1W9E", "url": "https://www.rcsb.org/structure/1W9E", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1W9O", "url": "https://www.rcsb.org/structure/1W9O", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1W9Q", "url": "https://www.rcsb.org/structure/1W9Q", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1YBO", "url": "https://www.rcsb.org/structure/1YBO", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4Z33", "url": "https://www.rcsb.org/structure/4Z33", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6R9H", "url": "https://www.rcsb.org/structure/6R9H", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6RLC", "url": "https://www.rcsb.org/structure/6RLC", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7FSG", "url": "https://www.rcsb.org/structure/7FSG", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7FSH", "url": "https://www.rcsb.org/structure/7FSH", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7FSI", "url": "https://www.rcsb.org/structure/7FSI", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7FSJ", "url": "https://www.rcsb.org/structure/7FSJ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7FSK", "url": "https://www.rcsb.org/structure/7FSK", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7FSL", "url": "https://www.rcsb.org/structure/7FSL", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7FSM", "url": "https://www.rcsb.org/structure/7FSM", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7FSN", "url": "https://www.rcsb.org/structure/7FSN", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7FSO", "url": "https://www.rcsb.org/structure/7FSO", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7FSP", "url": "https://www.rcsb.org/structure/7FSP", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7FSQ", "url": "https://www.rcsb.org/structure/7FSQ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7FSR", "url": "https://www.rcsb.org/structure/7FSR", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7FSS", "url": "https://www.rcsb.org/structure/7FSS", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7FST", "url": "https://www.rcsb.org/structure/7FST", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7FSU", "url": "https://www.rcsb.org/structure/7FSU", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7FSV", "url": "https://www.rcsb.org/structure/7FSV", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7FSW", "url": "https://www.rcsb.org/structure/7FSW", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7FSX", "url": "https://www.rcsb.org/structure/7FSX", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7FSY", "url": "https://www.rcsb.org/structure/7FSY", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7FSZ", "url": "https://www.rcsb.org/structure/7FSZ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7FT0", "url": "https://www.rcsb.org/structure/7FT0", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7FT1", "url": "https://www.rcsb.org/structure/7FT1", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7FT2", "url": "https://www.rcsb.org/structure/7FT2", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7FT3", "url": "https://www.rcsb.org/structure/7FT3", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7FT4", "url": "https://www.rcsb.org/structure/7FT4", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7FT5", "url": "https://www.rcsb.org/structure/7FT5", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7FT6", "url": "https://www.rcsb.org/structure/7FT6", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7FT7", "url": "https://www.rcsb.org/structure/7FT7", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7FT8", "url": "https://www.rcsb.org/structure/7FT8", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7FT9", "url": "https://www.rcsb.org/structure/7FT9", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7FTA", "url": "https://www.rcsb.org/structure/7FTA", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7FTB", "url": "https://www.rcsb.org/structure/7FTB", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7FTC", "url": "https://www.rcsb.org/structure/7FTC", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7FTD", "url": "https://www.rcsb.org/structure/7FTD", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8AAI", "url": "https://www.rcsb.org/structure/8AAI", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8AAK", "url": "https://www.rcsb.org/structure/8AAK", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8AAO", "url": "https://www.rcsb.org/structure/8AAO", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8AAP", "url": "https://www.rcsb.org/structure/8AAP", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8BLU", "url": "https://www.rcsb.org/structure/8BLU", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8BLV", "url": "https://www.rcsb.org/structure/8BLV", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00595", "url": "http://pfam.xfam.org/family/PF00595", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF17820", "url": "http://pfam.xfam.org/family/PF17820", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "O00560", "url": "https://pharos.nih.gov/targets/O00560", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_O00560", "url": "http://purl.obolibrary.org/obo/PR_O00560", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-3928664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3928664", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-447043", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-447043", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-5213460", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5213460", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-5675482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5675482", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-6798695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6798695", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001007068", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001007068", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "B4DHN5", "url": "https://www.uniprot.org/uniprot/B4DHN5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "B4DHN5-1", "url": "https://www.uniprot.org/uniprot/B4DHN5-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E9PBU7", "url": "https://www.uniprot.org/uniprot/E9PBU7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E9PBU7-1", "url": "https://www.uniprot.org/uniprot/E9PBU7-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "G5EA09", "url": "https://www.uniprot.org/uniprot/G5EA09", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "G5EA09-1", "url": "https://www.uniprot.org/uniprot/G5EA09-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O00560", "url": "https://www.uniprot.org/uniprot/O00560", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O00560-1", "url": "https://www.uniprot.org/uniprot/O00560-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O00560-2", "url": "https://www.uniprot.org/uniprot/O00560-2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O00560-3", "url": "https://www.uniprot.org/uniprot/O00560-3", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MSLYPSLEDLKVDKVIQAQTAFSANPANPAILSEASAPIPHDGNLYPRLYPELSQYMGLSLNEEEIRANVAVVSGAPLQGQLVARPSSINYMVAPVTGNDVGIRRAEIKQGIREVILCKDQDGKIGLRLKSIDNGIFVQLVQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQAFGEKITMTIRDRPFERTITMHKDSTGHVGFIFKNGKITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMPAFIFEHIIKRMAPSIMKSLMDHTIPEV", "length": 298, "header": "sp|O00560-1|SDCB1_HUMAN Isoform 1 of Syntenin-1 OS=Homo sapiens OX=9606 GN=SDCBP PE=1 SV=1 CANONICAL=O00560-1" }, "isoforms": [ { "isoform_ac": "B4DHN5-1", "url": "", "sequence": { "sequence": "MSLYPSLEDLKVDKVIQAQTAFSANPANPAILSEASAPIPHDGNLYPRLYPELSQYMGLSLNEEEIRANVAVVSGAPLQGLVQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQAFGEKITMTIRDRPFERTITMHKDSTGHVGFIFKNGKITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMPAFIFEHIIKRMAPSIMKSLMDHTIPEV", "length": 239, "header": "tr|B4DHN5-1|SDCB1_HUMAN Computationally mapped isoform of Syntenin-1 OS=Homo sapiens OX=9606 GN=SDCBP PE=1 SV=1 CANONICAL=O00560-1" }, "locus": { "chromosome": "8", "start_pos": 58581737, "end_pos": 58565034, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000520168.5", "url": "https://www.ensembl.org/id/ENST00000520168.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000430730.1", "url": "https://www.ensembl.org/id/ENSP00000430730.1" } ] } }, { "isoform_ac": "E9PBU7-1", "url": "", "sequence": { "sequence": "MSLYPSLEDLKVDKVIQAQTAFSANPANPAILSEASAPIPHDGNLYPRLYPELSQYMGLSLNEEEIRANVAVVSGAPLQGGIFVQLVQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQAFGEKITMTIRDRPFERTITMHKDSTGHVGFIFKNGKITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMPAFIFEHIIKRMAPSIMKSLMDHTIPEV", "length": 244, "header": "tr|E9PBU7-1|SDCB1_HUMAN Computationally mapped isoform of Syntenin-1 OS=Homo sapiens OX=9606 GN=SDCBP PE=1 SV=1 CANONICAL=O00560-1" }, "locus": { "chromosome": "8", "start_pos": 58581737, "end_pos": 58565034, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000447267.4", "url": "https://www.ensembl.org/id/ENST00000447267.4" }, { "database": "Ensembl Peptide", "id": "ENSP00000397820.2", "url": "https://www.ensembl.org/id/ENSP00000397820.2" } ] } }, { "isoform_ac": "G5EA09-1", "url": "", "sequence": { "sequence": "MIKLWTNRDLHIIVMVKNPAKMSLYPSLEDLKVDKVIQAQTAFSANPANPAILSEASAPIPHDGNLYPRLYPELSQYMGLSLNEEEIRANVAVVSGAPLQGLVARPSSINYMVAPVTGNDVGIRRAEIKQGIREVILCKDQDGKIGLRLKSIDNGIFVQLVQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQAFGEKITMTIRDRPFERTITMHKDSTGHVGFIFKNGKITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMPAFIFEHIIKRMAPSIMKSLMDHTIPEV", "length": 318, "header": "tr|G5EA09-1|G5EA09_HUMAN Computationally mapped isoform of Syndecan binding protein OS=Homo sapiens OX=9606 GN=SDCBP PE=1 SV=1 CANONICAL=O00560-1" }, "locus": { "chromosome": "8", "start_pos": 58581737, "end_pos": 58561748, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000630925.1", "url": "https://www.ensembl.org/id/ENST00000630925.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000487245.1", "url": "https://www.ensembl.org/id/ENSP00000487245.1" } ] } }, { "isoform_ac": "O00560-1", "url": "", "sequence": { "sequence": "MSLYPSLEDLKVDKVIQAQTAFSANPANPAILSEASAPIPHDGNLYPRLYPELSQYMGLSLNEEEIRANVAVVSGAPLQGQLVARPSSINYMVAPVTGNDVGIRRAEIKQGIREVILCKDQDGKIGLRLKSIDNGIFVQLVQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQAFGEKITMTIRDRPFERTITMHKDSTGHVGFIFKNGKITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMPAFIFEHIIKRMAPSIMKSLMDHTIPEV", "length": 298, "header": "sp|O00560-1|SDCB1_HUMAN Isoform 1 of Syntenin-1 OS=Homo sapiens OX=9606 GN=SDCBP PE=1 SV=1 CANONICAL=O00560-1" }, "locus": { "chromosome": "8", "start_pos": 58581737, "end_pos": 58565034, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000413219.6", "url": "https://www.ensembl.org/id/ENST00000413219.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000411771.2", "url": "https://www.ensembl.org/id/ENSP00000411771.2" } ] } }, { "isoform_ac": "O00560-2", "url": "", "sequence": { "sequence": "MSLYPSLEDLKVDKVIQAQTAFSANPANPAILSEASAPIPHDGNLYPRLYPELSQYMGLSLNEEEIRANVAVVSGAPLQGLVARPSSINYMVAPVTGNDVGIRRAEIKQGIREVILCKDQDGKIGLRLKSIDNGIFVQLVQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQAFGEKITMTIRDRPFERTITMHKDSTGHVGFIFKNGKITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMPAFIFEHIIKRMAPSIMKSLMDHTIPEV", "length": 297, "header": "sp|O00560-2|SDCB1_HUMAN Isoform 2 of Syntenin-1 OS=Homo sapiens OX=9606 GN=SDCBP PE=1 SV=1 CANONICAL=O00560-1" }, "locus": { "chromosome": "8", "start_pos": 58581737, "end_pos": 58565034, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000447182.6", "url": "https://www.ensembl.org/id/ENST00000447182.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000409288.2", "url": "https://www.ensembl.org/id/ENSP00000409288.2" } ] } }, { "isoform_ac": "O00560-3", "url": "", "sequence": { "sequence": "MSLYPSLEDLKAQTAFSANPANPAILSEASAPIPHDGNLYPRLYPELSQYMGLSLNEEEIRANVAVVSGAPLQGQLVARPSSINYMVAPVTGNDVGIRRAEIKQGIREVILCKDQDGKIGLRLKSIDNGIFVQLVQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQAFGEKITMTIRDRPFERTITMHKDSTGHVGFIFKNGKITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMPAFIFEHIIKRMAPSIMKSLMDHTIPEV", "length": 292, "header": "sp|O00560-3|SDCB1_HUMAN Isoform 3 of Syntenin-1 OS=Homo sapiens OX=9606 GN=SDCBP PE=1 SV=1 CANONICAL=O00560-1" }, "locus": { "chromosome": "8", "start_pos": 58581737, "end_pos": 58565034, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000424270.6", "url": "https://www.ensembl.org/id/ENST00000424270.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000395351.2", "url": "https://www.ensembl.org/id/ENSP00000395351.2" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "evidence": [ { "id": "O00560", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O00560" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "37217939", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37217939" } ] } ], "phosphorylation": [ { "start_pos": 131, "end_pos": 131, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O00560", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O00560" }, { "database": "PubMed", "id": "32572158", "url": "https://glygen.org/publication/PubMed/32572158" } ], "site_lbl": "Ser131" }, { "start_pos": 187, "end_pos": 187, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O00560", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O00560" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Thr187" }, { "start_pos": 200, "end_pos": 200, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O00560", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O00560" }, { "database": "PubMed", "id": "32572158", "url": "https://glygen.org/publication/PubMed/32572158" } ], "site_lbl": "Thr200" }, { "start_pos": 206, "end_pos": 206, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O00560", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O00560" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Thr206" }, { "start_pos": 2, "end_pos": 2, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O00560", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O00560" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Ser2" }, { "start_pos": 46, "end_pos": 46, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine", "evidence": [ { "database": "UniProtKB", "id": "O00560", "url": "https://www.uniprot.org/uniprot/O00560" }, { "database": "PubMed", "id": "24275569", "url": "https://glygen.org/publication/PubMed/24275569" }, { "database": "iPTMnet", "id": "O00560", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O00560" }, { "database": "PubMed", "id": "18083107", "url": "https://glygen.org/publication/PubMed/18083107" }, { "database": "phospho.ELM", "id": "O00560", "url": "http://phospho.elm.eu.org/byAccession/O00560.html" }, { "database": "PubMed", "id": "29109268", "url": "https://glygen.org/publication/PubMed/29109268" } ], "site_lbl": "Tyr46" }, { "start_pos": 4, "end_pos": 4, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O00560", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O00560" }, { "database": "PubMed", "id": "22349701", "url": "https://glygen.org/publication/PubMed/22349701" }, { "database": "PubMed", "id": "22535526", "url": "https://glygen.org/publication/PubMed/22535526" } ], "site_lbl": "Tyr4" }, { "start_pos": 60, "end_pos": 60, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O00560", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O00560" }, { "database": "PubMed", "id": "19007248", "url": "https://glygen.org/publication/PubMed/19007248" } ], "site_lbl": "Ser60" }, { "start_pos": 6, "end_pos": 6, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O00560", "url": "https://www.uniprot.org/uniprot/O00560" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "iPTMnet", "id": "O00560", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O00560" }, { "database": "PubMed", "id": "18578522", "url": "https://glygen.org/publication/PubMed/18578522" }, { "database": "PubMed", "id": "19413330", "url": "https://glygen.org/publication/PubMed/19413330" } ], "site_lbl": "Ser6" }, { "start_pos": 91, "end_pos": 91, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O00560", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O00560" }, { "database": "PubMed", "id": "18083107", "url": "https://glygen.org/publication/PubMed/18083107" }, { "database": "phospho.ELM", "id": "O00560", "url": "http://phospho.elm.eu.org/byAccession/O00560.html" } ], "site_lbl": "Tyr91" } ], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "Phosphorylation of non-muscle myosin II regulatory light chain by p21-activated kinase (gamma-PAK).", "journal": "Journal of muscle research and cell motility", "date": "1998", "authors": "Chew TL, Masaracchia RA, Goeckeler ZM, Wysolmerski RB", "evidence": [ { "database": "Reactome", "id": "R-HSA-3928664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3928664" } ], "reference": [ { "type": "PubMed", "id": "10047984", "url": "https://glygen.org/publication/PubMed/10047984" } ] }, { "title": "A role for a PDZ protein in the early secretory pathway for the targeting of proTGF-alpha to the cell surface.", "journal": "Molecular cell", "date": "1999", "authors": "Fernandez-Larrea J, Merlos-Suarez A, Urena JM, Baselga J, Arribas J", "evidence": [ { "database": "UniProtKB", "id": "O00560", "url": "https://www.uniprot.org/uniprot/O00560" } ], "reference": [ { "type": "PubMed", "id": "10230395", "url": "https://glygen.org/publication/PubMed/10230395" } ] }, { "title": "Syntenin-syndecan binding requires syndecan-synteny and the co-operation of both PDZ domains of syntenin.", "journal": "J. Biol. Chem.", "date": "2000", "authors": "Grootjans J J, Reekmans G, Ceulemans H, David G", "evidence": [ { "database": "UniProtKB", "id": "O00560", "url": "https://www.uniprot.org/uniprot/O00560" } ], "reference": [ { "type": "PubMed", "id": "10770943", "url": "https://glygen.org/publication/PubMed/10770943" } ] }, { "title": "The neural cell recognition molecule neurofascin interacts with syntenin-1 but not with syntenin-2, both of which reveal self-associating activity.", "journal": "J. Biol. Chem.", "date": "2001", "authors": "Koroll M, Rathjen FG, Volkmer H", "evidence": [ { "database": "UniProtKB", "id": "O00560", "url": "https://www.uniprot.org/uniprot/O00560" }, { "database": "Reactome", "id": "R-HSA-447043", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-447043" } ], "reference": [ { "type": "PubMed", "id": "11152476", "url": "https://glygen.org/publication/PubMed/11152476" } ] }, { "title": "Characterization of syntenin, a syndecan-binding PDZ protein, as a component of cell adhesion sites and microfilaments.", "journal": "Molecular biology of the cell", "date": "2001-02", "authors": "Zimmermann P, Tomatis D, Rosas M, Grootjans J, Leenaerts I, Degeest G, Reekmans G, Coomans C, David G", "evidence": [ { "database": "UniProtKB", "id": "O00560", "url": "https://www.uniprot.org/uniprot/O00560" } ], "reference": [ { "type": "PubMed", "id": "11179419", "url": "https://glygen.org/publication/PubMed/11179419" } ] }, { "title": "Schwannomin isoform-1 interacts with syntenin via PDZ domains.", "journal": "J. Biol. Chem.", "date": "2001", "authors": "Jannatipour M, Dion P, Khan S, Jindal H, Fan X, Lagani\u00e8re J, Chishti A H, Rouleau G A", "evidence": [ { "database": "UniProtKB", "id": "O00560", "url": "https://www.uniprot.org/uniprot/O00560" } ], "reference": [ { "type": "PubMed", "id": "11432873", "url": "https://glygen.org/publication/PubMed/11432873" } ] }, { "title": "Cytokine-specific transcriptional regulation through an IL-5Ralpha interacting protein.", "journal": "Science (New York, N.Y.)", "date": "2001-08-10", "authors": "Geijsen N, Uings I J, Pals C, Armstrong J, McKinnon M, Raaijmakers J A, Lammers J W, Koenderman L, Coffer P J", "evidence": [ { "database": "UniProtKB", "id": "O00560", "url": "https://www.uniprot.org/uniprot/O00560" } ], "reference": [ { "type": "PubMed", "id": "11498591", "url": "https://glygen.org/publication/PubMed/11498591" } ] }, { "title": "The SH2/SH3 adaptor Grb4 transduces B-ephrin reverse signals.", "journal": "Nature", "date": "2001", "authors": "Cowan CA, Henkemeyer M", "evidence": [ { "database": "Reactome", "id": "R-HSA-3928664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3928664" } ], "reference": [ { "type": "PubMed", "id": "11557983", "url": "https://glygen.org/publication/PubMed/11557983" } ] }, { "title": "EphrinB phosphorylation and reverse signaling: regulation by Src kinases and PTP-BL phosphatase.", "journal": "Molecular cell", "date": "2002", "authors": "Palmer A, Zimmer M, Erdmann KS, Eulenburg V, Porthin A, Heumann R, Deutsch U, Klein R", "evidence": [ { "database": "Reactome", "id": "R-HSA-3928664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3928664" } ], "reference": [ { "type": "PubMed", "id": "11983165", "url": "https://glygen.org/publication/PubMed/11983165" } ] }, { "title": "Proteomic analysis of early melanosomes: identification of novel melanosomal proteins.", "journal": "J. Proteome Res.", "date": "2003", "authors": "Basrur V, Yang F, Kushimoto T, Higashimoto Y, Yasumoto K, Valencia J, Muller J, Vieira WD, Watabe H, Shabanowitz J, Hearing VJ, Hunt DF, Appella E", "evidence": [ { "database": "UniProtKB", "id": "O00560", "url": "https://www.uniprot.org/uniprot/O00560" } ], "reference": [ { "type": "PubMed", "id": "12643545", "url": "https://glygen.org/publication/PubMed/12643545" } ] }, { "title": "Biology of the p21-activated kinases.", "journal": "Annual review of biochemistry", "date": "2003", "authors": "Bokoch GM", "evidence": [ { "database": "Reactome", "id": "R-HSA-3928664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3928664" } ], "reference": [ { "type": "PubMed", "id": "12676796", "url": "https://glygen.org/publication/PubMed/12676796" } ] }, { "title": "PDZ tandem of human syntenin: crystal structure and functional properties.", "journal": "Structure", "date": "2003", "authors": "Kang Beom Sik, Cooper David R, Jelen Filip, Devedjiev Yancho, Derewenda Urszula, Dauter Zbigniew, Otlewski Jacek, Derewenda Zygmunt S", "evidence": [ { "database": "UniProtKB", "id": "O00560", "url": "https://www.uniprot.org/uniprot/O00560" } ], "reference": [ { "type": "PubMed", "id": "12679023", "url": "https://glygen.org/publication/PubMed/12679023" } ] }, { "title": "Synapse formation is regulated by the signaling adaptor GIT1.", "journal": "The Journal of cell biology", "date": "2003", "authors": "Zhang H, Webb DJ, Asmussen H, Horwitz AF", "evidence": [ { "database": "Reactome", "id": "R-HSA-3928664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3928664" } ], "reference": [ { "type": "PubMed", "id": "12695502", "url": "https://glygen.org/publication/PubMed/12695502" } ] }, { "title": "Molecular roots of degenerate specificity in syntenin's PDZ2 domain: reassessment of the PDZ recognition paradigm.", "journal": "Structure", "date": "2003", "authors": "Kang Beom Sik, Cooper David R, Devedjiev Yancho, Derewenda Urszula, Derewenda Zygmunt S", "evidence": [ { "database": "UniProtKB", "id": "O00560", "url": "https://www.uniprot.org/uniprot/O00560" } ], "reference": [ { "type": "PubMed", "id": "12842047", "url": "https://glygen.org/publication/PubMed/12842047" } ] }, { "title": "The PDZ2 domain of syntenin at ultra-high resolution: bridging the gap between macromolecular and small molecule crystallography.", "journal": "J. Mol. Biol.", "date": "2004", "authors": "Kang Beom Sik, Devedjiev Yancho, Derewenda Urszula, Derewenda Zygmunt S", "evidence": [ { "database": "UniProtKB", "id": "O00560", "url": "https://www.uniprot.org/uniprot/O00560" } ], "reference": [ { "type": "PubMed", "id": "15081807", "url": "https://glygen.org/publication/PubMed/15081807" } ] }, { "title": "A GIT1/PIX/Rac/PAK signaling module regulates spine morphogenesis and synapse formation through MLC.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "date": "2005", "authors": "Zhang H, Webb DJ, Asmussen H, Niu S, Horwitz AF", "evidence": [ { "database": "Reactome", "id": "R-HSA-3928664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3928664" } ], "reference": [ { "type": "PubMed", "id": "15800193", "url": "https://glygen.org/publication/PubMed/15800193" } ] }, { "title": "Distinct BIR domains of cIAP1 mediate binding to and ubiquitination of tumor necrosis factor receptor-associated factor 2 and second mitochondrial activator of caspases.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Samuel T, Welsh K, Lober T, Togo SH, Zapata JM, Reed JC", "evidence": [ { "database": "Reactome", "id": "R-HSA-5675482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5675482" } ], "reference": [ { "type": "PubMed", "id": "16282325", "url": "https://glygen.org/publication/PubMed/16282325" } ] }, { "title": "The binding of the PDZ tandem of syntenin to target proteins.", "journal": "Biochemistry", "date": "2006", "authors": "Grembecka Jolanta, Cierpicki Tomasz, Devedjiev Yancho, Derewenda Urszula, Kang Beom Sik, Bushweller John H, Derewenda Zygmunt S", "evidence": [ { "database": "UniProtKB", "id": "O00560", "url": "https://www.uniprot.org/uniprot/O00560" } ], "reference": [ { "type": "PubMed", "id": "16533050", "url": "https://glygen.org/publication/PubMed/16533050" } ] }, { "title": "Proteomic and bioinformatic characterization of the biogenesis and function of melanosomes.", "journal": "J. Proteome Res.", "date": "2006", "authors": "Chi A, Valencia JC, Hu ZZ, Watabe H, Yamaguchi H, Mangini NJ, Huang H, Canfield VA, Cheng KC, Yang F, Abe R, Yamagishi S, Shabanowitz J, Hearing VJ, Wu C, Appella E, Hunt DF", "evidence": [ { "database": "UniProtKB", "id": "O00560", "url": "https://www.uniprot.org/uniprot/O00560" } ], "reference": [ { "type": "PubMed", "id": "17081065", "url": "https://glygen.org/publication/PubMed/17081065" } ] }, { "title": "Grb4 and GIT1 transduce ephrinB reverse signals modulating spine morphogenesis and synapse formation.", "journal": "Nature neuroscience", "date": "2007", "authors": "Segura I, Essmann CL, Weinges S, Acker-Palmer A", "evidence": [ { "database": "Reactome", "id": "R-HSA-3928664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3928664" } ], "reference": [ { "type": "PubMed", "id": "17310244", "url": "https://glygen.org/publication/PubMed/17310244" } ] }, { "title": "Cleavage of RIP3 inactivates its caspase-independent apoptosis pathway by removal of kinase domain.", "journal": "Cellular signalling", "date": "2007", "authors": "Feng S, Yang Y, Mei Y, Ma L, Zhu DE, Hoti N, Castanares M, Wu M", "evidence": [ { "database": "Reactome", "id": "R-HSA-5675482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5675482" } ], "reference": [ { "type": "PubMed", "id": "17644308", "url": "https://glygen.org/publication/PubMed/17644308" } ] }, { "title": "Global survey of phosphotyrosine signaling identifies oncogenic kinases in lung cancer.", "journal": "Cell", "date": "2007", "authors": "Rikova K, Guo A, Zeng Q, Possemato A, Yu J, Haack H, Nardone J, Lee K, Reeves C, Li Y, Hu Y, Tan Z, Stokes M, Sullivan L, Mitchell J, Wetzel R, Macneill J, Ren JM, Yuan J, Bakalarski CE, Villen J, Kornhauser JM, Smith B, Li D, Zhou X, Gygi SP, Gu TL, Polakiewicz RD, Rush J, Comb MJ", "evidence": [ { "database": "iPTMnet", "id": "O00560-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O00560-1" } ], "reference": [ { "type": "PubMed", "id": "18083107", "url": "https://glygen.org/publication/PubMed/18083107" } ] }, { "title": "cIAP1 and cIAP2 facilitate cancer cell survival by functioning as E3 ligases that promote RIP1 ubiquitination.", "journal": "Molecular cell", "date": "2008", "authors": "Bertrand MJ, Milutinovic S, Dickson KM, Ho WC, Boudreault A, Durkin J, Gillard JW, Jaquith JB, Morris SJ, Barker PA", "evidence": [ { "database": "Reactome", "id": "R-HSA-5675482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5675482" } ], "reference": [ { "type": "PubMed", "id": "18570872", "url": "https://glygen.org/publication/PubMed/18570872" } ] }, { "title": "TiO(2)-based phosphoproteomic analysis of the plasma membrane and the effects of phosphatase inhibitor treatment.", "journal": "Journal of proteome research", "date": "2008", "authors": "Thingholm TE, Larsen MR, Ingrell CR, Kassem M, Jensen ON", "evidence": [ { "database": "iPTMnet", "id": "O00560-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O00560-1" } ], "reference": [ { "type": "PubMed", "id": "18578522", "url": "https://glygen.org/publication/PubMed/18578522" } ] }, { "title": "Evaluation of the low-specificity protease elastase for large-scale phosphoproteome analysis.", "journal": "Analytical chemistry", "date": "2008", "authors": "Wang B, Malik R, Nigg EA, Korner R", "evidence": [ { "database": "iPTMnet", "id": "O00560-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O00560-1" } ], "reference": [ { "type": "PubMed", "id": "19007248", "url": "https://glygen.org/publication/PubMed/19007248" } ] }, { "title": "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.", "journal": "Analytical chemistry", "date": "2009", "authors": "Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S", "evidence": [ { "database": "iPTMnet", "id": "O00560-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O00560-1" } ], "reference": [ { "type": "PubMed", "id": "19413330", "url": "https://glygen.org/publication/PubMed/19413330" } ] }, { "title": "Receptor interacting protein kinase-3 determines cellular necrotic response to TNF-alpha.", "journal": "Cell", "date": "2009", "authors": "He S, Wang L, Miao L, Wang T, Du F, Zhao L, Wang X", "evidence": [ { "database": "Reactome", "id": "R-HSA-5213460", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5213460" } ], "reference": [ { "type": "PubMed", "id": "19524512", "url": "https://glygen.org/publication/PubMed/19524512" } ] }, { "title": "Phosphorylation-driven assembly of the RIP1-RIP3 complex regulates programmed necrosis and virus-induced inflammation.", "journal": "Cell", "date": "2009", "authors": "Cho YS, Challa S, Moquin D, Genga R, Ray TD, Guildford M, Chan FK", "evidence": [ { "database": "Reactome", "id": "R-HSA-5213460", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5213460" } ], "reference": [ { "type": "PubMed", "id": "19524513", "url": "https://glygen.org/publication/PubMed/19524513" } ] }, { "title": "Ephrin-B1 and ephrin-B2 mediate EphB-dependent presynaptic development via syntenin-1.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2009", "authors": "McClelland AC, Sheffler-Collins SI, Kayser MS, Dalva MB", "evidence": [ { "database": "Reactome", "id": "R-HSA-3928664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3928664" } ], "reference": [ { "type": "PubMed", "id": "19915143", "url": "https://glygen.org/publication/PubMed/19915143" } ] }, { "title": "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.", "journal": "Science signaling", "date": "2010", "authors": "Olsen JV, Vermeulen M, Santamaria A, Kumar C, Miller ML, Jensen LJ, Gnad F, Cox J, Jensen TS, Nigg EA, Brunak S, Mann M", "evidence": [ { "database": "iPTMnet", "id": "O00560-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O00560-1" } ], "reference": [ { "type": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ] }, { "title": "cIAPs block Ripoptosome formation, a RIP1/caspase-8 containing intracellular cell death complex differentially regulated by cFLIP isoforms.", "journal": "Molecular cell", "date": "2011", "authors": "Feoktistova M, Geserick P, Kellert B, Dimitrova DP, Langlais C, Hupe M, Cain K, MacFarlane M, Hacker G, Leverkus M", "evidence": [ { "database": "Reactome", "id": "R-HSA-5675482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5675482" } ], "reference": [ { "type": "PubMed", "id": "21737330", "url": "https://glygen.org/publication/PubMed/21737330" } ] }, { "title": "Mixed lineage kinase domain-like protein mediates necrosis signaling downstream of RIP3 kinase.", "journal": "Cell", "date": "2012", "authors": "Sun L, Wang H, Wang Z, He S, Chen S, Liao D, Wang L, Yan J, Liu W, Lei X, Wang X", "evidence": [ { "database": "Reactome", "id": "R-HSA-5213460", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5213460" } ], "reference": [ { "type": "PubMed", "id": "22265413", "url": "https://glygen.org/publication/PubMed/22265413" } ] }, { "title": "Association of syntenin-1 with M-RIP polarizes Rac-1 activation during chemotaxis and immune interactions.", "journal": "Journal of cell science", "date": "2012", "authors": "Sala-Valdes M, Gordon-Alonso M, Tejera E, Ibanez A, Cabrero JR, Ursa A, Mittelbrunn M, Lozano F, Sanchez-Madrid F, Yanez-Mo M", "evidence": [ { "database": "iPTMnet", "id": "O00560", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O00560" } ], "reference": [ { "type": "PubMed", "id": "22349701", "url": "https://glygen.org/publication/PubMed/22349701" } ] }, { "title": "Mixed lineage kinase domain-like is a key receptor interacting protein 3 downstream component of TNF-induced necrosis.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2012", "authors": "Zhao J, Jitkaew S, Cai Z, Choksi S, Li Q, Luo J, Liu ZG", "evidence": [ { "database": "Reactome", "id": "R-HSA-5213460", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5213460" } ], "reference": [ { "type": "PubMed", "id": "22421439", "url": "https://glygen.org/publication/PubMed/22421439" } ] }, { "title": "The PDZ-adaptor protein syntenin-1 regulates HIV-1 entry.", "journal": "Molecular biology of the cell", "date": "2012", "authors": "Gordon-Alonso M, Rocha-Perugini V, Alvarez S, Moreno-Gonzalo O, Ursa A, Lopez-Martin S, Izquierdo-Useros N, Martinez-Picado J, Munoz-Fernandez MA, Yanez-Mo M, Sanchez-Madrid F", "evidence": [ { "database": "iPTMnet", "id": "O00560", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O00560" } ], "reference": [ { "type": "PubMed", "id": "22535526", "url": "https://glygen.org/publication/PubMed/22535526" } ] }, { "title": "Syndecan-syntenin-ALIX regulates the biogenesis of exosomes.", "journal": "Nature cell biology", "date": "2012", "authors": "Baietti MF, Zhang Z, Mortier E, Melchior A, Degeest G, Geeraerts A, Ivarsson Y, Depoortere F, Coomans C, Vermeiren E, Zimmermann P, David G", "evidence": [ { "database": "UniProtKB", "id": "O00560", "url": "https://www.uniprot.org/uniprot/O00560" } ], "reference": [ { "type": "PubMed", "id": "22660413", "url": "https://glygen.org/publication/PubMed/22660413" } ] }, { "title": "The RIP1/RIP3 necrosome forms a functional amyloid signaling complex required for programmed necrosis.", "journal": "Cell", "date": "2012", "authors": "Li J, McQuade T, Siemer AB, Napetschnig J, Moriwaki K, Hsiao YS, Damko E, Moquin D, Walz T, McDermott A, Chan FK, Wu H", "evidence": [ { "database": "Reactome", "id": "R-HSA-5213460", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5213460" } ], "reference": [ { "type": "PubMed", "id": "22817896", "url": "https://glygen.org/publication/PubMed/22817896" } ] }, { "title": "Toward a comprehensive characterization of a human cancer cell phosphoproteome.", "journal": "Journal of proteome research", "date": "2013", "authors": "Zhou H, Di Palma S, Preisinger C, Peng M, Polat AN, Heck AJ, Mohammed S", "evidence": [ { "database": "UniProtKB", "id": "O00560", "url": "https://www.uniprot.org/uniprot/O00560" }, { "database": "iPTMnet", "id": "O00560", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O00560" } ], "reference": [ { "type": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" } ] }, { "title": "Proteome wide purification and identification of O-GlcNAc-modified proteins using click chemistry and mass spectrometry.", "journal": "Journal of proteome research", "date": "2013", "authors": "Hahne H, Sobotzki N, Nyberg T, Helm D, Borodkin VS, van Aalten DM, Agnew B, Kuster B", "evidence": [ { "database": "O-GlcNAc Database", "id": "O00560", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O00560" } ], "reference": [ { "type": "PubMed", "id": "23301498", "url": "https://glygen.org/publication/PubMed/23301498" } ] }, { "title": "Proteome profiling of human neutrophil granule subsets, secretory vesicles, and cell membrane: correlation with transcriptome profiling of neutrophil precursors.", "journal": "Journal of leukocyte biology", "date": "2013", "authors": "Rorvig S, Ostergaard O, Heegaard NH, Borregaard N", "evidence": [ { "database": "Reactome", "id": "R-HSA-6798695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6798695" } ], "reference": [ { "type": "PubMed", "id": "23650620", "url": "https://glygen.org/publication/PubMed/23650620" } ] }, { "title": "Positive and negative phosphorylation regulates RIP1- and RIP3-induced programmed necrosis.", "journal": "The Biochemical journal", "date": "2013", "authors": "McQuade T, Cho Y, Chan FK", "evidence": [ { "database": "Reactome", "id": "R-HSA-5213460", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5213460" } ], "reference": [ { "type": "PubMed", "id": "24059293", "url": "https://glygen.org/publication/PubMed/24059293" } ] }, { "title": "An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.", "journal": "Journal of proteomics", "date": "2014", "authors": "Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H", "evidence": [ { "database": "UniProtKB", "id": "O00560", "url": "https://www.uniprot.org/uniprot/O00560" }, { "database": "iPTMnet", "id": "O00560", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O00560" } ], "reference": [ { "type": "PubMed", "id": "24275569", "url": "https://glygen.org/publication/PubMed/24275569" } ] }, { "title": "Plasma membrane translocation of trimerized MLKL protein is required for TNF-induced necroptosis.", "journal": "Nature cell biology", "date": "2014", "authors": "Cai Z, Jitkaew S, Zhao J, Chiang HC, Choksi S, Liu J, Ward Y, Wu LG, Liu ZG", "evidence": [ { "database": "Reactome", "id": "R-HSA-5213460", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5213460" } ], "reference": [ { "type": "PubMed", "id": "24316671", "url": "https://glygen.org/publication/PubMed/24316671" } ] }, { "title": "Mixed lineage kinase domain-like protein MLKL causes necrotic membrane disruption upon phosphorylation by RIP3.", "journal": "Molecular cell", "date": "2014", "authors": "Wang H, Sun L, Su L, Rizo J, Liu L, Wang LF, Wang FS, Wang X", "evidence": [ { "database": "Reactome", "id": "R-HSA-5213460", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5213460" } ], "reference": [ { "type": "PubMed", "id": "24703947", "url": "https://glygen.org/publication/PubMed/24703947" } ] }, { "title": "MLKL compromises plasma membrane integrity by binding to phosphatidylinositol phosphates.", "journal": "Cell reports", "date": "2014", "authors": "Dondelinger Y, Declercq W, Montessuit S, Roelandt R, Goncalves A, Bruggeman I, Hulpiau P, Weber K, Sehon CA, Marquis RW, Bertin J, Gough PJ, Savvides S, Martinou JC, Bertrand MJ, Vandenabeele P", "evidence": [ { "database": "Reactome", "id": "R-HSA-5213460", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5213460" } ], "reference": [ { "type": "PubMed", "id": "24813885", "url": "https://glygen.org/publication/PubMed/24813885" } ] }, { "title": "Targeting tumor invasion: the roles of MDA-9/Syntenin.", "journal": "Expert Opin. Ther. Targets", "date": "2015", "authors": "Kegelman Timothy P, Das Swadesh K, Emdad Luni, Hu Bin, Menezes Mitchell E, Bhoopathi Praveen, Wang Xiang-Yang, Pellecchia Maurizio, Sarkar Devanand, Fisher Paul B", "evidence": [ { "database": "UniProtKB", "id": "O00560", "url": "https://www.uniprot.org/uniprot/O00560" } ], "reference": [ { "type": "PubMed", "id": "25219541", "url": "https://glygen.org/publication/PubMed/25219541" } ] }, { "title": "A cytosolic heat shock protein 90 and cochaperone CDC37 complex is required for RIP3 activation during necroptosis.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2015", "authors": "Li D, Xu T, Cao Y, Wang H, Li L, Chen S, Wang X, Shen Z", "evidence": [ { "database": "Reactome", "id": "R-HSA-5675482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5675482" } ], "reference": [ { "type": "PubMed", "id": "25852146", "url": "https://glygen.org/publication/PubMed/25852146" } ] }, { "title": "Syntenin regulates TGF-beta1-induced Smad activation and the epithelial-to-mesenchymal transition by inhibiting caveolin-mediated TGF-beta type I receptor internalization.", "journal": "Oncogene", "date": "2016", "authors": "Hwangbo C, Tae N, Lee S, Kim O, Park OK, Kim J, Kwon SH, Lee JH", "evidence": [ { "database": "UniProtKB", "id": "O00560", "url": "https://www.uniprot.org/uniprot/O00560" } ], "reference": [ { "type": "PubMed", "id": "25893292", "url": "https://glygen.org/publication/PubMed/25893292" } ] }, { "title": "A cellular screen identifies ponatinib and pazopanib as inhibitors of necroptosis.", "journal": "Cell death & disease", "date": "2015", "authors": "Fauster A, Rebsamen M, Huber KV, Bigenzahn JW, Stukalov A, Lardeau CH, Scorzoni S, Bruckner M, Gridling M, Parapatics K, Colinge J, Bennett KL, Kubicek S, Krautwald S, Linkermann A, Superti-Furga G", "evidence": [ { "database": "Reactome", "id": "R-HSA-5675482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5675482" } ], "reference": [ { "type": "PubMed", "id": "25996294", "url": "https://glygen.org/publication/PubMed/25996294" } ] }, { "title": "Syntenin and syndecan in the biogenesis of exosomes.", "journal": "Biol. Cell", "date": "2015", "authors": "Friand V\u00e9ronique, David Guido, Zimmermann Pascale", "evidence": [ { "database": "UniProtKB", "id": "O00560", "url": "https://www.uniprot.org/uniprot/O00560" } ], "reference": [ { "type": "PubMed", "id": "26032692", "url": "https://glygen.org/publication/PubMed/26032692" } ] }, { "title": "MDA-9/Syntenin Control.", "journal": "Journal of cellular physiology", "date": "2016-03", "authors": "Philley Julie V, Kannan Anbarasu, Dasgupta Santanu", "evidence": [ { "database": "UniProtKB", "id": "O00560", "url": "https://www.uniprot.org/uniprot/O00560" } ], "reference": [ { "type": "PubMed", "id": "26291527", "url": "https://glygen.org/publication/PubMed/26291527" } ] }, { "title": "Syntenin controls migration, growth, proliferation, and cell cycle progression in cancer cells.", "journal": "Frontiers in pharmacology", "date": "2015", "authors": "Kashyap R, Roucourt B, Lembo F, Fares J, Carcavilla AM, Restouin A, Zimmermann P, Ghossoub R", "evidence": [ { "database": "UniProtKB", "id": "O00560", "url": "https://www.uniprot.org/uniprot/O00560" } ], "reference": [ { "type": "PubMed", "id": "26539120", "url": "https://glygen.org/publication/PubMed/26539120" } ] }, { "title": "HSP90 activity is required for MLKL oligomerisation and membrane translocation and the induction of necroptotic cell death.", "journal": "Cell death & disease", "date": "2016", "authors": "Jacobsen AV, Lowes KN, Tanzer MC, Lucet IS, Hildebrand JM, Petrie EJ, van Delft MF, Liu Z, Conos SA, Zhang JG, Huang DC, Silke J, Lessene G, Murphy JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-5675482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5675482" } ], "reference": [ { "type": "PubMed", "id": "26775703", "url": "https://glygen.org/publication/PubMed/26775703" } ] }, { "title": "Hsp90 modulates the stability of MLKL and is required for TNF-induced necroptosis.", "journal": "Cell death & disease", "date": "2016", "authors": "Zhao XM, Chen Z, Zhao JB, Zhang PP, Pu YF, Jiang SH, Hou JJ, Cui YM, Jia XL, Zhang SQ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5675482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5675482" } ], "reference": [ { "type": "PubMed", "id": "26866270", "url": "https://glygen.org/publication/PubMed/26866270" } ] }, { "title": "CHIP controls necroptosis through ubiquitylation- and lysosome-dependent degradation of RIPK3.", "journal": "Nature cell biology", "date": "2016", "authors": "Seo J, Lee EW, Sung H, Seong D, Dondelinger Y, Shin J, Jeong M, Lee HK, Kim JH, Han SY, Lee C, Seong JK, Vandenabeele P, Song J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5675482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5675482" } ], "reference": [ { "type": "PubMed", "id": "26900751", "url": "https://glygen.org/publication/PubMed/26900751" } ] }, { "title": "An Inducible Retroviral Expression System for Tandem Affinity Purification Mass-Spectrometry-Based Proteomics Identifies Mixed Lineage Kinase Domain-like Protein (MLKL) as an Heat Shock Protein 90 (HSP90) Client.", "journal": "Molecular & cellular proteomics : MCP", "date": "2016", "authors": "Bigenzahn JW, Fauster A, Rebsamen M, Kandasamy RK, Scorzoni S, Vladimer GI, Muller AC, Gstaiger M, Zuber J, Bennett KL, Superti-Furga G", "evidence": [ { "database": "Reactome", "id": "R-HSA-5675482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5675482" } ], "reference": [ { "type": "PubMed", "id": "26933192", "url": "https://glygen.org/publication/PubMed/26933192" } ] }, { "title": "Frizzled 7 and PIP2 binding by syntenin PDZ2 domain supports Frizzled 7 trafficking and signalling.", "journal": "Nature communications", "date": "2016", "authors": "Egea-Jimenez AL, Gallardo R, Garcia-Pino A, Ivarsson Y, Wawrzyniak AM, Kashyap R, Loris R, Schymkowitz J, Rousseau F, Zimmermann P", "evidence": [ { "database": "UniProtKB", "id": "O00560", "url": "https://www.uniprot.org/uniprot/O00560" } ], "reference": [ { "type": "PubMed", "id": "27386966", "url": "https://glygen.org/publication/PubMed/27386966" } ] }, { "title": "Sorafenib tosylate inhibits directly necrosome complex formation and protects in mouse models of inflammation and tissue injury.", "journal": "Cell death & disease", "date": "2017", "authors": "Martens S, Jeong M, Tonnus W, Feldmann F, Hofmans S, Goossens V, Takahashi N, Brasen JH, Lee EW, Van der Veken P, Joossens J, Augustyns K, Fulda S, Linkermann A, Song J, Vandenabeele P", "evidence": [ { "database": "Reactome", "id": "R-HSA-5675482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5675482" } ], "reference": [ { "type": "PubMed", "id": "28661484", "url": "https://glygen.org/publication/PubMed/28661484" } ] }, { "title": "Syntenin mediates SRC function in exosomal cell-to-cell communication.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2017", "authors": "Imjeti NS, Menck K, Egea-Jimenez AL, Lecointre C, Lembo F, Bouguenina H, Badache A, Ghossoub R, David G, Roche S, Zimmermann P", "evidence": [ { "database": "iPTMnet", "id": "O00560", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O00560" } ], "reference": [ { "type": "PubMed", "id": "29109268", "url": "https://glygen.org/publication/PubMed/29109268" } ] }, { "title": "The Structure of the Necrosome RIPK1-RIPK3 Core, a Human Hetero-Amyloid Signaling Complex.", "journal": "Cell", "date": "2018", "authors": "Mompean M, Li W, Li J, Laage S, Siemer AB, Bozkurt G, Wu H, McDermott AE", "evidence": [ { "database": "Reactome", "id": "R-HSA-5213460", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5213460" } ], "reference": [ { "type": "PubMed", "id": "29681455", "url": "https://glygen.org/publication/PubMed/29681455" } ] }, { "title": "PELI1 Selectively Targets Kinase-Active RIP3 for Ubiquitylation-Dependent Proteasomal Degradation.", "journal": "Molecular cell", "date": "2018", "authors": "Choi SW, Park HH, Kim S, Chung JM, Noh HJ, Kim SK, Song HK, Lee CW, Morgan MJ, Kang HC, Kim YS", "evidence": [ { "database": "Reactome", "id": "R-HSA-5675482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5675482" } ], "reference": [ { "type": "PubMed", "id": "29883609", "url": "https://glygen.org/publication/PubMed/29883609" } ] }, { "title": "MLKL Requires the Inositol Phosphate Code to Execute Necroptosis.", "journal": "Molecular cell", "date": "2018", "authors": "Dovey CM, Diep J, Clarke BP, Hale AT, McNamara DE, Guo H, Brown NW Jr, Cao JY, Grace CR, Gough PJ, Bertin J, Dixon SJ, Fiedler D, Mocarski ES, Kaiser WJ, Moldoveanu T, York JD, Carette JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-5675482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5675482" } ], "reference": [ { "type": "PubMed", "id": "29883610", "url": "https://glygen.org/publication/PubMed/29883610" } ] }, { "title": "Conformational switching of the pseudokinase domain promotes human MLKL tetramerization and cell death by necroptosis.", "journal": "Nature communications", "date": "2018", "authors": "Petrie EJ, Sandow JJ, Jacobsen AV, Smith BJ, Griffin MDW, Lucet IS, Dai W, Young SN, Tanzer MC, Wardak A, Liang LY, Cowan AD, Hildebrand JM, Kersten WJA, Lessene G, Silke J, Czabotar PE, Webb AI, Murphy JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-5213460", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5213460" } ], "reference": [ { "type": "PubMed", "id": "29930286", "url": "https://glygen.org/publication/PubMed/29930286" } ] }, { "title": "O-GlcNAc Transferase Suppresses Inflammation and Necroptosis by Targeting Receptor-Interacting Serine/Threonine-Protein Kinase 3.", "journal": "Immunity", "date": "2019", "authors": "Li X, Gong W, Wang H, Li T, Attri KS, Lewis RE, Kalil AC, Bhinderwala F, Powers R, Yin G, Herring LE, Asara JM, Lei YL, Yang X, Rodriguez DA, Yang M, Green DR, Singh PK, Wen H", "evidence": [ { "database": "Reactome", "id": "R-HSA-5675482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5675482" } ], "reference": [ { "type": "PubMed", "id": "30770249", "url": "https://glygen.org/publication/PubMed/30770249" } ] }, { "title": "Direct Activation of Human MLKL by a Select Repertoire of Inositol Phosphate Metabolites.", "journal": "Cell chemical biology", "date": "2019", "authors": "McNamara DE, Dovey CM, Hale AT, Quarato G, Grace CR, Guibao CD, Diep J, Nourse A, Cai CR, Wu H, Kalathur RC, Green DR, York JD, Carette JE, Moldoveanu T", "evidence": [ { "database": "Reactome", "id": "R-HSA-5675482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5675482" } ], "reference": [ { "type": "PubMed", "id": "31031142", "url": "https://glygen.org/publication/PubMed/31031142" } ] }, { "title": "Flotillin-mediated endocytosis and ALIX-syntenin-1-mediated exocytosis protect the cell membrane from damage caused by necroptosis.", "journal": "Science signaling", "date": "2019", "authors": "Fan W, Guo J, Gao B, Zhang W, Ling L, Xu T, Pan C, Li L, Chen S, Wang H, Zhang J, Wang X", "evidence": [ { "database": "Reactome", "id": "R-HSA-5675482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5675482" } ], "reference": [ { "type": "PubMed", "id": "31138766", "url": "https://glygen.org/publication/PubMed/31138766" } ] }, { "title": "The AMPK-Parkin axis negatively regulates necroptosis and tumorigenesis by inhibiting the necrosome.", "journal": "Nature cell biology", "date": "2019", "authors": "Lee SB, Kim JJ, Han SA, Fan Y, Guo LS, Aziz K, Nowsheen S, Kim SS, Park SY, Luo Q, Chung JO, Choi SI, Aziz A, Yin P, Tong SY, Fiesel FC, Springer W, Zhang JS, Lou Z", "evidence": [ { "database": "Reactome", "id": "R-HSA-5675482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5675482" } ], "reference": [ { "type": "PubMed", "id": "31358971", "url": "https://glygen.org/publication/PubMed/31358971" } ] }, { "title": "Autophosphorylation at serine 166 regulates RIP kinase 1-mediated cell death and inflammation.", "journal": "Nature communications", "date": "2020", "authors": "Laurien L, Nagata M, Schunke H, Delanghe T, Wiederstein JL, Kumari S, Schwarzer R, Corona T, Kruger M, Bertrand MJM, Kondylis V, Pasparakis M", "evidence": [ { "database": "Reactome", "id": "R-HSA-5213460", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5213460" } ], "reference": [ { "type": "PubMed", "id": "32269263", "url": "https://glygen.org/publication/PubMed/32269263" } ] }, { "title": "MLKL trafficking and accumulation at the plasma membrane control the kinetics and threshold for necroptosis.", "journal": "Nature communications", "date": "2020", "authors": "Samson AL, Zhang Y, Geoghegan ND, Gavin XJ, Davies KA, Mlodzianoski MJ, Whitehead LW, Frank D, Garnish SE, Fitzgibbon C, Hempel A, Young SN, Jacobsen AV, Cawthorne W, Petrie EJ, Faux MC, Shield-Artin K, Lalaoui N, Hildebrand JM, Silke J, Rogers KL, Lessene G, Hawkins ED, Murphy JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-5213460", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5213460" } ], "reference": [ { "type": "PubMed", "id": "32561730", "url": "https://glygen.org/publication/PubMed/32561730" } ] }, { "title": "SDCBP/MDA-9/syntenin phosphorylation by AURKA promotes esophageal squamous cell carcinoma progression through the EGFR-PI3K-Akt signaling pathway.", "journal": "Oncogene", "date": "2020-07", "authors": "Du Ruijuan, Huang Chuntian, Chen Hanyong, Liu Kangdong, Xiang Pu, Yao Ning, Yang Lu, Zhou Liting, Wu Qiong, Zheng Yaqiu, Xin Mingxia, Dong Zigang, Li Xiang", "evidence": [ { "database": "iPTMnet", "id": "O00560", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O00560" } ], "reference": [ { "type": "PubMed", "id": "32572158", "url": "https://glygen.org/publication/PubMed/32572158" } ] }, { "title": "Site-specific ubiquitination of MLKL targets it to endosomes and targets Listeria and Yersinia to the lysosomes.", "journal": "Cell death and differentiation", "date": "2022", "authors": "Yoon S, Bogdanov K, Wallach D", "evidence": [ { "database": "Reactome", "id": "R-HSA-5675482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5675482" } ], "reference": [ { "type": "PubMed", "id": "34999730", "url": "https://glygen.org/publication/PubMed/34999730" } ] }, { "title": "Syntenin-1-mediated small extracellular vesicles promotes cell growth, migration, and angiogenesis by increasing onco-miRNAs secretion in lung cancer cells.", "journal": "Cell death & disease", "date": "2022", "authors": "Kim O, Hwangbo C, Tran PT, Lee JH", "evidence": [ { "database": "RefSeq", "id": "NP_001007068", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001007068" } ], "reference": [ { "type": "PubMed", "id": "35136055", "url": "https://glygen.org/publication/PubMed/35136055" } ] }, { "title": "Syntenin-1-mediated arthritogenicity is advanced by reprogramming RA metabolic macrophages and Th1 cells.", "journal": "Annals of the rheumatic diseases", "date": "2023-01-02", "authors": "Meyer Anja, Sienes Ryan E, Nijim Wes, Zanotti Brian, Umar Sadiq, Volin Michael V, Van Raemdonck Katrien, Lewis Myles, Pitzalis Costantino, Arami Shiva, Al-Awqati Mina, Chang Huan J, Jetanalin Pim, Schett Georg, Sweiss Nadera, Shahrara Shiva", "evidence": [ { "database": "RefSeq", "id": "NP_001007068", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001007068" } ], "reference": [ { "type": "PubMed", "id": "36593091", "url": "https://glygen.org/publication/PubMed/36593091" } ] }, { "title": "SDCBP promotes pancreatic cancer progression by preventing YAP1 from \u03b2-TrCP-mediated proteasomal degradation.", "journal": "Gut", "date": "2023-09", "authors": "Liu Jing, Bai Weiwei, Zhou Tianxing, Xie Yongjie, Yang Bo, Sun Jingyan, Wang Yifei, Li Xueyang, Hou Xupeng, Liu Ziyun, Fu Danqi, Yan Jingrui, Jiang Wenna, Zhao Kaili, Zhou Bodong, Yuan Shuai, Guo Yu, Wang Hongwei, Chang Antao, Gao Song, Shi Lei, Huang Chongbiao, Yang Shengyu, Hao Jihui", "evidence": [ { "database": "RefSeq", "id": "NP_001007068", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001007068" } ], "reference": [ { "type": "PubMed", "id": "36828627", "url": "https://glygen.org/publication/PubMed/36828627" } ] }, { "title": "Extracellular arginine availability modulates eIF2\u03b1 O-GlcNAcylation and heme oxygenase 1 translation for cellular homeostasis.", "journal": "Journal of biomedical science", "date": "2023-05-22", "authors": "Hung Yu-Wen, Ouyang Ching, Ping Xiaoli, Qi Yue, Wang Yi-Chang, Kung Hsing-Jien, Ann David K", "evidence": [ { "database": "O-GlcNAc Database", "id": "O00560", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O00560" } ], "reference": [ { "type": "PubMed", "id": "37217939", "url": "https://glygen.org/publication/PubMed/37217939" } ] }, { "title": "The Multifunctional Protein Syntenin-1: Regulator of Exosome Biogenesis, Cellular Function, and Tumor Progression.", "journal": "International journal of molecular sciences", "date": "2023-05-29", "authors": "Lee Kwang-Min, Seo Eun-Chan, Lee Jeong-Hyung, Kim Hyo-Jin, Hwangbo Cheol", "evidence": [ { "database": "RefSeq", "id": "NP_001007068", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001007068" } ], "reference": [ { "type": "PubMed", "id": "37298370", "url": "https://glygen.org/publication/PubMed/37298370" } ] }, { "title": "Anaplasma phagocytophilum Ats-1 enhances exosome secretion through Syntenin-1.", "journal": "BMC microbiology", "date": "2023-09-27", "authors": "Li Ruirui, Ma Zhongchen, Zheng Wei, Xiao Yangyang, Wang Zhen, Yi Jihai, Wang Yong, Chen Chuangfu", "evidence": [ { "database": "RefSeq", "id": "NP_001007068", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001007068" } ], "reference": [ { "type": "PubMed", "id": "37759206", "url": "https://glygen.org/publication/PubMed/37759206" } ] }, { "title": "Targeting of proteins to granule subsets is determined by timing and not by sorting: The specific granule protein NGAL is localized to azurophil granules when expressed in HL-60 cells.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1996", "authors": "Le Cabec V, Cowland JB, Calafat J, Borregaard N", "evidence": [ { "database": "Reactome", "id": "R-HSA-6798695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6798695" } ], "reference": [ { "type": "PubMed", "id": "8692836", "url": "https://glygen.org/publication/PubMed/8692836" } ] }, { "title": "Neurofascin induces neurites by heterophilic interactions with axonal NrCAM while NrCAM requires F11 on the axonal surface to extend neurites.", "journal": "The Journal of cell biology", "date": "1996", "authors": "Volkmer H, Leuschner R, Zacharias U, Rathjen FG", "evidence": [ { "database": "Reactome", "id": "R-HSA-447043", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-447043" } ], "reference": [ { "type": "PubMed", "id": "8922386", "url": "https://glygen.org/publication/PubMed/8922386" } ] }, { "title": "The phosphorylation state of the FIGQY tyrosine of neurofascin determines ankyrin-binding activity and patterns of cell segregation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1997", "authors": "Tuvia S, Garver TD, Bennett V", "evidence": [ { "database": "Reactome", "id": "R-HSA-447043", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-447043" } ], "reference": [ { "type": "PubMed", "id": "9371782", "url": "https://glygen.org/publication/PubMed/9371782" } ] }, { "title": "Syntenin, a PDZ protein that binds syndecan cytoplasmic domains.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1997", "authors": "Grootjans JJ, Zimmermann P, Reekmans G, Smets A, Degeest G, Durr J, David G", "evidence": [ { "database": "UniProtKB", "id": "O00560", "url": "https://www.uniprot.org/uniprot/O00560" } ], "reference": [ { "type": "PubMed", "id": "9391086", "url": "https://glygen.org/publication/PubMed/9391086" } ] }, { "title": "Melanoma differentiation associated gene-9, mda-9, is a human gamma interferon responsive gene.", "journal": "Gene", "date": "1998", "authors": "Lin JJ, Jiang H, Fisher PB", "evidence": [ { "database": "UniProtKB", "id": "O00560", "url": "https://www.uniprot.org/uniprot/O00560" } ], "reference": [ { "type": "PubMed", "id": "9511750", "url": "https://glygen.org/publication/PubMed/9511750" } ] }, { "title": "Structural requirements for association of neurofascin with ankyrin.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Zhang X, Davis JQ, Carpenter S, Bennett V", "evidence": [ { "database": "Reactome", "id": "R-HSA-447043", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-447043" } ], "reference": [ { "type": "PubMed", "id": "9804856", "url": "https://glygen.org/publication/PubMed/9804856" } ] }, { "title": "PDZ proteins bind, cluster, and synaptically colocalize with Eph receptors and their ephrin ligands.", "journal": "Neuron", "date": "1998", "authors": "Torres R, Firestein BL, Dong H, Staudinger J, Olson EN, Huganir RL, Bredt DS, Gale NW, Yancopoulos GD", "evidence": [ { "database": "UniProtKB", "id": "O00560", "url": "https://www.uniprot.org/uniprot/O00560" } ], "reference": [ { "type": "PubMed", "id": "9883737", "url": "https://glygen.org/publication/PubMed/9883737" } ] } ], "pathway": [ { "id": "R-HSA-3928664", "name": "Ephrin signaling", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3928664", "resource": "Reactome", "description": "Ephrin signaling" }, { "id": "R-HSA-447043", "name": "Neurofascin interactions", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-447043", "resource": "Reactome", "description": "Neurofascin interactions" }, { "id": "R-HSA-5213460", "name": "RIPK1-mediated regulated necrosis", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5213460", "resource": "Reactome", "description": "RIPK1-mediated regulated necrosis" }, { "id": "R-HSA-5675482", "name": "Regulation of necroptotic cell death", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5675482", "resource": "Reactome", "description": "Regulation of necroptotic cell death" }, { "id": "R-HSA-6798695", "name": "Neutrophil degranulation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6798695", "resource": "Reactome", "description": "Neutrophil degranulation" } ], "orthologs": [ { "uniprot_canonical_ac": "O08992-1", "protein_name": "Syntenin-1", "gene_name": "Sdcbp", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MSLYPSLEDLKVDKVIQAQTAYSANPASQAFVLVDASAALPPDGNLYPKLYPELSQYMGLSLNEAEICESMPMVSGAPAQGQLVARPSSVNYMVAPVTGNDAGIRRAEIKQGIREVILCKDQDGKIGLRLKSIDNGIFVQLVQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQAFGEKITMTIRDRPFERTVTMHKDSSGHVGFIFKSGKITSIVKDSSAARNGLLTDHHICEINGQNVIGLKDAQIADILSTAGTVVTITIMPTFIFEHIIKRMAPSIMKSLMDHTIPEV", "length": 299 }, "evidence": [ { "id": "45919102", "url": "http://www.informatics.jax.org/homology/45919102", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q9JI92-1", "protein_name": "Syntenin-1", "gene_name": "Sdcbp", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MSLYPSLEDLKVDKVIQAQTASSANPASQAFFLNVVDSAAFPPGGNLYPKLYPELSQYMGLSLSEAEICENMPVVSGAPTQGQLVARPSSVNYMVAPVTGNDAGIRRAEIKQGIREVILCKDQDGKIGLRLKSVDNGIFVQLVQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQAFGEKITMTIRDRPFERTVTMHKDSSGHVGFIFKSGKITSIVKDSSAARNGLLTDHHICEINGQNVIGLKDAQIADILSTAGTVVTITIMPAFIFEHIIKRMAPSIMKSLMDHTIPEV", "length": 300 }, "evidence": [ { "id": "45919102", "url": "http://www.informatics.jax.org/homology/45919102", "database": "MGI" } ], "common_name": "Rat" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 21, "go_terms": [ { "name": "nucleoplasm", "id": "GO:0005654", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654", "evidence": [ { "database": "UniProtKB", "id": "O00560", "url": "https://www.uniprot.org/uniprot/O00560" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "O00560", "url": "https://www.uniprot.org/uniprot/O00560" } ], "pmid": "" }, { "name": "nuclear membrane", "id": "GO:0031965", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031965", "evidence": [ { "database": "UniProtKB", "id": "O00560", "url": "https://www.uniprot.org/uniprot/O00560" } ], "pmid": "" }, { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "O00560", "url": "https://www.uniprot.org/uniprot/O00560" } ], "pmid": "" }, { "name": "extracellular region", "id": "GO:0005576", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576", "evidence": [ { "database": "UniProtKB", "id": "O00560", "url": "https://www.uniprot.org/uniprot/O00560" } ], "pmid": "" }, { "name": "extracellular space", "id": "GO:0005615", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005615", "evidence": [ { "database": "UniProtKB", "id": "O00560", "url": "https://www.uniprot.org/uniprot/O00560" } ], "pmid": "" }, { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "O00560", "url": "https://www.uniprot.org/uniprot/O00560" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "O00560", "url": "https://www.uniprot.org/uniprot/O00560" } ], "pmid": "" }, { "name": "cytoskeleton", "id": "GO:0005856", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005856", "evidence": [ { "database": "UniProtKB", "id": "O00560", "url": "https://www.uniprot.org/uniprot/O00560" } ], "pmid": "" }, { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "O00560", "url": "https://www.uniprot.org/uniprot/O00560" } ], "pmid": "" }, { "name": "adherens junction", "id": "GO:0005912", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005912", "evidence": [ { "database": "UniProtKB", "id": "O00560", "url": "https://www.uniprot.org/uniprot/O00560" } ], "pmid": "" }, { "name": "focal adhesion", "id": "GO:0005925", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005925", "evidence": [ { "database": "UniProtKB", "id": "O00560", "url": "https://www.uniprot.org/uniprot/O00560" } ], "pmid": "" }, { "name": "membrane raft", "id": "GO:0045121", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045121", "evidence": [ { "database": "UniProtKB", "id": "O00560", "url": "https://www.uniprot.org/uniprot/O00560" } ], "pmid": "" }, { "name": "extracellular exosome", "id": "GO:0070062", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070062", "evidence": [ { "database": "UniProtKB", "id": "O00560", "url": "https://www.uniprot.org/uniprot/O00560" } ], "pmid": "" }, { "name": "blood microparticle", "id": "GO:0072562", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0072562", "evidence": [ { "database": "UniProtKB", "id": "O00560", "url": "https://www.uniprot.org/uniprot/O00560" } ], "pmid": "" }, { "name": "endoplasmic reticulum membrane", "id": "GO:0005789", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005789", "evidence": [ { "database": "UniProtKB", "id": "O00560", "url": "https://www.uniprot.org/uniprot/O00560" } ], "pmid": "" }, { "name": "azurophil granule lumen", "id": "GO:0035578", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035578", "evidence": [ { "database": "UniProtKB", "id": "O00560", "url": "https://www.uniprot.org/uniprot/O00560" } ], "pmid": "" }, { "name": "melanosome", "id": "GO:0042470", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042470", "evidence": [ { "database": "UniProtKB", "id": "O00560", "url": "https://www.uniprot.org/uniprot/O00560" } ], "pmid": "" }, { "name": "extracellular vesicle", "id": "GO:1903561", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1903561", "evidence": [ { "database": "UniProtKB", "id": "O00560", "url": "https://www.uniprot.org/uniprot/O00560" } ], "pmid": "" }, { "name": "presynapse", "id": "GO:0098793", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0098793", "evidence": [ { "database": "UniProtKB", "id": "O00560", "url": "https://www.uniprot.org/uniprot/O00560" } ], "pmid": "" }, { "name": "interleukin-5 receptor complex", "id": "GO:0005895", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005895", "evidence": [ { "database": "UniProtKB", "id": "O00560", "url": "https://www.uniprot.org/uniprot/O00560" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 20, "go_terms": [ { "name": "proteolysis", "id": "GO:0006508", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006508", "evidence": [ { "database": "UniProtKB", "id": "O00560", "url": "https://www.uniprot.org/uniprot/O00560" } ], "pmid": "" }, { "name": "presynapse assembly", "id": "GO:0099054", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0099054", "evidence": [ { "database": "UniProtKB", "id": "O00560", "url": "https://www.uniprot.org/uniprot/O00560" } ], "pmid": "" }, { "name": "negative regulation of transcription by RNA polymerase II", "id": "GO:0000122", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000122", "evidence": [ { "database": "UniProtKB", "id": "O00560", "url": "https://www.uniprot.org/uniprot/O00560" } ], "pmid": "" }, { "name": "positive regulation of cell population proliferation", "id": "GO:0008284", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008284", "evidence": [ { "database": "UniProtKB", "id": "O00560", "url": "https://www.uniprot.org/uniprot/O00560" } ], "pmid": "" }, { "name": "positive regulation of cell growth", "id": "GO:0030307", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030307", "evidence": [ { "database": "UniProtKB", "id": "O00560", "url": "https://www.uniprot.org/uniprot/O00560" } ], "pmid": "" }, { "name": "positive regulation of cell migration", "id": "GO:0030335", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030335", "evidence": [ { "database": "UniProtKB", "id": "O00560", "url": "https://www.uniprot.org/uniprot/O00560" } ], "pmid": "" }, { "name": "intracellular signal transduction", "id": "GO:0035556", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035556", "evidence": [ { "database": "UniProtKB", "id": "O00560", "url": "https://www.uniprot.org/uniprot/O00560" } ], "pmid": "" }, { "name": "positive regulation of JNK cascade", "id": "GO:0046330", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046330", "evidence": [ { "database": "UniProtKB", "id": "O00560", "url": "https://www.uniprot.org/uniprot/O00560" } ], "pmid": "" }, { "name": "protein targeting to membrane", "id": "GO:0006612", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006612", "evidence": [ { "database": "UniProtKB", "id": "O00560", "url": "https://www.uniprot.org/uniprot/O00560" } ], "pmid": "" }, { "name": "chemical synaptic transmission", "id": "GO:0007268", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007268", "evidence": [ { "database": "UniProtKB", "id": "O00560", "url": "https://www.uniprot.org/uniprot/O00560" } ], "pmid": "" }, { "name": "actin cytoskeleton organization", "id": "GO:0030036", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030036", "evidence": [ { "database": "UniProtKB", "id": "O00560", "url": "https://www.uniprot.org/uniprot/O00560" } ], "pmid": "" }, { "name": "Ras protein signal transduction", "id": "GO:0007265", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007265", "evidence": [ { "database": "UniProtKB", "id": "O00560", "url": "https://www.uniprot.org/uniprot/O00560" } ], "pmid": "" }, { "name": "regulation of mitotic cell cycle", "id": "GO:0007346", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007346", "evidence": [ { "database": "UniProtKB", "id": "O00560", "url": "https://www.uniprot.org/uniprot/O00560" } ], "pmid": "" }, { "name": "positive regulation of transforming growth factor beta receptor signaling pathway", "id": "GO:0030511", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030511", "evidence": [ { "database": "UniProtKB", "id": "O00560", "url": "https://www.uniprot.org/uniprot/O00560" } ], "pmid": "" }, { "name": "positive regulation of phosphorylation", "id": "GO:0042327", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042327", "evidence": [ { "database": "UniProtKB", "id": "O00560", "url": "https://www.uniprot.org/uniprot/O00560" } ], "pmid": "" }, { "name": "positive regulation of epithelial to mesenchymal transition", "id": "GO:0010718", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010718", "evidence": [ { "database": "UniProtKB", "id": "O00560", "url": "https://www.uniprot.org/uniprot/O00560" } ], "pmid": "" }, { "name": "negative regulation of receptor internalization", "id": "GO:0002091", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002091", "evidence": [ { "database": "UniProtKB", "id": "O00560", "url": "https://www.uniprot.org/uniprot/O00560" } ], "pmid": "" }, { "name": "positive regulation of exosomal secretion", "id": "GO:1903543", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1903543", "evidence": [ { "database": "UniProtKB", "id": "O00560", "url": "https://www.uniprot.org/uniprot/O00560" } ], "pmid": "" }, { "name": "substrate-dependent cell migration, cell extension", "id": "GO:0006930", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006930", "evidence": [ { "database": "UniProtKB", "id": "O00560", "url": "https://www.uniprot.org/uniprot/O00560" } ], "pmid": "" }, { "name": "positive regulation of extracellular exosome assembly", "id": "GO:1903553", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1903553", "evidence": [ { "database": "UniProtKB", "id": "O00560", "url": "https://www.uniprot.org/uniprot/O00560" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 14, "go_terms": [ { "name": "frizzled binding", "id": "GO:0005109", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005109", "evidence": [ { "database": "UniProtKB", "id": "O00560", "url": "https://www.uniprot.org/uniprot/O00560" } ], "pmid": "" }, { "name": "phosphatidylinositol-4,5-bisphosphate binding", "id": "GO:0005546", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005546", "evidence": [ { "database": "UniProtKB", "id": "O00560", "url": "https://www.uniprot.org/uniprot/O00560" } ], "pmid": "" }, { "name": "growth factor binding", "id": "GO:0019838", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019838", "evidence": [ { "database": "UniProtKB", "id": "O00560", "url": "https://www.uniprot.org/uniprot/O00560" } ], "pmid": "" }, { "name": "identical protein binding", "id": "GO:0042802", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042802", "evidence": [ { "database": "UniProtKB", "id": "O00560", "url": "https://www.uniprot.org/uniprot/O00560" } ], "pmid": "" }, { "name": "ephrin receptor binding", "id": "GO:0046875", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046875", "evidence": [ { "database": "UniProtKB", "id": "O00560", "url": "https://www.uniprot.org/uniprot/O00560" } ], "pmid": "" }, { "name": "protein heterodimerization activity", "id": "GO:0046982", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046982", "evidence": [ { "database": "UniProtKB", "id": "O00560", "url": "https://www.uniprot.org/uniprot/O00560" } ], "pmid": "" }, { "name": "cell adhesion molecule binding", "id": "GO:0050839", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050839", "evidence": [ { "database": "UniProtKB", "id": "O00560", "url": "https://www.uniprot.org/uniprot/O00560" } ], "pmid": "" }, { "name": "cytoskeletal anchor activity", "id": "GO:0008093", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008093", "evidence": [ { "database": "UniProtKB", "id": "O00560", "url": "https://www.uniprot.org/uniprot/O00560" } ], "pmid": "" }, { "name": "protein-containing complex binding", "id": "GO:0044877", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0044877", "evidence": [ { "database": "UniProtKB", "id": "O00560", "url": "https://www.uniprot.org/uniprot/O00560" } ], "pmid": "" }, { "name": "syndecan binding", "id": "GO:0045545", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045545", "evidence": [ { "database": "UniProtKB", "id": "O00560", "url": "https://www.uniprot.org/uniprot/O00560" } ], "pmid": "" }, { "name": "ionotropic glutamate receptor binding", "id": "GO:0035255", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035255", "evidence": [ { "database": "UniProtKB", "id": "O00560", "url": "https://www.uniprot.org/uniprot/O00560" } ], "pmid": "" }, { "name": "neurexin family protein binding", "id": "GO:0042043", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042043", "evidence": [ { "database": "UniProtKB", "id": "O00560", "url": "https://www.uniprot.org/uniprot/O00560" } ], "pmid": "" }, { "name": "interleukin-5 receptor binding", "id": "GO:0005137", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005137", "evidence": [ { "database": "UniProtKB", "id": "O00560", "url": "https://www.uniprot.org/uniprot/O00560" } ], "pmid": "" }, { "name": "protein sequestering activity", "id": "GO:0140311", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0140311", "evidence": [ { "database": "UniProtKB", "id": "O00560", "url": "https://www.uniprot.org/uniprot/O00560" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [ 2, 4, 6, 46, 60, 91, 131, 187, 200, 206 ], "sequon_annotation_sites": [] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 10 }, { "field": "total_sites", "count": 10 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 84 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }