{ "uniprot_canonical_ac": "O00443-1", "uniprot_ac": "O00443", "uniprot_id": "P3C2A_HUMAN", "mass": { "chemical_mass": 190680.0, "monoisotopic_mass": 190680.0 }, "refseq": { "ac": "NP_001308307", "name": "phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha isoform 1", "summary": "The protein encoded by this gene belongs to the phosphoinositide 3-kinase (PI3K) family. PI3-kinases play roles in signaling pathways involved in cell proliferation, oncogenic transformation, cell survival, cell migration, and intracellular protein trafficking. This protein contains a lipid kinase catalytic domain as well as a C-terminal C2 domain, a characteristic of class II PI3-kinases. C2 domains act as calcium-dependent phospholipid binding motifs that mediate translocation of proteins to membranes, and may also mediate protein-protein interactions. The PI3-kinase activity of this protein is not sensitive to nanomolar levels of the inhibitor wortmanin. This protein was shown to be able to be activated by insulin and may be involved in integrin-dependent signaling. [provided by RefSeq, Jul 2008].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001308307" }, "gene_names": [ { "name": "PIK3C2A", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/O00443", "id": "O00443" }, { "name": "CPK; OCSKD; PI3-K-C2(ALPHA); PI3-K-C2A; PI3K-C2-alpha; PI3K-C2alpha", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001308307", "id": "NP_001308307" }, { "name": "PIK3C2A", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001308307", "id": "NP_001308307" } ], "protein_names": [ { "name": "Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "O00443" }, { "name": "2.7.1.137", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O00443" }, { "name": "2.7.1.153", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O00443" }, { "name": "2.7.1.154", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O00443" }, { "name": "C2-containing phosphatidylinositol kinase; phosphatidylinositol-4-phosphate 3-kinase C2 domain-containing subunit alpha; ptdIns-3-kinase C2 subunit alpha; phosphoinositide 3-kinase-C2-alpha; phosphoinositide-3-kinase, class 2, alpha polypeptide", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001308307", "id": "NP_001308307" }, { "name": "PI3K-C2-alpha", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O00443" }, { "name": "Phosphoinositide 3-kinase-C2-alpha", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O00443" }, { "name": "PtdIns-3-kinase C2 subunit alpha", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O00443" }, { "name": "phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha isoform 1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001308307", "id": "NP_001308307" } ], "function": [ { "annotation": "Class II phosphatidylinositol 3-kinase-C2alpha is essential for Notch signaling by regulating the endocytosis of gamma-secretase in endothelial cells. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_001308307", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001308307" }, { "database": "PubMed", "id": "33664344", "url": "https://glygen.org/publication/PubMed/33664344" } ] }, { "annotation": "Generates phosphatidylinositol 3-phosphate (PtdIns3P) and phosphatidylinositol 3,4-bisphosphate (PtdIns(3,4)P2) that act as second messengers. Has a role in several intracellular trafficking events. Functions in insulin signaling and secretion. Required for translocation of the glucose transporter SLC2A4/GLUT4 to the plasma membrane and glucose uptake in response to insulin-mediated RHOQ activation. Regulates insulin secretion through two different mechanisms: involved in glucose-induced insulin secretion downstream of insulin receptor in a pathway that involves AKT1 activation and TBC1D4/AS160 phosphorylation, and participates in the late step of insulin granule exocytosis probably in insulin granule fusion. Synthesizes PtdIns3P in response to insulin signaling. Functions in clathrin-coated endocytic vesicle formation and distribution. Regulates dynamin-independent endocytosis, probably by recruiting EEA1 to internalizing vesicles. In neurosecretory cells synthesizes PtdIns3P on large dense core vesicles. Participates in calcium induced contraction of vascular smooth muscle by regulating myosin light chain (MLC) phosphorylation through a mechanism involving Rho kinase-dependent phosphorylation of the MLCP-regulatory subunit MYPT1. May play a role in the EGF signaling cascade. May be involved in mitosis and UV-induced damage response. Required for maintenance of normal renal structure and function by supporting normal podocyte function. Involved in the regulation of ciliogenesis and trafficking of ciliary components (PubMed:31034465).", "evidence": [ { "database": "UniProtKB", "id": "O00443", "url": "https://www.uniprot.org/uniprot/O00443#function" }, { "database": "PubMed", "id": "21081650", "url": "https://glygen.org/publication/PubMed/21081650" }, { "database": "PubMed", "id": "10766823", "url": "https://glygen.org/publication/PubMed/10766823" }, { "database": "PubMed", "id": "9337861", "url": "https://glygen.org/publication/PubMed/9337861" }, { "database": "PubMed", "id": "12719431", "url": "https://glygen.org/publication/PubMed/12719431" }, { "database": "PubMed", "id": "16215232", "url": "https://glygen.org/publication/PubMed/16215232" }, { "database": "PubMed", "id": "10805725", "url": "https://glygen.org/publication/PubMed/10805725" }, { "database": "PubMed", "id": "11239472", "url": "https://glygen.org/publication/PubMed/11239472" }, { "database": "PubMed", "id": "31034465", "url": "https://glygen.org/publication/PubMed/31034465" } ] }, { "annotation": "PI(3,4)P2-mediated cytokinetic abscission prevents early senescence and cataract formation.", "evidence": [ { "database": "RefSeq", "id": "NP_001308307", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001308307" }, { "database": "PubMed", "id": "34882480", "url": "https://glygen.org/publication/PubMed/34882480" } ] }, { "annotation": "TGFbeta receptor endocytosis and Smad signaling require synaptojanin1, PI3K-C2alpha-, and INPP4B-mediated phosphoinositide conversions.", "evidence": [ { "database": "RefSeq", "id": "NP_001308307", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001308307" }, { "database": "PubMed", "id": "31913757", "url": "https://glygen.org/publication/PubMed/31913757" } ] }, { "annotation": "The molecular mechanisms mediating class II PI 3-kinase function in cell physiology. Review article", "evidence": [ { "database": "RefSeq", "id": "NP_001308307", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001308307" }, { "database": "PubMed", "id": "33387369", "url": "https://glygen.org/publication/PubMed/33387369" } ] }, { "annotation": "The protein encoded by this gene belongs to the phosphoinositide 3-kinase (PI3K) family. PI3-kinases play roles in signaling pathways involved in cell proliferation, oncogenic transformation, cell survival, cell migration, and intracellular protein trafficking. This protein contains a lipid kinase catalytic domain as well as a C-terminal C2 domain, a characteristic of class II PI3-kinases. C2 domains act as calcium-dependent phospholipid binding motifs that mediate translocation of proteins to membranes, and may also mediate protein-protein interactions. The PI3-kinase activity of this protein is not sensitive to nanomolar levels of the inhibitor wortmanin. This protein was shown to be able to be activated by insulin and may be involved in integrin-dependent signaling. [provided by RefSeq, Jul 2008].", "evidence": [ { "database": "RefSeq", "id": "NP_001308307", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001308307" } ] }, { "annotation": "Various Expressions of PIK3C2A and TXNIP Genes and Their Potential Role as Independent Risk Factors for Chronic Stable Angina and Acute Coronary Syndrome. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_001308307", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001308307" }, { "database": "PubMed", "id": "36830671", "url": "https://glygen.org/publication/PubMed/36830671" } ] } ], "disease": [ { "disease_id": "MONDO:0034145", "recommended_name": { "id": "MONDO:0034145", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0034145", "name": "oculocerebrodental syndrome", "description": "" }, "synonyms": [ { "id": "MONDO:0034145", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0034145", "name": "Cataracts, Early-Onset, With Skeletal and Dental Anomalies", "description": "" }, { "id": "MONDO:0034145", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0034145", "name": "OCSKD", "description": "" }, { "id": "MONDO:0034145", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0034145", "name": "oculoskeletodental syndrome", "description": "" }, { "id": "MIM:618440", "resource": "MIM", "url": "https://www.omim.org/entry/618440", "name": "Oculoskeletodental syndrome", "description": "Oculoskeletodental syndrome" } ], "evidence": [ { "id": "618440", "database": "MIM", "url": "https://www.omim.org/entry/618440" } ] } ], "snv": [ { "evidence": [ { "id": "rs1290811602", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1290811602" }, { "id": "rs1290811602", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1290811602" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 1120, "end_pos": 1120, "sequence_org": "K", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (KVT->NVT).", "chr_id": "11", "chr_pos": "17112628", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "K1120", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1590920403", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1590920403" }, { "id": "rs1590920403", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1590920403" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 1136, "end_pos": 1136, "sequence_org": "M", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NVM->NVT).", "chr_id": "11", "chr_pos": "17112581", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "M1136", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "O00443", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O00443" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 1220, "end_pos": 1220, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "P", "sequence_mut": "H", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (NPS->NHS).", "chr_id": "11", "chr_pos": "17105191", "ref_nt": "G", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "P1220", "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs145095769", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs145095769" }, { "id": "rs145095769", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs145095769#frequency_tab" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 1220, "end_pos": 1220, "sequence_org": "P", "sequence_mut": "R", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NPS->NRS).", "chr_id": "11", "chr_pos": "17105191", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "P1220", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs267602800", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs267602800" }, { "id": "rs267602800", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs267602800" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 1220, "end_pos": 1220, "sequence_org": "P", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NPS->NSS).", "chr_id": "11", "chr_pos": "17105192", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "P1220", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs140312144", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs140312144" }, { "id": "rs140312144", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs140312144" }, { "id": "rs140312144", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs140312144#frequency_tab" }, { "id": "rs140312144", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs140312144" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 1255, "end_pos": 1255, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NDN->NDS).", "chr_id": "11", "chr_pos": "17102749", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N1255", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs377699951", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs377699951" }, { "id": "rs377699951", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs377699951" }, { "id": "rs377699951", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs377699951#frequency_tab" }, { "id": "rs377699951", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs377699951" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 1327, "end_pos": 1327, "sequence_org": "T", "sequence_mut": "R", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->R).", "chr_id": "11", "chr_pos": "17101306", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T1327", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1487590917", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1487590917" }, { "id": "rs1487590917", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1487590917" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 1394, "end_pos": 1394, "sequence_org": "A", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NLA->NLT).", "chr_id": "11", "chr_pos": "17097203", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "A1394", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs11604561", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs11604561" }, { "id": "rs11604561", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs11604561" }, { "id": "rs11604561", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs11604561" }, { "id": "rs11604561", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs11604561#frequency_tab" }, { "id": "rs11604561", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs11604561" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 1415, "end_pos": 1415, "sequence_org": "T", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->A).", "chr_id": "11", "chr_pos": "17097140", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "0.08027", "site_lbl": "T1415", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs778846156", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs778846156" }, { "id": "rs778846156", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs778846156" }, { "id": "rs778846156", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs778846156" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 1417, "end_pos": 1417, "sequence_org": "S", "sequence_mut": "C", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->C).", "chr_id": "11", "chr_pos": "17097133", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S1417", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs751396589", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs751396589" }, { "id": "rs751396589", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs751396589" }, { "id": "rs751396589", "database": "NCI-TCGA", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs751396589" }, { "id": "rs751396589", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs751396589" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 1621, "end_pos": 1621, "sequence_org": "P", "sequence_mut": "L", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NPT->NLT).", "chr_id": "11", "chr_pos": "17091350", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "P1621", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1338697655", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1338697655" }, { "id": "rs1338697655", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1338697655#frequency_tab" }, { "id": "rs1338697655", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1338697655" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 1626, "end_pos": 1626, "sequence_org": "M", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NEM->NET).", "chr_id": "11", "chr_pos": "17091335", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "M1626", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1420637134", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1420637134" }, { "id": "rs1420637134", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1420637134" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 1648, "end_pos": 1648, "sequence_org": "S", "sequence_mut": "G", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->G).", "chr_id": "11", "chr_pos": "17089857", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S1648", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1249005253", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1249005253" }, { "id": "rs1249005253", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1249005253" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 186, "end_pos": 186, "sequence_org": "Y", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (YLS->NLS).", "chr_id": "11", "chr_pos": "17169186", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "Y186", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs774351816", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs774351816" }, { "id": "rs774351816", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs774351816" }, { "id": "rs774351816", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs774351816#frequency_tab" }, { "id": "rs774351816", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs774351816" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 264, "end_pos": 264, "sequence_org": "D", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (DIS->NIS).", "chr_id": "11", "chr_pos": "17168952", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "D264", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1305518375", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1305518375" }, { "id": "rs1305518375", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1305518375#frequency_tab" }, { "id": "rs1305518375", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1305518375" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 334, "end_pos": 334, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->I).", "chr_id": "11", "chr_pos": "17168741", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T334", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1305518375", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1305518375" }, { "id": "rs1305518375", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1305518375#frequency_tab" }, { "id": "rs1305518375", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1305518375" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 334, "end_pos": 334, "sequence_org": "T", "sequence_mut": "R", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->R).", "chr_id": "11", "chr_pos": "17168741", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T334", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "O00443", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O00443" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 366, "end_pos": 366, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "T", "sequence_mut": "N", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (TGS->NGS).", "chr_id": "11", "chr_pos": "17155598", "ref_nt": "G", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "T366", "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs752142585", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs752142585" }, { "id": "rs752142585", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs752142585" }, { "id": "rs752142585", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs752142585#frequency_tab" }, { "id": "rs752142585", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs752142585" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 442, "end_pos": 442, "sequence_org": "D", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (DVS->NVS).", "chr_id": "11", "chr_pos": "17150501", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "D442", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs770085365", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs770085365" }, { "id": "rs770085365", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs770085365" }, { "id": "rs770085365", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs770085365" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 444, "end_pos": 444, "sequence_org": "S", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (SST->NST).", "chr_id": "11", "chr_pos": "17148784", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S444", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs757655412", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs757655412" }, { "id": "rs757655412", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs757655412" }, { "id": "rs757655412", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs757655412" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 486, "end_pos": 486, "sequence_org": "C", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NHC->NHS).", "chr_id": "11", "chr_pos": "17147620", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "C486", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs751588184", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs751588184" }, { "id": "rs751588184", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs751588184" }, { "id": "rs751588184", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs751588184" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 509, "end_pos": 509, "sequence_org": "T", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (TFS->NFS).", "chr_id": "11", "chr_pos": "17147551", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T509", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs372724550", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs372724550" }, { "id": "rs372724550", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs372724550" }, { "id": "rs372724550", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs372724550#frequency_tab" }, { "id": "rs372724550", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs372724550" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 518, "end_pos": 518, "sequence_org": "A", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NLA->NLT).", "chr_id": "11", "chr_pos": "17147525", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "A518", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1434383407", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1434383407" }, { "id": "rs1434383407", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1434383407" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 59, "end_pos": 59, "sequence_org": "S", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (SST->NST).", "chr_id": "11", "chr_pos": "17169566", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S59", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1479461285", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1479461285" }, { "id": "rs1479461285", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1479461285#frequency_tab" }, { "id": "rs1479461285", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1479461285" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 610, "end_pos": 610, "sequence_org": "P", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NLP->NLS).", "chr_id": "11", "chr_pos": "17136502", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "P610", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs765384257", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs765384257" }, { "id": "rs765384257", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs765384257" }, { "id": "rs765384257", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs765384257#frequency_tab" }, { "id": "rs765384257", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs765384257" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 612, "end_pos": 612, "sequence_org": "S", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (SKT->NKT).", "chr_id": "11", "chr_pos": "17136495", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S612", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1251378935", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1251378935" }, { "id": "rs1251378935", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1251378935" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 629, "end_pos": 629, "sequence_org": "S", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (SST->NST).", "chr_id": "11", "chr_pos": "17135122", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S629", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1468725672", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1468725672" }, { "id": "rs1468725672", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1468725672#frequency_tab" }, { "id": "rs1468725672", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1468725672" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 648, "end_pos": 648, "sequence_org": "L", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NQL->NQS).", "chr_id": "11", "chr_pos": "17134984", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "L648", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1266779970", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1266779970" }, { "id": "rs1266779970", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1266779970" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 663, "end_pos": 663, "sequence_org": "G", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NSG->NSS).", "chr_id": "11", "chr_pos": "17134940", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "G663", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "O00443", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O00443" } ], "glycoeffect": [], "start_pos": 720, "end_pos": 720, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "L", "sequence_mut": "I", "comment": "Somatic mutation passed 1 out of 6 filters: num. of cancers (3).", "chr_id": "11", "chr_pos": "17131989", "ref_nt": "G", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "L720", "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] }, { "disease_id": "DOID:1319", "recommended_name": { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "brain cancer", "description": "A central nervous system cancer that is characterized by the growth of abnormal cells in the tissues of the brain." }, "synonyms": [ { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "BT - Brain tumour", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "adult brain tumor", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "adult malignant brain neoplasm", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "brain neoplasm", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "brain neoplasm, adult", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant brain tumour", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant primary brain neoplasm", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant primary brain tumor", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant tumor of Brain", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant tumor of adult brain", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "neoplasm of brain", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "primary brain neoplasm", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "primary brain tumor", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "primary malignant neoplasm of brain", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "tumor of the Brain", "description": "" } ] }, { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs1341448846", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1341448846" }, { "id": "rs1341448846", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1341448846" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 871, "end_pos": 871, "sequence_org": "I", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NDI->NDT).", "chr_id": "11", "chr_pos": "17122233", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "I871", "keywords": [ "ebi", "germline" ] } ], "mutagenesis": [ { "start_pos": 103, "end_pos": 107, "sequence_org": "LLLDD", "sequence_mut": "AAAAA", "comment": "Reduces clathrin binding.", "evidence": [ { "database": "UniProtKB", "id": "O00443", "url": "https://www.uniprot.org/uniprot/O00443" }, { "database": "PubMed", "id": "11239472", "url": "https://glygen.org/publication/PubMed/11239472" } ] }, { "start_pos": 1250, "end_pos": 1250, "sequence_org": "D", "sequence_mut": "A", "comment": "Abolishes lipid kinase activity. Affects clathrin distribution when combined with a truncation encompassing the region of clathrin interaction.", "evidence": [ { "database": "UniProtKB", "id": "O00443", "url": "https://www.uniprot.org/uniprot/O00443" }, { "database": "PubMed", "id": "16215232", "url": "https://glygen.org/publication/PubMed/16215232" } ] }, { "start_pos": 1488, "end_pos": 1488, "sequence_org": "R", "sequence_mut": "A", "comment": "Reduces affinity for PtdIns(4,5)P2-containing membranes 7-fold.", "evidence": [ { "database": "UniProtKB", "id": "O00443", "url": "https://www.uniprot.org/uniprot/O00443" }, { "database": "PubMed", "id": "17038310", "url": "https://glygen.org/publication/PubMed/17038310" } ] }, { "start_pos": 1490, "end_pos": 1490, "sequence_org": "V", "sequence_mut": "A", "comment": "Reduces affinity for PtdIns(4,5)P2-containing membranes 7-fold.", "evidence": [ { "database": "UniProtKB", "id": "O00443", "url": "https://www.uniprot.org/uniprot/O00443" }, { "database": "PubMed", "id": "17038310", "url": "https://glygen.org/publication/PubMed/17038310" } ] }, { "start_pos": 1491, "end_pos": 1491, "sequence_org": "L", "sequence_mut": "A", "comment": "Reduces affinity for PtdIns(4,5)P2-containing membranes 5-fold.", "evidence": [ { "database": "UniProtKB", "id": "O00443", "url": "https://www.uniprot.org/uniprot/O00443" }, { "database": "PubMed", "id": "17038310", "url": "https://glygen.org/publication/PubMed/17038310" } ] }, { "start_pos": 1493, "end_pos": 1493, "sequence_org": "R", "sequence_mut": "A", "comment": "Reduces affinity for PtdIns(4,5)P2-containing membranes 23-fold.", "evidence": [ { "database": "UniProtKB", "id": "O00443", "url": "https://www.uniprot.org/uniprot/O00443" }, { "database": "PubMed", "id": "17038310", "url": "https://glygen.org/publication/PubMed/17038310" } ] }, { "start_pos": 1503, "end_pos": 1503, "sequence_org": "R", "sequence_mut": "A", "comment": "Abolishes interaction with PtdIns(4,5)P2-containing membranes.", "evidence": [ { "database": "UniProtKB", "id": "O00443", "url": "https://www.uniprot.org/uniprot/O00443" }, { "database": "PubMed", "id": "17038310", "url": "https://glygen.org/publication/PubMed/17038310" } ] }, { "start_pos": 254, "end_pos": 254, "sequence_org": "S", "sequence_mut": "A", "comment": "No effect on phosphorylation in vitro.", "evidence": [ { "database": "UniProtKB", "id": "O00443", "url": "https://www.uniprot.org/uniprot/O00443" }, { "database": "PubMed", "id": "12719431", "url": "https://glygen.org/publication/PubMed/12719431" } ] }, { "start_pos": 259, "end_pos": 259, "sequence_org": "S", "sequence_mut": "A", "comment": "Abolishes phosphorylation, no change in activity.", "evidence": [ { "database": "UniProtKB", "id": "O00443", "url": "https://www.uniprot.org/uniprot/O00443" }, { "database": "PubMed", "id": "12719431", "url": "https://glygen.org/publication/PubMed/12719431" } ] }, { "start_pos": 259, "end_pos": 259, "sequence_org": "S", "sequence_mut": "A", "comment": "Protects from proteolysis.", "evidence": [ { "database": "UniProtKB", "id": "O00443", "url": "https://www.uniprot.org/uniprot/O00443" }, { "database": "PubMed", "id": "12719431", "url": "https://glygen.org/publication/PubMed/12719431" } ] }, { "start_pos": 259, "end_pos": 259, "sequence_org": "S", "sequence_mut": "D", "comment": "Abolishes phosphorylation, no change in activity.", "evidence": [ { "database": "UniProtKB", "id": "O00443", "url": "https://www.uniprot.org/uniprot/O00443" }, { "database": "PubMed", "id": "12719431", "url": "https://glygen.org/publication/PubMed/12719431" } ] }, { "start_pos": 259, "end_pos": 259, "sequence_org": "S", "sequence_mut": "E", "comment": "Abolishes phosphorylation, no change in activity.", "evidence": [ { "database": "UniProtKB", "id": "O00443", "url": "https://www.uniprot.org/uniprot/O00443" }, { "database": "PubMed", "id": "12719431", "url": "https://glygen.org/publication/PubMed/12719431" } ] }, { "start_pos": 262, "end_pos": 262, "sequence_org": "S", "sequence_mut": "A", "comment": "No effect on phosphorylation in vitro.", "evidence": [ { "database": "UniProtKB", "id": "O00443", "url": "https://www.uniprot.org/uniprot/O00443" }, { "database": "PubMed", "id": "12719431", "url": "https://glygen.org/publication/PubMed/12719431" } ] }, { "start_pos": 266, "end_pos": 266, "sequence_org": "S", "sequence_mut": "A", "comment": "No effect on phosphorylation in vitro.", "evidence": [ { "database": "UniProtKB", "id": "O00443", "url": "https://www.uniprot.org/uniprot/O00443" }, { "database": "PubMed", "id": "12719431", "url": "https://glygen.org/publication/PubMed/12719431" } ] } ], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "87.35", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000011405", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000011405" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "93.6", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000011405", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000011405" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "91.92", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000011405", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000011405" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "89.62", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000011405", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000011405" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "88.39", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000011405", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000011405" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "87.88", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000011405", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000011405" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "81.92", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000011405", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000011405" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "90.55", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000011405", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000011405" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "89.43", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000011405", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000011405" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "93.04", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000011405", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000011405" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "93.88", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000011405", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000011405" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "85.12", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000011405", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000011405" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "87.94", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000011405", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000011405" } ] } ], "expression_disease": [ { "significant": "Yes", "trend": "down", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "O00443", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O00443" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "No", "trend": "down", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "O00443", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O00443" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "O00443", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O00443" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "O00443", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O00443" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "O00443", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O00443" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "O00443", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O00443" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "O00443", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O00443" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "O00443", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O00443" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "O00443", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O00443" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "O00443", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O00443" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "O00443", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O00443" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "O00443", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O00443" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O00443", "url": "https://www.uniprot.org/uniprot/O00443" } ], "common_name": "Human" } ], "gene": [ { "name": "PIK3C2A", "url": "https://www.uniprot.org/uniprot/O00443", "locus": { "chromosome": "11", "start_pos": 17077730, "end_pos": 17207986, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000011405", "url": "https://www.ensembl.org/id/ENSG00000011405" } ] } } ], "crossref": [ { "id": "ENSG00000011405", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000011405", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "O00443", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O00443", "database": "BioMuta", "categories": [ "Variation" ] }, { "id": "2.7.1.154", "url": "https://www.brenda-enzymes.org/enzyme.php?ecno=2.7.1.154&UniProtAcc=O00443", "database": "BRENDA", "categories": [ "Enzyme and Pathway" ] }, { "id": "cd00869", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00869", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd04012", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd04012", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd05176", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd05176", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd07289", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd07289", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd08381", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd08381", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "CHEMBL1075102", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL1075102", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "PIK3C2A", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=PIK3C2A", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "5286", "url": "https://www.ncbi.nlm.nih.gov/gene/5286", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "8971", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=8971", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "O00443", "url": "https://www.ebi.ac.uk/intact/interactors/id:O00443*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR000008", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000008", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR000341", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000341", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR000403", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000403", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR001263", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001263", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR001683", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001683", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR002420", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002420", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR011009", "url": "https://www.ebi.ac.uk/interpro/entry/IPR011009", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR015433", "url": "https://www.ebi.ac.uk/interpro/entry/IPR015433", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR016024", "url": "https://www.ebi.ac.uk/interpro/entry/IPR016024", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR018936", "url": "https://www.ebi.ac.uk/interpro/entry/IPR018936", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR029071", "url": "https://www.ebi.ac.uk/interpro/entry/IPR029071", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR035892", "url": "https://www.ebi.ac.uk/interpro/entry/IPR035892", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036871", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036871", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036940", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036940", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR037705", "url": "https://www.ebi.ac.uk/interpro/entry/IPR037705", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR042133", "url": "https://www.ebi.ac.uk/interpro/entry/IPR042133", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR042236", "url": "https://www.ebi.ac.uk/interpro/entry/IPR042236", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:5286", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:5286", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "603601", "url": "http://www.omim.org/entry/603601", "database": "MIM", "categories": [ "Other" ] }, { "id": "618440", "url": "http://www.omim.org/entry/618440", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_O00443", "url": "https://www.nextprot.org/entry/NX_O00443", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "O00443", "url": "https://oglcnac.org/atlas/detail/O00443", "database": "O-GlcNAc Atlas", "categories": [ "Glycoproteomics" ] }, { "id": "O00443", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O00443", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "HQWPALY", "url": "https://omabrowser.org/oma/group/HQWPALY/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "10350at2759", "url": "http://www.orthodb.org/?query=10350at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR10048", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10048", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR10048:SF28", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10048:SF28", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "2AR5", "url": "https://www.rcsb.org/structure/2AR5", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2IWL", "url": "https://www.rcsb.org/structure/2IWL", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2REA", "url": "https://www.rcsb.org/structure/2REA", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2RED", "url": "https://www.rcsb.org/structure/2RED", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6BTY", "url": "https://www.rcsb.org/structure/6BTY", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6BTZ", "url": "https://www.rcsb.org/structure/6BTZ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6BU0", "url": "https://www.rcsb.org/structure/6BU0", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6BUB", "url": "https://www.rcsb.org/structure/6BUB", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00168", "url": "http://pfam.xfam.org/family/PF00168", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF00454", "url": "http://pfam.xfam.org/family/PF00454", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF00613", "url": "http://pfam.xfam.org/family/PF00613", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF00787", "url": "http://pfam.xfam.org/family/PF00787", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF00792", "url": "http://pfam.xfam.org/family/PF00792", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF00794", "url": "http://pfam.xfam.org/family/PF00794", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "O00443", "url": "https://pharos.nih.gov/targets/O00443", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_O00443", "url": "http://purl.obolibrary.org/obo/PR_O00443", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-1660499", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1660499", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-1660514", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1660514", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-1660516", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1660516", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-1660517", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1660517", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-432722", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-432722", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001308307", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001308307", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "12709", "url": "https://www.rhea-db.org/rhea/12709", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "18373", "url": "https://www.rhea-db.org/rhea/18373", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "21292", "url": "https://www.rhea-db.org/rhea/21292", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "A0A0C4DGF9", "url": "https://www.uniprot.org/uniprot/A0A0C4DGF9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0C4DGF9-1", "url": "https://www.uniprot.org/uniprot/A0A0C4DGF9-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E9PPP3", "url": "https://www.uniprot.org/uniprot/E9PPP3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E9PPP3-1", "url": "https://www.uniprot.org/uniprot/E9PPP3-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O00443", "url": "https://www.uniprot.org/uniprot/O00443", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O00443-1", "url": "https://www.uniprot.org/uniprot/O00443-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O00443-2", "url": "https://www.uniprot.org/uniprot/O00443-2", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MAQISSNSGFKECPSSHPEPTRAKDVDKEEALQMEAEALAKLQKDRQVTDNQRGFELSSSTRKKAQVYNKQDYDLMVFPESDSQKRALDIDVEKLTQAELEKLLLDDSFETKKTPVLPVTPILSPSFSAQLYFRPTIQRGQWPPGLPGPSTYALPSIYPSTYSKQAAFQNGFNPRMPTFPSTEPIYLSLPGQSPYFSYPLTPATPFHPQGSLPIYRPVVSTDMAKLFDKIASTSEFLKNGKARTDLEITDSKVSNLQVSPKSEDISKFDWLDLDPLSKPKVDNVEVLDHEEEKNVSSLLAKDPWDAVLLEERSTANCHLERKVNGKSLSVATVTRSQSLNIRTTQLAKAQGHISQKDPNGTSSLPTGSSLLQEVEVQNEEMAAFCRSITKLKTKFPYTNHRTNPGYLLSPVTAQRNICGENASVKVSIDIEGFQLPVTFTCDVSSTVEIIIMQALCWVHDDLNQVDVGSYVLKVCGQEEVLQNNHCLGSHEHIQNCRKWDTEIRLQLLTFSAMCQNLARTAEDDETPVDLNKHLYQIEKPCKEAMTRHPVEELLDSYHNQVELALQIENQHRAVDQVIKAVRKICSALDGVETLAITESVKKLKRAVNLPRSKTADVTSLFGGEDTSRSSTRGSLNPENPVQVSINQLTAAIYDLLRLHANSGRSPTDCAQSSKSVKEAWTTTEQLQFTIFAAHGISSNWVSNYEKYYLICSLSHNGKDLFKPIQSKKVGTYKNFFYLIKWDELIIFPIQISQLPLESVLHLTLFGILNQSSGSSPDSNKQRKGPEALGKVSLPLFDFKRFLTCGTKLLYLWTSSHTNSVPGTVTKKGYVMERIVLQVDFPSPAFDIIYTTPQVDRSIIQQHNLETLENDIKGKLLDILHKDSSLGLSKEDKAFLWEKRYYCFKHPNCLPKILASAPNWKWVNLAKTYSLLHQWPALYPLIALELLDSKFADQEVRSLAVTWIEAISDDELTDLLPQFVQALKYEIYLNSSLVQFLLSRALGNIQIAHNLYWLLKDALHDVQFSTRYEHVLGALLSVGGKRLREELLKQTKLVQLLGGVAEKVRQASGSARQVVLQRSMERVQSFFQKNKCRLPLKPSLVAKELNIKSCSFFSSNAVPLKVTMVNADPMGEEINVMFKVGEDLRQDMLALQMIKIMDKIWLKEGLDLRMVIFKCLSTGRDRGMVELVPASDTLRKIQVEYGVTGSFKDKPLAEWLRKYNPSEEEYEKASENFIYSCAGCCVATYVLGICDRHNDNIMLRSTGHMFHIDFGKFLGHAQMFGSFKRDRAPFVLTSDMAYVINGGEKPTIRFQLFVDLCCQAYNLIRKQTNLFLNLLSLMIPSGLPELTSIQDLKYVRDALQPQTTDAEATIFFTRLIESSLGSIATKFNFFIHNLAQLRFSGLPSNDEPILSFSPKTYSFRQDGRIKEVSVFTYHKKYNPDKHYIYVVRILREGQIEPSFVFRTFDEFQELHNKLSIIFPLWKLPGFPNRMVLGRTHIKDVAAKRKIELNSYLQSLMNASTDVAECDLVCTFFHPLLRDEKAEGIARSADAGSFSPTPGQIGGAVKLSISYRNGTLFIMVMHIKDLVTEDGADPNPYVKTYLLPDNHKTSKRKTKISRKTRNPTFNEMLVYSGYSKETLRQRELQLSVLSAESLRENFFLGGVTLPLKDFNLSKETVKWYQLTAATYL", "length": 1686, "header": "sp|O00443-1|P3C2A_HUMAN Isoform 1 of Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha OS=Homo sapiens OX=9606 GN=PIK3C2A PE=1 SV=2 CANONICAL=O00443-1" }, "isoforms": [ { "isoform_ac": "A0A0C4DGF9-1", "url": "", "sequence": { "sequence": "MAQISSNSGFKECPSSHPEPTRAKDVDKEEALQMEAEALAKLQKDRQVTDNQRGFELSSSTRKKAQVYNKQDYDLMVFPESDSQKRALDIDVEKLTQAELEKLLLDDSFETKKTPVLPVTPILSPSFSAQLYFRPTIQRGQWPPGLPGPSTYALPSIYPSTYSKQAAFQNGFNPRMPTFPSTEPIYLSLPGQSPYFSYPLTPATPFHPQGSLPIYRPVVSTDMAKLFDKIASTSEFLKNGKARTDLEITDSKVSNLQVSPKSEDISKFDWLDLDPLSKPKVDNVEVLDHEEEKNVSSLLAKDPWDAVLLEERSTANCHLERKVNGKSLSVATVTRSQSLNIRTTQLAKAQGHISQKDPNGTSSLPTGSSLLQEVEVQNEEMAAFCRSITKLKTKFPYTNHRTNPGYLLSPVTAQRNICGENASVKVSIDIEGFQLPVTFTCDVSSTVEIIIMQALCWVHDDLNQVDVGSYVLKVCGQEEVLQK", "length": 483, "header": "tr|A0A0C4DGF9-1|P3C2A_HUMAN Computationally mapped isoform of Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha OS=Homo sapiens OX=9606 GN=PIK3C2A PE=1 SV=1 CANONICAL=O00443-1" }, "locus": { "chromosome": "11", "start_pos": 17169741, "end_pos": 17148666, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000533645.1", "url": "https://www.ensembl.org/id/ENST00000533645.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000436244.1", "url": "https://www.ensembl.org/id/ENSP00000436244.1" } ] } }, { "isoform_ac": "E9PPP3-1", "url": "", "sequence": { "sequence": "MAQISSNSGFKECPSSHPEPTRAKDVDKEEALQMEAEALAKLQKDRQVTDNQRGFELSSSTRKKAQVYNKQDYDLMVFPESDSQKRALDIDVEKLTQAELEKLLLDDSFETKKTPVLPVTPILSPSFSAQ", "length": 130, "header": "tr|E9PPP3-1|P3C2A_HUMAN Computationally mapped isoform of Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha OS=Homo sapiens OX=9606 GN=PIK3C2A PE=1 SV=1 CANONICAL=O00443-1" }, "locus": { "chromosome": "11", "start_pos": 17169741, "end_pos": 17169352, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000532035.1", "url": "https://www.ensembl.org/id/ENST00000532035.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000436969.1", "url": "https://www.ensembl.org/id/ENSP00000436969.1" } ] } }, { "isoform_ac": "O00443-1", "url": "", "sequence": { "sequence": "MAQISSNSGFKECPSSHPEPTRAKDVDKEEALQMEAEALAKLQKDRQVTDNQRGFELSSSTRKKAQVYNKQDYDLMVFPESDSQKRALDIDVEKLTQAELEKLLLDDSFETKKTPVLPVTPILSPSFSAQLYFRPTIQRGQWPPGLPGPSTYALPSIYPSTYSKQAAFQNGFNPRMPTFPSTEPIYLSLPGQSPYFSYPLTPATPFHPQGSLPIYRPVVSTDMAKLFDKIASTSEFLKNGKARTDLEITDSKVSNLQVSPKSEDISKFDWLDLDPLSKPKVDNVEVLDHEEEKNVSSLLAKDPWDAVLLEERSTANCHLERKVNGKSLSVATVTRSQSLNIRTTQLAKAQGHISQKDPNGTSSLPTGSSLLQEVEVQNEEMAAFCRSITKLKTKFPYTNHRTNPGYLLSPVTAQRNICGENASVKVSIDIEGFQLPVTFTCDVSSTVEIIIMQALCWVHDDLNQVDVGSYVLKVCGQEEVLQNNHCLGSHEHIQNCRKWDTEIRLQLLTFSAMCQNLARTAEDDETPVDLNKHLYQIEKPCKEAMTRHPVEELLDSYHNQVELALQIENQHRAVDQVIKAVRKICSALDGVETLAITESVKKLKRAVNLPRSKTADVTSLFGGEDTSRSSTRGSLNPENPVQVSINQLTAAIYDLLRLHANSGRSPTDCAQSSKSVKEAWTTTEQLQFTIFAAHGISSNWVSNYEKYYLICSLSHNGKDLFKPIQSKKVGTYKNFFYLIKWDELIIFPIQISQLPLESVLHLTLFGILNQSSGSSPDSNKQRKGPEALGKVSLPLFDFKRFLTCGTKLLYLWTSSHTNSVPGTVTKKGYVMERIVLQVDFPSPAFDIIYTTPQVDRSIIQQHNLETLENDIKGKLLDILHKDSSLGLSKEDKAFLWEKRYYCFKHPNCLPKILASAPNWKWVNLAKTYSLLHQWPALYPLIALELLDSKFADQEVRSLAVTWIEAISDDELTDLLPQFVQALKYEIYLNSSLVQFLLSRALGNIQIAHNLYWLLKDALHDVQFSTRYEHVLGALLSVGGKRLREELLKQTKLVQLLGGVAEKVRQASGSARQVVLQRSMERVQSFFQKNKCRLPLKPSLVAKELNIKSCSFFSSNAVPLKVTMVNADPMGEEINVMFKVGEDLRQDMLALQMIKIMDKIWLKEGLDLRMVIFKCLSTGRDRGMVELVPASDTLRKIQVEYGVTGSFKDKPLAEWLRKYNPSEEEYEKASENFIYSCAGCCVATYVLGICDRHNDNIMLRSTGHMFHIDFGKFLGHAQMFGSFKRDRAPFVLTSDMAYVINGGEKPTIRFQLFVDLCCQAYNLIRKQTNLFLNLLSLMIPSGLPELTSIQDLKYVRDALQPQTTDAEATIFFTRLIESSLGSIATKFNFFIHNLAQLRFSGLPSNDEPILSFSPKTYSFRQDGRIKEVSVFTYHKKYNPDKHYIYVVRILREGQIEPSFVFRTFDEFQELHNKLSIIFPLWKLPGFPNRMVLGRTHIKDVAAKRKIELNSYLQSLMNASTDVAECDLVCTFFHPLLRDEKAEGIARSADAGSFSPTPGQIGGAVKLSISYRNGTLFIMVMHIKDLVTEDGADPNPYVKTYLLPDNHKTSKRKTKISRKTRNPTFNEMLVYSGYSKETLRQRELQLSVLSAESLRENFFLGGVTLPLKDFNLSKETVKWYQLTAATYL", "length": 1686, "header": "sp|O00443-1|P3C2A_HUMAN Isoform 1 of Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha OS=Homo sapiens OX=9606 GN=PIK3C2A PE=1 SV=2 CANONICAL=O00443-1" }, "locus": { "chromosome": "11", "start_pos": 17169741, "end_pos": 17089741, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000265970.11", "url": "https://www.ensembl.org/id/ENST00000265970.11" }, { "database": "Ensembl Peptide", "id": "ENSP00000265970.6", "url": "https://www.ensembl.org/id/ENSP00000265970.6" } ] } }, { "isoform_ac": "O00443-2", "url": "", "sequence": { "sequence": "MAQISSNSGFKECPSSHPEPTRAKDVDKEEALQMEAEALAKLQKDRQVTDNQRGFELSSSTRKKAQVYNKQDYDLMVFPESDSQKRALDIDVEKLTQAELEKLLLDDSFETKKTPVLPVTPILSPSFSAQLYFRPTIQRGQWPPGLPGPSTYALPSIYPSTYSKQAAFQNGFNPRMPTFPSTEPIYLSLPGQSPYFSYPLTPATPFHPQGSLPIYRPVVSTDMAKLFDKIASTSEFLKNGKARTDLEITDSKVSNLQVSPKSEDISKFDWLDLDPLSKPKVDNVEVLDHEEEKNVSSLLAKDPWDAVLLEERSTANCHLERKVNGKSLSVATVTRSQSLNIRTTQLAKAQGHISQKDPNGTSSLPTGSSLLQEVEVQNEEMAAFCRSITKLKTKFPYTNHRTNPGYLLSPVTAQRNICGENASVKVSIDIEGFQLPVTFTCDVSSTVEIIIMQALCWVHDDLNQVDVGSYVLKVCGQEEVLQN", "length": 483, "header": "sp|O00443-2|P3C2A_HUMAN Isoform 2 of Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha OS=Homo sapiens OX=9606 GN=PIK3C2A PE=1 SV=2 CANONICAL=O00443-1" }, "locus": {} } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 1327, "start_aa": "Thr", "end_pos": 1327, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1327", "evidence": [ { "id": "O00443", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O00443" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "O00443", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O00443" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 1335, "start_aa": "Ser", "end_pos": 1335, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser1335", "evidence": [ { "id": "O00443", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O00443" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "O00443", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O00443" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 1415, "start_aa": "Thr", "end_pos": 1415, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1415", "evidence": [ { "id": "O00443", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O00443" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 1417, "start_aa": "Ser", "end_pos": 1417, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser1417", "evidence": [ { "id": "O00443", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O00443" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 1648, "start_aa": "Ser", "end_pos": 1648, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser1648", "evidence": [ { "id": "O00443", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O00443" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 1651, "start_aa": "Ser", "end_pos": 1651, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser1651", "evidence": [ { "id": "O00443", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O00443" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 334, "start_aa": "Thr", "end_pos": 334, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr334", "evidence": [ { "id": "O00443", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O00443" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "O00443", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O00443" } ] } ], "phosphorylation": [ { "start_pos": 108, "end_pos": 108, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O00443", "url": "https://www.uniprot.org/uniprot/O00443" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "18691976", "url": "https://glygen.org/publication/PubMed/18691976" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "iPTMnet", "id": "O00443", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O00443" }, { "database": "phospho.ELM", "id": "O00443", "url": "http://phospho.elm.eu.org/byAccession/O00443.html" } ], "site_lbl": "Ser108" }, { "start_pos": 1281, "end_pos": 1281, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O00443", "url": "https://www.uniprot.org/uniprot/O00443" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "iPTMnet", "id": "O00443", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O00443" } ], "site_lbl": "Ser1281" }, { "start_pos": 1551, "end_pos": 1551, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O00443", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O00443" }, { "database": "PubMed", "id": "19691289", "url": "https://glygen.org/publication/PubMed/19691289" } ], "site_lbl": "Ser1551" }, { "start_pos": 1553, "end_pos": 1553, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O00443", "url": "https://www.uniprot.org/uniprot/O00443" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "iPTMnet", "id": "O00443", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O00443" }, { "database": "PubMed", "id": "18691976", "url": "https://glygen.org/publication/PubMed/18691976" }, { "database": "PubMed", "id": "19691289", "url": "https://glygen.org/publication/PubMed/19691289" } ], "site_lbl": "Ser1553" }, { "start_pos": 259, "end_pos": 259, "kinase_uniprot_canonical_ac": "P06493-1", "kinase_gene_name": "CDK1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O00443", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O00443" }, { "database": "PubMed", "id": "12719431", "url": "https://glygen.org/publication/PubMed/12719431" }, { "database": "phospho.ELM", "id": "O00443", "url": "http://phospho.elm.eu.org/byAccession/O00443.html" } ], "site_lbl": "Ser259" }, { "start_pos": 259, "end_pos": 259, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O00443", "url": "https://www.uniprot.org/uniprot/O00443" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "19369195", "url": "https://glygen.org/publication/PubMed/19369195" }, { "database": "PubMed", "id": "18691976", "url": "https://glygen.org/publication/PubMed/18691976" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "24275569", "url": "https://glygen.org/publication/PubMed/24275569" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "PubMed", "id": "21406692", "url": "https://glygen.org/publication/PubMed/21406692" }, { "database": "PubMed", "id": "19690332", "url": "https://glygen.org/publication/PubMed/19690332" }, { "database": "PubMed", "id": "12719431", "url": "https://glygen.org/publication/PubMed/12719431" }, { "database": "iPTMnet", "id": "O00443", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O00443" }, { "database": "PubMed", "id": "18767875", "url": "https://glygen.org/publication/PubMed/18767875" }, { "database": "PubMed", "id": "19007248", "url": "https://glygen.org/publication/PubMed/19007248" }, { "database": "PubMed", "id": "19664994", "url": "https://glygen.org/publication/PubMed/19664994" }, { "database": "PubMed", "id": "19664995", "url": "https://glygen.org/publication/PubMed/19664995" }, { "database": "PubMed", "id": "19691289", "url": "https://glygen.org/publication/PubMed/19691289" }, { "database": "phospho.ELM", "id": "O00443", "url": "http://phospho.elm.eu.org/byAccession/O00443.html" } ], "site_lbl": "Ser259" }, { "start_pos": 327, "end_pos": 327, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O00443", "url": "https://www.uniprot.org/uniprot/O00443" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "PubMed", "id": "21406692", "url": "https://glygen.org/publication/PubMed/21406692" }, { "database": "iPTMnet", "id": "O00443", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O00443" } ], "site_lbl": "Ser327" }, { "start_pos": 338, "end_pos": 338, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O00443", "url": "https://www.uniprot.org/uniprot/O00443" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "iPTMnet", "id": "O00443", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O00443" }, { "database": "phospho.ELM", "id": "O00443", "url": "http://phospho.elm.eu.org/byAccession/O00443.html" } ], "site_lbl": "Ser338" }, { "start_pos": 60, "end_pos": 60, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O00443", "url": "https://www.uniprot.org/uniprot/O00443" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "iPTMnet", "id": "O00443", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O00443" }, { "database": "phospho.ELM", "id": "O00443", "url": "http://phospho.elm.eu.org/byAccession/O00443.html" } ], "site_lbl": "Ser60" }, { "start_pos": 630, "end_pos": 630, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O00443", "url": "https://www.uniprot.org/uniprot/O00443" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "iPTMnet", "id": "O00443", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O00443" } ], "site_lbl": "Ser630" }, { "start_pos": 73, "end_pos": 73, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O00443", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O00443" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Tyr73" } ], "glycation": [], "keywords": [ "enzyme", "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "Functional expression and characterisation of a new human phosphatidylinositol 4-kinase PI4K230.", "journal": "Biochimica et biophysica acta", "date": "1999", "authors": "Gehrmann T, Gulkan H, Suer S, Herberg FW, Balla A, Vereb G, Mayr GW, Heilmeyer LM Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-1660514", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1660514" } ], "reference": [ { "type": "PubMed", "id": "10101268", "url": "https://glygen.org/publication/PubMed/10101268" } ] }, { "title": "A novel SH2-containing phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase (SHIP2) is constitutively tyrosine phosphorylated and associated with src homologous and collagen gene (SHC) in chronic myelogenous leukemia progenitor cells.", "journal": "Blood", "date": "1999", "authors": "Wisniewski D, Strife A, Swendeman S, Erdjument-Bromage H, Geromanos S, Kavanaugh WM, Tempst P, Clarkson B", "evidence": [ { "database": "Reactome", "id": "R-HSA-1660499", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1660499" } ], "reference": [ { "type": "PubMed", "id": "10194451", "url": "https://glygen.org/publication/PubMed/10194451" } ] }, { "title": "SAC1-like domains of yeast SAC1, INP52, and INP53 and of human synaptojanin encode polyphosphoinositide phosphatases.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Guo S, Stolz LE, Lemrow SM, York JD", "evidence": [ { "database": "Reactome", "id": "R-HSA-1660499", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1660499" } ], "reference": [ { "type": "PubMed", "id": "10224048", "url": "https://glygen.org/publication/PubMed/10224048" } ] }, { "title": "Functional organization of clathrin in coats: combining electron cryomicroscopy and X-ray crystallography.", "journal": "Molecular cell", "date": "1999", "authors": "Musacchio A, Smith CJ, Roseman AM, Harrison SC, Kirchhausen T, Pearse BM", "evidence": [ { "database": "Reactome", "id": "R-HSA-432722", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-432722" } ], "reference": [ { "type": "PubMed", "id": "10394364", "url": "https://glygen.org/publication/PubMed/10394364" } ] }, { "title": "PIKfyve, a mammalian ortholog of yeast Fab1p lipid kinase, synthesizes 5-phosphoinositides. Effect of insulin.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Sbrissa D, Ikonomov OC, Shisheva A", "evidence": [ { "database": "Reactome", "id": "R-HSA-1660517", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1660517" } ], "reference": [ { "type": "PubMed", "id": "10419465", "url": "https://glygen.org/publication/PubMed/10419465" } ] }, { "title": "Essential role of phosphoinositide metabolism in synaptic vesicle recycling.", "journal": "Cell", "date": "1999", "authors": "Cremona O, Di Paolo G, Wenk MR, Luthi A, Kim WT, Takei K, Daniell L, Nemoto Y, Shears SB, Flavell RA, McCormick DA, De Camilli P", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "10535736", "url": "https://glygen.org/publication/PubMed/10535736" } ] }, { "title": "The SH3 domains of endophilin and amphiphysin bind to the proline-rich region of synaptojanin 1 at distinct sites that display an unconventional binding specificity.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Cestra G, Castagnoli L, Dente L, Minenkova O, Petrelli A, Migone N, Hoffmuller U, Schneider-Mergener J, Cesareni G", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "10542231", "url": "https://glygen.org/publication/PubMed/10542231" } ] }, { "title": "Crystal structure of the PTEN tumor suppressor: implications for its phosphoinositide phosphatase activity and membrane association.", "journal": "Cell", "date": "1999", "authors": "Lee JO, Yang H, Georgescu MM, Di Cristofano A, Maehama T, Shi Y, Dixon JE, Pandolfi P, Pavletich NP", "evidence": [ { "database": "Reactome", "id": "R-HSA-1660499", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1660499" } ], "reference": [ { "type": "PubMed", "id": "10555148", "url": "https://glygen.org/publication/PubMed/10555148" } ] }, { "title": "Spatial control of coated-pit dynamics in living cells.", "journal": "Nature cell biology", "date": "1999", "authors": "Gaidarov I, Santini F, Warren RA, Keen JH", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "10559856", "url": "https://glygen.org/publication/PubMed/10559856" } ] }, { "title": "Functional partnership between amphiphysin and dynamin in clathrin-mediated endocytosis.", "journal": "Nature cell biology", "date": "1999", "authors": "Takei K, Slepnev VI, Haucke V, De Camilli P", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "10559861", "url": "https://glygen.org/publication/PubMed/10559861" } ] }, { "title": "Phosphatidylinositol-3-OH kinases are Rab5 effectors.", "journal": "Nature cell biology", "date": "1999", "authors": "Christoforidis S, Miaczynska M, Ashman K, Wilm M, Zhao L, Yip SC, Waterfield MD, Backer JM, Zerial M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "10559924", "url": "https://glygen.org/publication/PubMed/10559924" } ] }, { "title": "ARF mediates recruitment of PtdIns-4-OH kinase-beta and stimulates synthesis of PtdIns(4,5)P2 on the Golgi complex.", "journal": "Nature cell biology", "date": "1999", "authors": "Godi A, Pertile P, Meyers R, Marra P, Di Tullio G, Iurisci C, Luini A, Corda D, De Matteis MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-1660514", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1660514" } ], "reference": [ { "type": "PubMed", "id": "10559940", "url": "https://glygen.org/publication/PubMed/10559940" } ] }, { "title": "Complementation analysis in PtdInsP kinase-deficient yeast mutants demonstrates that Schizosaccharomyces pombe and murine Fab1p homologues are phosphatidylinositol 3-phosphate 5-kinases.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "McEwen RK, Dove SK, Cooke FT, Painter GF, Holmes AB, Shisheva A, Ohya Y, Parker PJ, Michell RH", "evidence": [ { "database": "Reactome", "id": "R-HSA-1660514", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1660514" } ], "reference": [ { "type": "PubMed", "id": "10567352", "url": "https://glygen.org/publication/PubMed/10567352" } ] }, { "title": "Novel inositol polyphosphate 5-phosphatase localizes at membrane ruffles.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Mochizuki Y, Takenawa T", "evidence": [ { "database": "Reactome", "id": "R-HSA-1660499", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1660499" } ], "reference": [ { "type": "PubMed", "id": "10593988", "url": "https://glygen.org/publication/PubMed/10593988" } ] }, { "title": "Role of cyclin G-associated kinase in uncoating clathrin-coated vesicles from non-neuronal cells.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Greener T, Zhao X, Nojima H, Eisenberg E, Greene LE", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "10625686", "url": "https://glygen.org/publication/PubMed/10625686" } ] }, { "title": "Identification and characterization of a novel inositol polyphosphate 5-phosphatase.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Ijuin T, Mochizuki Y, Fukami K, Funaki M, Asano T, Takenawa T", "evidence": [ { "database": "Reactome", "id": "R-HSA-1660499", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1660499" } ], "reference": [ { "type": "PubMed", "id": "10753883", "url": "https://glygen.org/publication/PubMed/10753883" } ] }, { "title": "The isolation and characterization of a cDNA encoding phospholipid-specific inositol polyphosphate 5-phosphatase.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Kisseleva MV, Wilson MP, Majerus PW", "evidence": [ { "database": "Reactome", "id": "R-HSA-1660514", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1660514" } ], "reference": [ { "type": "PubMed", "id": "10764818", "url": "https://glygen.org/publication/PubMed/10764818" } ] }, { "title": "The class II phosphoinositide 3-kinase PI3K-C2alpha is concentrated in the trans-Golgi network and present in clathrin-coated vesicles.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Domin J, Gaidarov I, Smith ME, Keen JH, Waterfield MD", "evidence": [ { "database": "UniProtKB", "id": "O00443", "url": "https://www.uniprot.org/uniprot/O00443" }, { "database": "Reactome", "id": "R-HSA-1660514", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1660514" } ], "reference": [ { "type": "PubMed", "id": "10766823", "url": "https://glygen.org/publication/PubMed/10766823" } ] }, { "title": "Class II phosphoinositide 3-kinases are downstream targets of activated polypeptide growth factor receptors.", "journal": "Molecular and cellular biology", "date": "2000", "authors": "Arcaro A, Zvelebil MJ, Wallasch C, Ullrich A, Waterfield MD, Domin J", "evidence": [ { "database": "UniProtKB", "id": "O00443", "url": "https://www.uniprot.org/uniprot/O00443" }, { "database": "Reactome", "id": "R-HSA-1660514", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1660514" } ], "reference": [ { "type": "PubMed", "id": "10805725", "url": "https://glygen.org/publication/PubMed/10805725" } ] }, { "title": "Cloning and characterization of a 72-kDa inositol-polyphosphate 5-phosphatase localized to the Golgi network.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Kong AM, Speed CJ, O'Malley CJ, Layton MJ, Meehan T, Loveland KL, Cheema S, Ooms LM, Mitchell CA", "evidence": [ { "database": "Reactome", "id": "R-HSA-1660514", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1660514" } ], "reference": [ { "type": "PubMed", "id": "10806194", "url": "https://glygen.org/publication/PubMed/10806194" } ] }, { "title": "The phosphatidylinositol polyphosphate 5-phosphatase SHIP1 associates with the dok1 phosphoprotein in bcr-Abl transformed cells.", "journal": "Cellular signalling", "date": "2000", "authors": "Dunant NM, Wisniewski D, Strife A, Clarkson B, Resh MD", "evidence": [ { "database": "Reactome", "id": "R-HSA-1660499", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1660499" } ], "reference": [ { "type": "PubMed", "id": "10822173", "url": "https://glygen.org/publication/PubMed/10822173" } ] }, { "title": "Identification of pleckstrin-homology-domain-containing proteins with novel phosphoinositide-binding specificities.", "journal": "The Biochemical journal", "date": "2000", "authors": "Dowler S, Currie RA, Campbell DG, Deak M, Kular G, Downes CP, Alessi DR", "evidence": [ { "database": "Reactome", "id": "R-HSA-1660499", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1660499" } ], "reference": [ { "type": "PubMed", "id": "11001876", "url": "https://glygen.org/publication/PubMed/11001876" } ] }, { "title": "All three PACSIN isoforms bind to endocytic proteins and inhibit endocytosis.", "journal": "Journal of cell science", "date": "2000", "authors": "Modregger J, Ritter B, Witter B, Paulsson M, Plomann M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "11082044", "url": "https://glygen.org/publication/PubMed/11082044" } ] }, { "title": "Synaptojanin 2, a novel Rac1 effector that regulates clathrin-mediated endocytosis.", "journal": "Current biology : CB", "date": "2000", "authors": "Malecz N, McCabe PC, Spaargaren C, Qiu R, Chuang Y, Symons M", "evidence": [ { "database": "Reactome", "id": "R-HSA-1660499", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1660499" } ], "reference": [ { "type": "PubMed", "id": "11084340", "url": "https://glygen.org/publication/PubMed/11084340" } ] }, { "title": "Clathrin uncoating: Auxilin comes to life.", "journal": "Current biology : CB", "date": "2001", "authors": "Lemmon SK", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "11231140", "url": "https://glygen.org/publication/PubMed/11231140" } ] }, { "title": "The class II phosphoinositide 3-kinase C2alpha is activated by clathrin and regulates clathrin-mediated membrane trafficking.", "journal": "Molecular cell", "date": "2001", "authors": "Gaidarov I, Smith ME, Domin J, Keen JH", "evidence": [ { "database": "UniProtKB", "id": "O00443", "url": "https://www.uniprot.org/uniprot/O00443" }, { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "11239472", "url": "https://glygen.org/publication/PubMed/11239472" } ] }, { "title": "Cloning of a human type II phosphatidylinositol 4-kinase reveals a novel lipid kinase family.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Minogue S, Anderson JS, Waugh MG, dos Santos M, Corless S, Cramer R, Hsuan JJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-1660499", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1660499" } ], "reference": [ { "type": "PubMed", "id": "11279162", "url": "https://glygen.org/publication/PubMed/11279162" } ] }, { "title": "FYVE-DSP2, a FYVE domain-containing dual specificity protein phosphatase that dephosphorylates phosphotidylinositol 3-phosphate.", "journal": "Experimental cell research", "date": "2001", "authors": "Zhao R, Qi Y, Chen J, Zhao ZJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-1660499", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1660499" } ], "reference": [ { "type": "PubMed", "id": "11302699", "url": "https://glygen.org/publication/PubMed/11302699" } ] }, { "title": "The Src homology 2 domain containing inositol 5-phosphatase SHIP2 is recruited to the epidermal growth factor (EGF) receptor and dephosphorylates phosphatidylinositol 3,4,5-trisphosphate in EGF-stimulated COS-7 cells.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Pesesse X, Dewaste V, De Smedt F, Laffargue M, Giuriato S, Moreau C, Payrastre B, Erneux C", "evidence": [ { "database": "Reactome", "id": "R-HSA-1660499", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1660499" } ], "reference": [ { "type": "PubMed", "id": "11349134", "url": "https://glygen.org/publication/PubMed/11349134" } ] }, { "title": "Multiple interactions of auxilin 1 with clathrin and the AP-2 adaptor complex.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Scheele U, Kalthoff C, Ungewickell E", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "11470803", "url": "https://glygen.org/publication/PubMed/11470803" } ] }, { "title": "Phosphorylation of threonine 156 of the mu2 subunit of the AP2 complex is essential for endocytosis in vitro and in vivo.", "journal": "Current biology : CB", "date": "2001", "authors": "Olusanya O, Andrews PD, Swedlow JR, Smythe E", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "11516654", "url": "https://glygen.org/publication/PubMed/11516654" } ] }, { "title": "HIP1 functions in clathrin-mediated endocytosis through binding to clathrin and adaptor protein 2.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Metzler M, Legendre-Guillemin V, Gan L, Chopra V, Kwok A, McPherson PS, Hayden MR", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "11517213", "url": "https://glygen.org/publication/PubMed/11517213" } ] }, { "title": "The huntingtin interacting protein HIP1 is a clathrin and alpha-adaptin-binding protein involved in receptor-mediated endocytosis.", "journal": "Human molecular genetics", "date": "2001", "authors": "Waelter S, Scherzinger E, Hasenbank R, Nordhoff E, Lurz R, Goehler H, Gauss C, Sathasivam K, Bates GP, Lehrach H, Wanker EE", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "11532990", "url": "https://glygen.org/publication/PubMed/11532990" } ] }, { "title": "Clathrin- and AP-2-binding sites in HIP1 uncover a general assembly role for endocytic accessory proteins.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Mishra SK, Agostinelli NR, Brett TJ, Mizukami I, Ross TS, Traub LM", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "11577110", "url": "https://glygen.org/publication/PubMed/11577110" } ] }, { "title": "Identification and characterization of a novel Golgi protein, GCP60, that interacts with the integral membrane protein giantin.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Sohda M, Misumi Y, Yamamoto A, Yano A, Nakamura N, Ikehara Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-432722", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-432722" } ], "reference": [ { "type": "PubMed", "id": "11590181", "url": "https://glygen.org/publication/PubMed/11590181" } ] }, { "title": "PIP kinase Igamma is the major PI(4,5)P(2) synthesizing enzyme at the synapse.", "journal": "Neuron", "date": "2001", "authors": "Wenk MR, Pellegrini L, Klenchin VA, Di Paolo G, Chang S, Daniell L, Arioka M, Martin TF, De Camilli P", "evidence": [ { "database": "Reactome", "id": "R-HSA-1660499", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1660499" } ], "reference": [ { "type": "PubMed", "id": "11604140", "url": "https://glygen.org/publication/PubMed/11604140" } ] }, { "title": "Generation of high curvature membranes mediated by direct endophilin bilayer interactions.", "journal": "The Journal of cell biology", "date": "2001", "authors": "Farsad K, Ringstad N, Takei K, Floyd SR, Rose K, De Camilli P", "evidence": [ { "database": "Reactome", "id": "R-HSA-432722", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-432722" } ], "reference": [ { "type": "PubMed", "id": "11604418", "url": "https://glygen.org/publication/PubMed/11604418" } ] }, { "title": "Phosphatidylinositol 3-kinase c2alpha contains a nuclear localization sequence and associates with nuclear speckles.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Didichenko SA, Thelen M", "evidence": [ { "database": "UniProtKB", "id": "O00443", "url": "https://www.uniprot.org/uniprot/O00443" } ], "reference": [ { "type": "PubMed", "id": "11606566", "url": "https://glygen.org/publication/PubMed/11606566" } ] }, { "title": "Characterization of MTMR3. an inositol lipid 3-phosphatase with novel substrate specificity.", "journal": "Current biology : CB", "date": "2001", "authors": "Walker DM, Urbe S, Dove SK, Tenza D, Raposo G, Clague MJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-1660499", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1660499" } ], "reference": [ { "type": "PubMed", "id": "11676921", "url": "https://glygen.org/publication/PubMed/11676921" } ] }, { "title": "GGAs: roles of the different domains and comparison with AP-1 and clathrin.", "journal": "Molecular biology of the cell", "date": "2001", "authors": "Hirst J, Lindsay MR, Robinson MS", "evidence": [ { "database": "Reactome", "id": "R-HSA-432722", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-432722" } ], "reference": [ { "type": "PubMed", "id": "11694590", "url": "https://glygen.org/publication/PubMed/11694590" } ] }, { "title": "Phosphatidylinositol 3-phosphate-interacting domains in PIKfyve. Binding specificity and role in PIKfyve. Endomenbrane localization.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Sbrissa D, Ikonomov OC, Shisheva A", "evidence": [ { "database": "Reactome", "id": "R-HSA-1660517", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1660517" } ], "reference": [ { "type": "PubMed", "id": "11706043", "url": "https://glygen.org/publication/PubMed/11706043" } ] }, { "title": "TPIP: a novel phosphoinositide 3-phosphatase.", "journal": "The Biochemical journal", "date": "2001", "authors": "Walker SM, Downes CP, Leslie NR", "evidence": [ { "database": "Reactome", "id": "R-HSA-1660514", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1660514" } ], "reference": [ { "type": "PubMed", "id": "11716755", "url": "https://glygen.org/publication/PubMed/11716755" } ] }, { "title": "Myotubularin and MTMR2, phosphatidylinositol 3-phosphatases mutated in myotubular myopathy and type 4B Charcot-Marie-Tooth disease.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Kim SA, Taylor GS, Torgersen KM, Dixon JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-1660517", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1660517" } ], "reference": [ { "type": "PubMed", "id": "11733541", "url": "https://glygen.org/publication/PubMed/11733541" } ] }, { "title": "Interaction between tyrosine kinase Etk and a RUN domain- and FYVE domain-containing protein RUFY1. A possible role of ETK in regulation of vesicle trafficking.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Yang J, Kim O, Wu J, Qiu Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-1660499", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1660499" } ], "reference": [ { "type": "PubMed", "id": "11877430", "url": "https://glygen.org/publication/PubMed/11877430" } ] }, { "title": "Phosphorylation of the AP2 mu subunit by AAK1 mediates high affinity binding to membrane protein sorting signals.", "journal": "The Journal of cell biology", "date": "2002", "authors": "Ricotta D, Conner SD, Schmid SL, von Figura K, Honing S", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "11877457", "url": "https://glygen.org/publication/PubMed/11877457" } ] }, { "title": "Identification of an adaptor-associated kinase, AAK1, as a regulator of clathrin-mediated endocytosis.", "journal": "The Journal of cell biology", "date": "2002", "authors": "Conner SD, Schmid SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "11877461", "url": "https://glygen.org/publication/PubMed/11877461" } ] }, { "title": "HIP1 and HIP12 display differential binding to F-actin, AP2, and clathrin. Identification of a novel interaction with clathrin light chain.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Legendre-Guillemin V, Metzler M, Charbonneau M, Gan L, Chopra V, Philie J, Hayden MR, McPherson PS", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "11889126", "url": "https://glygen.org/publication/PubMed/11889126" } ] }, { "title": "Characterization of type II phosphatidylinositol 4-kinase isoforms reveals association of the enzymes with endosomal vesicular compartments.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Balla A, Tuymetova G, Barshishat M, Geiszt M, Balla T", "evidence": [ { "database": "Reactome", "id": "R-HSA-1660499", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1660499" } ], "reference": [ { "type": "PubMed", "id": "11923287", "url": "https://glygen.org/publication/PubMed/11923287" } ] }, { "title": "Regulated transport of the glucose transporter GLUT4.", "journal": "Nature reviews. Molecular cell biology", "date": "2002", "authors": "Bryant NJ, Govers R, James DE", "evidence": [ { "database": "Reactome", "id": "R-HSA-432722", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-432722" } ], "reference": [ { "type": "PubMed", "id": "11994746", "url": "https://glygen.org/publication/PubMed/11994746" } ] }, { "title": "Accessory protein recruitment motifs in clathrin-mediated endocytosis.", "journal": "Structure (London, England : 1993)", "date": "2002", "authors": "Brett TJ, Traub LM, Fremont DH", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "12057195", "url": "https://glygen.org/publication/PubMed/12057195" } ] }, { "title": "TAPP1 and TAPP2 are targets of phosphatidylinositol 3-kinase signaling in B cells: sustained plasma membrane recruitment triggered by the B-cell antigen receptor.", "journal": "Molecular and cellular biology", "date": "2002", "authors": "Marshall AJ, Krahn AK, Ma K, Duronio V, Hou S", "evidence": [ { "database": "Reactome", "id": "R-HSA-1660499", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1660499" } ], "reference": [ { "type": "PubMed", "id": "12101241", "url": "https://glygen.org/publication/PubMed/12101241" } ] }, { "title": "The PtdIns3P phosphatase myotubularin is a cytoplasmic protein that also localizes to Rac1-inducible plasma membrane ruffles.", "journal": "Journal of cell science", "date": "2002", "authors": "Laporte J, Blondeau F, Gansmuller A, Lutz Y, Vonesch JL, Mandel JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-1660499", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1660499" } ], "reference": [ { "type": "PubMed", "id": "12118066", "url": "https://glygen.org/publication/PubMed/12118066" } ] }, { "title": "Enthoprotin: a novel clathrin-associated protein identified through subcellular proteomics.", "journal": "The Journal of cell biology", "date": "2002", "authors": "Wasiak S, Legendre-Guillemin V, Puertollano R, Blondeau F, Girard M, de Heuvel E, Boismenu D, Bell AW, Bonifacino JS, McPherson PS", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "12213833", "url": "https://glygen.org/publication/PubMed/12213833" } ] }, { "title": "Phosphatidylinositol 5-phosphate biosynthesis is linked to PIKfyve and is involved in osmotic response pathway in mammalian cells.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Sbrissa D, Ikonomov OC, Deeb R, Shisheva A", "evidence": [ { "database": "Reactome", "id": "R-HSA-1660517", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1660517" } ], "reference": [ { "type": "PubMed", "id": "12270933", "url": "https://glygen.org/publication/PubMed/12270933" } ] }, { "title": "Type II phosphatidylinositol 4-kinase beta is a cytosolic and peripheral membrane protein that is recruited to the plasma membrane and activated by Rac-GTP.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Wei YJ, Sun HQ, Yamamoto M, Wlodarski P, Kunii K, Martinez M, Barylko B, Albanesi JP, Yin HL", "evidence": [ { "database": "Reactome", "id": "R-HSA-1660499", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1660499" } ], "reference": [ { "type": "PubMed", "id": "12324459", "url": "https://glygen.org/publication/PubMed/12324459" } ] }, { "title": "Recruitment and regulation of phosphatidylinositol phosphate kinase type 1 gamma by the FERM domain of talin.", "journal": "Nature", "date": "2002", "authors": "Di Paolo G, Pellegrini L, Letinic K, Cestra G, Zoncu R, Voronov S, Chang S, Guo J, Wenk MR, De Camilli P", "evidence": [ { "database": "Reactome", "id": "R-HSA-1660499", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1660499" } ], "reference": [ { "type": "PubMed", "id": "12422219", "url": "https://glygen.org/publication/PubMed/12422219" } ] }, { "title": "ARF6-GTP recruits Nm23-H1 to facilitate dynamin-mediated endocytosis during adherens junctions disassembly.", "journal": "Nature cell biology", "date": "2002", "authors": "Palacios F, Schweitzer JK, Boshans RL, D'Souza-Schorey C", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "12447393", "url": "https://glygen.org/publication/PubMed/12447393" } ] }, { "title": "Identification of a novel domain in two mammalian inositol-polyphosphate 5-phosphatases that mediates membrane ruffle localization. The inositol 5-phosphatase skip localizes to the endoplasmic reticulum and translocates to membrane ruffles following epidermal growth factor stimulation.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Gurung R, Tan A, Ooms LM, McGrath MJ, Huysmans RD, Munday AD, Prescott M, Whisstock JC, Mitchell CA", "evidence": [ { "database": "Reactome", "id": "R-HSA-1660499", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1660499" } ], "reference": [ { "type": "PubMed", "id": "12536145", "url": "https://glygen.org/publication/PubMed/12536145" } ] }, { "title": "Phosphatidylinositol-5-phosphate activation and conserved substrate specificity of the myotubularin phosphatidylinositol 3-phosphatases.", "journal": "Current biology : CB", "date": "2003", "authors": "Schaletzky J, Dove SK, Short B, Lorenzo O, Clague MJ, Barr FA", "evidence": [ { "database": "Reactome", "id": "R-HSA-1660499", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1660499" } ], "reference": [ { "type": "PubMed", "id": "12646134", "url": "https://glygen.org/publication/PubMed/12646134" } ] }, { "title": "Mitotic and stress-induced phosphorylation of HsPI3K-C2alpha targets the protein for degradation.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Didichenko SA, Fragoso CM, Thelen M", "evidence": [ { "database": "UniProtKB", "id": "O00443", "url": "https://www.uniprot.org/uniprot/O00443" }, { "database": "iPTMnet", "id": "O00443", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O00443" } ], "reference": [ { "type": "PubMed", "id": "12719431", "url": "https://glygen.org/publication/PubMed/12719431" } ] }, { "title": "Membrane-binding and activation mechanism of PTEN.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2003", "authors": "Das S, Dixon JE, Cho W", "evidence": [ { "database": "Reactome", "id": "R-HSA-1660499", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1660499" } ], "reference": [ { "type": "PubMed", "id": "12808147", "url": "https://glygen.org/publication/PubMed/12808147" } ] }, { "title": "ARF6 stimulates clathrin/AP-2 recruitment to synaptic membranes by activating phosphatidylinositol phosphate kinase type Igamma.", "journal": "The Journal of cell biology", "date": "2003", "authors": "Krauss M, Kinuta M, Wenk MR, De Camilli P, Takei K, Haucke V", "evidence": [ { "database": "Reactome", "id": "R-HSA-1660499", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1660499" } ], "reference": [ { "type": "PubMed", "id": "12847086", "url": "https://glygen.org/publication/PubMed/12847086" } ] }, { "title": "Identification of myotubularin as the lipid phosphatase catalytic subunit associated with the 3-phosphatase adapter protein, 3-PAP.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2003", "authors": "Nandurkar HH, Layton M, Laporte J, Selan C, Corcoran L, Caldwell KK, Mochizuki Y, Majerus PW, Mitchell CA", "evidence": [ { "database": "Reactome", "id": "R-HSA-1660516", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1660516" } ], "reference": [ { "type": "PubMed", "id": "12847286", "url": "https://glygen.org/publication/PubMed/12847286" } ] }, { "title": "Characterization of myotubularin-related protein 7 and its binding partner, myotubularin-related protein 9.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2003", "authors": "Mochizuki Y, Majerus PW", "evidence": [ { "database": "Reactome", "id": "R-HSA-1660517", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1660517" } ], "reference": [ { "type": "PubMed", "id": "12890864", "url": "https://glygen.org/publication/PubMed/12890864" } ] }, { "title": "Sorting nexin 9 participates in clathrin-mediated endocytosis through interactions with the core components.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Lundmark R, Carlsson SR", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "12952949", "url": "https://glygen.org/publication/PubMed/12952949" } ] }, { "title": "Interaction of the protein tyrosine phosphatase PTPL1 with the PtdIns(3,4)P2-binding adaptor protein TAPP1.", "journal": "The Biochemical journal", "date": "2003", "authors": "Kimber WA, Deak M, Prescott AR, Alessi DR", "evidence": [ { "database": "Reactome", "id": "R-HSA-1660499", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1660499" } ], "reference": [ { "type": "PubMed", "id": "14516276", "url": "https://glygen.org/publication/PubMed/14516276" } ] }, { "title": "The human phosphatidylinositol phosphatase SAC1 interacts with the coatomer I complex.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Rohde HM, Cheong FY, Konrad G, Paiha K, Mayinger P, Boehmelt G", "evidence": [ { "database": "Reactome", "id": "R-HSA-1660514", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1660514" } ], "reference": [ { "type": "PubMed", "id": "14527956", "url": "https://glygen.org/publication/PubMed/14527956" } ] }, { "title": "Identification of a family of endocytic proteins that define a new alpha-adaptin ear-binding motif.", "journal": "EMBO reports", "date": "2003", "authors": "Ritter B, Philie J, Girard M, Tung EC, Blondeau F, McPherson PS", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "14555962", "url": "https://glygen.org/publication/PubMed/14555962" } ] }, { "title": "Topographical expression of class IA and class II phosphoinositide 3-kinase enzymes in normal human tissues is consistent with a role in differentiation.", "journal": "BMC Clin. Pathol.", "date": "2003", "authors": "El Sheikh Soha Salama, Domin Jan, Tomtitchong Prakitpunthu, Abel Paul, Stamp Gordon, Lalani El-Nasir", "evidence": [ { "database": "UniProtKB", "id": "O00443", "url": "https://www.uniprot.org/uniprot/O00443" } ], "reference": [ { "type": "PubMed", "id": "14563213", "url": "https://glygen.org/publication/PubMed/14563213" } ] }, { "title": "Clathrin promotes incorporation of cargo into coated pits by activation of the AP2 adaptor micro2 kinase.", "journal": "The Journal of cell biology", "date": "2003", "authors": "Jackson AP, Flett A, Smythe C, Hufton L, Wettey FR, Smythe E", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "14581451", "url": "https://glygen.org/publication/PubMed/14581451" } ] }, { "title": "AAK1-mediated micro2 phosphorylation is stimulated by assembled clathrin.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2003", "authors": "Conner SD, Schroter T, Schmid SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "14617351", "url": "https://glygen.org/publication/PubMed/14617351" } ] }, { "title": "Rabip4' is an effector of rab5 and rab4 and regulates transport through early endosomes.", "journal": "Molecular biology of the cell", "date": "2004", "authors": "Fouraux MA, Deneka M, Ivan V, van der Heijden A, Raymackers J, van Suylekom D, van Venrooij WJ, van der Sluijs P, Pruijn GJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-1660499", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1660499" } ], "reference": [ { "type": "PubMed", "id": "14617813", "url": "https://glygen.org/publication/PubMed/14617813" } ] }, { "title": "Synaptojanin is recruited by endophilin to promote synaptic vesicle uncoating.", "journal": "Neuron", "date": "2003", "authors": "Verstreken P, Koh TW, Schulze KL, Zhai RG, Hiesinger PR, Zhou Y, Mehta SQ, Cao Y, Roos J, Bellen HJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "14622578", "url": "https://glygen.org/publication/PubMed/14622578" } ] }, { "title": "Endophilin is required for synaptic vesicle endocytosis by localizing synaptojanin.", "journal": "Neuron", "date": "2003", "authors": "Schuske KR, Richmond JE, Matthies DS, Davis WS, Runz S, Rube DA, van der Bliek AM, Jorgensen EM", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "14622579", "url": "https://glygen.org/publication/PubMed/14622579" } ] }, { "title": "The TPTE gene family: cellular expression, subcellular localization and alternative splicing.", "journal": "Gene", "date": "2003", "authors": "Tapparel C, Reymond A, Girardet C, Guillou L, Lyle R, Lamon C, Hutter P, Antonarakis SE", "evidence": [ { "database": "Reactome", "id": "R-HSA-1660514", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1660514" } ], "reference": [ { "type": "PubMed", "id": "14659893", "url": "https://glygen.org/publication/PubMed/14659893" } ] }, { "title": "Production of phosphatidylinositol 5-phosphate by the phosphoinositide 3-phosphatase myotubularin in mammalian cells.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Tronchere H, Laporte J, Pendaries C, Chaussade C, Liaubet L, Pirola L, Mandel JL, Payrastre B", "evidence": [ { "database": "Reactome", "id": "R-HSA-1660517", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1660517" } ], "reference": [ { "type": "PubMed", "id": "14660569", "url": "https://glygen.org/publication/PubMed/14660569" } ] }, { "title": "Myotubularin regulates the function of the late endosome through the gram domain-phosphatidylinositol 3,5-bisphosphate interaction.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Tsujita K, Itoh T, Ijuin T, Yamamoto A, Shisheva A, Laporte J, Takenawa T", "evidence": [ { "database": "Reactome", "id": "R-HSA-1660517", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1660517" } ], "reference": [ { "type": "PubMed", "id": "14722070", "url": "https://glygen.org/publication/PubMed/14722070" } ] }, { "title": "InsP3-mediated intracellular calcium signalling is altered by expression of synaptojanin-1.", "journal": "The Biochemical journal", "date": "2004", "authors": "Johenning FW, Wenk MR, Uhlen P, Degray B, Lee E, De Camilli P, Ehrlich BE", "evidence": [ { "database": "Reactome", "id": "R-HSA-1660499", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1660499" } ], "reference": [ { "type": "PubMed", "id": "15080793", "url": "https://glygen.org/publication/PubMed/15080793" } ] }, { "title": "Identification of snapin and three novel proteins (BLOS1, BLOS2, and BLOS3/reduced pigmentation) as subunits of biogenesis of lysosome-related organelles complex-1 (BLOC-1).", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Starcevic M, Dell'Angelica EC", "evidence": [ { "database": "Reactome", "id": "R-HSA-432722", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-432722" } ], "reference": [ { "type": "PubMed", "id": "15102850", "url": "https://glygen.org/publication/PubMed/15102850" } ] }, { "title": "FAPPs control Golgi-to-cell-surface membrane traffic by binding to ARF and PtdIns(4)P.", "journal": "Nature cell biology", "date": "2004", "authors": "Godi A, Di Campli A, Konstantakopoulos A, Di Tullio G, Alessi DR, Kular GS, Daniele T, Marra P, Lucocq JM, De Matteis MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-1660499", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1660499" } ], "reference": [ { "type": "PubMed", "id": "15107860", "url": "https://glygen.org/publication/PubMed/15107860" } ] }, { "title": "Cloning, expression, purification, and characterization of the human Class Ia phosphoinositide 3-kinase isoforms.", "journal": "Protein expression and purification", "date": "2004", "authors": "Meier TI, Cook JA, Thomas JE, Radding JA, Horn C, Lingaraj T, Smith MC", "evidence": [ { "database": "Reactome", "id": "R-HSA-1660499", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1660499" } ], "reference": [ { "type": "PubMed", "id": "15135396", "url": "https://glygen.org/publication/PubMed/15135396" } ] }, { "title": "A novel dynamin-associating molecule, formin-binding protein 17, induces tubular membrane invaginations and participates in endocytosis.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Kamioka Y, Fukuhara S, Sawa H, Nagashima K, Masuda M, Matsuda M, Mochizuki N", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "15252009", "url": "https://glygen.org/publication/PubMed/15252009" } ] }, { "title": "Dap160/intersectin scaffolds the periactive zone to achieve high-fidelity endocytosis and normal synaptic growth.", "journal": "Neuron", "date": "2004", "authors": "Marie B, Sweeney ST, Poskanzer KE, Roos J, Kelly RB, Davis GW", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "15260957", "url": "https://glygen.org/publication/PubMed/15260957" } ] }, { "title": "The stimulatory action of amphiphysin on dynamin function is dependent on lipid bilayer curvature.", "journal": "The EMBO journal", "date": "2004", "authors": "Yoshida Y, Kinuta M, Abe T, Liang S, Araki K, Cremona O, Di Paolo G, Moriyama Y, Yasuda T, De Camilli P, Takei K", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "15318165", "url": "https://glygen.org/publication/PubMed/15318165" } ] }, { "title": "Endocytosis by random initiation and stabilization of clathrin-coated pits.", "journal": "Cell", "date": "2004", "authors": "Ehrlich M, Boll W, Van Oijen A, Hariharan R, Chandran K, Nibert ML, Kirchhausen T", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "15339664", "url": "https://glygen.org/publication/PubMed/15339664" } ] }, { "title": "Regulation and cellular roles of phosphoinositide 5-kinases.", "journal": "European journal of pharmacology", "date": "2004", "authors": "Oude Weernink PA, Schmidt M, Jakobs KH", "evidence": [ { "database": "Reactome", "id": "R-HSA-1660499", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1660499" } ], "reference": [ { "type": "PubMed", "id": "15464023", "url": "https://glygen.org/publication/PubMed/15464023" } ] }, { "title": "Molecular model for a complete clathrin lattice from electron cryomicroscopy.", "journal": "Nature", "date": "2004", "authors": "Fotin A, Cheng Y, Sliz P, Grigorieff N, Harrison SC, Kirchhausen T, Walz T", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "15502812", "url": "https://glygen.org/publication/PubMed/15502812" } ] }, { "title": "Structure of an auxilin-bound clathrin coat and its implications for the mechanism of uncoating.", "journal": "Nature", "date": "2004", "authors": "Fotin A, Cheng Y, Grigorieff N, Walz T, Harrison SC, Kirchhausen T", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "15502813", "url": "https://glygen.org/publication/PubMed/15502813" } ] }, { "title": "BAR domains and membrane curvature: bringing your curves to the BAR.", "journal": "Biochemical Society symposium", "date": "2005", "authors": "Gallop JL, McMahon HT", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "15649145", "url": "https://glygen.org/publication/PubMed/15649145" } ] }, { "title": "SNX9 regulates dynamin assembly and is required for efficient clathrin-mediated endocytosis.", "journal": "Molecular biology of the cell", "date": "2005", "authors": "Soulet F, Yarar D, Leonard M, Schmid SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "15703209", "url": "https://glygen.org/publication/PubMed/15703209" } ] }, { "title": "The type Ialpha inositol polyphosphate 4-phosphatase generates and terminates phosphoinositide 3-kinase signals on endosomes and the plasma membrane.", "journal": "Molecular biology of the cell", "date": "2005", "authors": "Ivetac I, Munday AD, Kisseleva MV, Zhang XM, Luff S, Tiganis T, Whisstock JC, Rowe T, Majerus PW, Mitchell CA", "evidence": [ { "database": "Reactome", "id": "R-HSA-1660516", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1660516" } ], "reference": [ { "type": "PubMed", "id": "15716355", "url": "https://glygen.org/publication/PubMed/15716355" } ] }, { "title": "p84, a new Gbetagamma-activated regulatory subunit of the type IB phosphoinositide 3-kinase p110gamma.", "journal": "Current biology : CB", "date": "2005", "authors": "Suire S, Coadwell J, Ferguson GJ, Davidson K, Hawkins P, Stephens L", "evidence": [ { "database": "Reactome", "id": "R-HSA-1660499", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1660499" } ], "reference": [ { "type": "PubMed", "id": "15797027", "url": "https://glygen.org/publication/PubMed/15797027" } ] }, { "title": "The small G-protein Arf6GTP recruits the AP-2 adaptor complex to membranes.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Paleotti O, Macia E, Luton F, Klein S, Partisani M, Chardin P, Kirchhausen T, Franco M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "15802264", "url": "https://glygen.org/publication/PubMed/15802264" } ] }, { "title": "Analysis of phosphoinositide binding domain properties within the myotubularin-related protein MTMR3.", "journal": "Journal of cell science", "date": "2005", "authors": "Lorenzo O, Urbe S, Clague MJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-1660499", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1660499" } ], "reference": [ { "type": "PubMed", "id": "15840652", "url": "https://glygen.org/publication/PubMed/15840652" } ] }, { "title": "Caenorhabditis elegans RME-6 is a novel regulator of RAB-5 at the clathrin-coated pit.", "journal": "Nature cell biology", "date": "2005", "authors": "Sato M, Sato K, Fonarev P, Huang CJ, Liou W, Grant BD", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "15895077", "url": "https://glygen.org/publication/PubMed/15895077" } ] }, { "title": "Phosphatidylinositol-(4,5)-bisphosphate regulates sorting signal recognition by the clathrin-associated adaptor complex AP2.", "journal": "Molecular cell", "date": "2005", "authors": "Honing S, Ricotta D, Krauss M, Spate K, Spolaore B, Motley A, Robinson M, Robinson C, Haucke V, Owen DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "15916959", "url": "https://glygen.org/publication/PubMed/15916959" } ] }, { "title": "An enzymatic cascade of Rab5 effectors regulates phosphoinositide turnover in the endocytic pathway.", "journal": "The Journal of cell biology", "date": "2005", "authors": "Shin HW, Hayashi M, Christoforidis S, Lacas-Gervais S, Hoepfner S, Wenk MR, Modregger J, Uttenweiler-Joseph S, Wilm M, Nystuen A, Frankel WN, Solimena M, De Camilli P, Zerial M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "16103228", "url": "https://glygen.org/publication/PubMed/16103228" } ] }, { "title": "Characterization of the role of the Rab GTPase-activating protein AS160 in insulin-regulated GLUT4 trafficking.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Larance M, Ramm G, Stockli J, van Dam EM, Winata S, Wasinger V, Simpson F, Graham M, Junutula JR, Guilhaus M, James DE", "evidence": [ { "database": "Reactome", "id": "R-HSA-1660499", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1660499" } ], "reference": [ { "type": "PubMed", "id": "16154996", "url": "https://glygen.org/publication/PubMed/16154996" } ] }, { "title": "Depletion of GAK/auxilin 2 inhibits receptor-mediated endocytosis and recruitment of both clathrin and clathrin adaptors.", "journal": "Journal of cell science", "date": "2005", "authors": "Lee DW, Zhao X, Zhang F, Eisenberg E, Greene LE", "evidence": [ { "database": "Reactome", "id": "R-HSA-432722", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-432722" } ], "reference": [ { "type": "PubMed", "id": "16155256", "url": "https://glygen.org/publication/PubMed/16155256" } ] }, { "title": "Individual phosphoinositide 3-kinase C2alpha domain activities independently regulate clathrin function.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Gaidarov I, Zhao Y, Keen JH", "evidence": [ { "database": "UniProtKB", "id": "O00443", "url": "https://www.uniprot.org/uniprot/O00443" }, { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "16215232", "url": "https://glygen.org/publication/PubMed/16215232" } ] }, { "title": "Dynamin and the actin cytoskeleton cooperatively regulate plasma membrane invagination by BAR and F-BAR proteins.", "journal": "Developmental cell", "date": "2005", "authors": "Itoh T, Erdmann KS, Roux A, Habermann B, Werner H, De Camilli P", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "16326391", "url": "https://glygen.org/publication/PubMed/16326391" } ] }, { "title": "Multi-level regulation of myotubularin-related protein-2 phosphatase activity by myotubularin-related protein-13/set-binding factor-2.", "journal": "Human molecular genetics", "date": "2006", "authors": "Berger P, Berger I, Schaffitzel C, Tersar K, Volkmer B, Suter U", "evidence": [ { "database": "Reactome", "id": "R-HSA-1660499", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1660499" } ], "reference": [ { "type": "PubMed", "id": "16399794", "url": "https://glygen.org/publication/PubMed/16399794" } ] }, { "title": "Rab5-activating protein 6, a novel endosomal protein with a role in endocytosis.", "journal": "Biochemical and biophysical research communications", "date": "2006", "authors": "Hunker CM, Galvis A, Kruk I, Giambini H, Veisaga ML, Barbieri MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "16410077", "url": "https://glygen.org/publication/PubMed/16410077" } ] }, { "title": "Characterization of p87PIKAP, a novel regulatory subunit of phosphoinositide 3-kinase gamma that is highly expressed in heart and interacts with PDE3B.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Voigt P, Dorner MB, Schaefer M", "evidence": [ { "database": "Reactome", "id": "R-HSA-1660499", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1660499" } ], "reference": [ { "type": "PubMed", "id": "16476736", "url": "https://glygen.org/publication/PubMed/16476736" } ] }, { "title": "Molecular switches involving the AP-2 beta2 appendage regulate endocytic cargo selection and clathrin coat assembly.", "journal": "Developmental cell", "date": "2006", "authors": "Edeling MA, Mishra SK, Keyel PA, Steinhauser AL, Collins BM, Roth R, Heuser JE, Owen DJ, Traub LM", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "16516836", "url": "https://glygen.org/publication/PubMed/16516836" } ] }, { "title": "The Rab4 effector Rabip4 plays a role in the endocytotic trafficking of Glut 4 in 3T3-L1 adipocytes.", "journal": "Journal of cell science", "date": "2006", "authors": "Mari M, Monzo P, Kaddai V, Keslair F, Gonzalez T, Le Marchand-Brustel Y, Cormont M", "evidence": [ { "database": "Reactome", "id": "R-HSA-1660499", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1660499" } ], "reference": [ { "type": "PubMed", "id": "16522682", "url": "https://glygen.org/publication/PubMed/16522682" } ] }, { "title": "Isolation and characterization of two 3-phosphatases that hydrolyze both phosphatidylinositol 3-phosphate and inositol 1,3-bisphosphate.", "journal": "The Journal of biological chemistry", "date": "1991", "authors": "Caldwell KK, Lips DL, Bansal VS, Majerus PW", "evidence": [ { "database": "Reactome", "id": "R-HSA-1660516", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1660516" } ], "reference": [ { "type": "PubMed", "id": "1655747", "url": "https://glygen.org/publication/PubMed/1655747" } ] }, { "title": "Type Igamma661 phosphatidylinositol phosphate kinase directly interacts with AP2 and regulates endocytosis.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Bairstow SF, Ling K, Su X, Firestone AJ, Carbonara C, Anderson RA", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "16707488", "url": "https://glygen.org/publication/PubMed/16707488" } ] }, { "title": "Systematic analysis of myotubularins: heteromeric interactions, subcellular localisation and endosome related functions.", "journal": "Journal of cell science", "date": "2006", "authors": "Lorenzo O, Urbe S, Clague MJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-1660517", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1660517" } ], "reference": [ { "type": "PubMed", "id": "16787938", "url": "https://glygen.org/publication/PubMed/16787938" } ] }, { "title": "A burst of auxilin recruitment determines the onset of clathrin-coated vesicle uncoating.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2006", "authors": "Massol RH, Boll W, Griffin AM, Kirchhausen T", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "16798879", "url": "https://glygen.org/publication/PubMed/16798879" } ] }, { "title": "Stimulation of phosphatidylinositol kinase type I-mediated phosphatidylinositol (4,5)-bisphosphate synthesis by AP-2mu-cargo complexes.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2006", "authors": "Krauss M, Kukhtina V, Pechstein A, Haucke V", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "16880396", "url": "https://glygen.org/publication/PubMed/16880396" } ] }, { "title": "Role of the AP2 beta-appendage hub in recruiting partners for clathrin-coated vesicle assembly.", "journal": "PLoS biology", "date": "2006", "authors": "Schmid EM, Ford MG, Burtey A, Praefcke GJ, Peak-Chew SY, Mills IG, Benmerah A, McMahon HT", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "16903783", "url": "https://glygen.org/publication/PubMed/16903783" } ] }, { "title": "Specificity of the myotubularin family of phosphatidylinositol-3-phosphatase is determined by the PH/GRAM domain.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Choudhury P, Srivastava S, Li Z, Ko K, Albaqumi M, Narayan K, Coetzee WA, Lemmon MA, Skolnik EY", "evidence": [ { "database": "Reactome", "id": "R-HSA-1660499", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1660499" } ], "reference": [ { "type": "PubMed", "id": "16914545", "url": "https://glygen.org/publication/PubMed/16914545" } ] }, { "title": "A role for PtdIns(4,5)P2 and PIP5Kalpha in regulating stress-induced apoptosis.", "journal": "Current biology : CB", "date": "2006", "authors": "Halstead JR, van Rheenen J, Snel MH, Meeuws S, Mohammed S, D'Santos CS, Heck AJ, Jalink K, Divecha N", "evidence": [ { "database": "Reactome", "id": "R-HSA-1660499", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1660499" } ], "reference": [ { "type": "PubMed", "id": "16979564", "url": "https://glygen.org/publication/PubMed/16979564" } ] }, { "title": "A novel PtdIns3P and PtdIns(3,5)P2 phosphatase with an inactivating variant in centronuclear myopathy.", "journal": "Human molecular genetics", "date": "2006", "authors": "Tosch V, Rohde HM, Tronchere H, Zanoteli E, Monroy N, Kretz C, Dondaine N, Payrastre B, Mandel JL, Laporte J", "evidence": [ { "database": "Reactome", "id": "R-HSA-1660499", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1660499" } ], "reference": [ { "type": "PubMed", "id": "17008356", "url": "https://glygen.org/publication/PubMed/17008356" } ] }, { "title": "Cargo regulates clathrin-coated pit dynamics.", "journal": "Cell", "date": "2006", "authors": "Puthenveedu MA, von Zastrow M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "17018281", "url": "https://glygen.org/publication/PubMed/17018281" } ] }, { "title": "Phosphoinositides in cell regulation and membrane dynamics.", "journal": "Nature", "date": "2006", "authors": "Di Paolo G, De Camilli P", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "17035995", "url": "https://glygen.org/publication/PubMed/17035995" } ] }, { "title": "Structural and membrane binding analysis of the Phox homology domain of phosphoinositide 3-kinase-C2alpha.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Stahelin RV, Karathanassis D, Bruzik KS, Waterfield MD, Bravo J, Williams RL, Cho W", "evidence": [ { "database": "UniProtKB", "id": "O00443", "url": "https://www.uniprot.org/uniprot/O00443" } ], "reference": [ { "type": "PubMed", "id": "17038310", "url": "https://glygen.org/publication/PubMed/17038310" } ] }, { "title": "Comparative proteomics of clathrin-coated vesicles.", "journal": "The Journal of cell biology", "date": "2006", "authors": "Borner GH, Harbour M, Hester S, Lilley KS, Robinson MS", "evidence": [ { "database": "Reactome", "id": "R-HSA-432722", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-432722" } ], "reference": [ { "type": "PubMed", "id": "17116749", "url": "https://glygen.org/publication/PubMed/17116749" } ] }, { "title": "Two synaptojanin 1 isoforms are recruited to clathrin-coated pits at different stages.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2006", "authors": "Perera RM, Zoncu R, Lucast L, De Camilli P, Toomre D", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "17158794", "url": "https://glygen.org/publication/PubMed/17158794" } ] }, { "title": "Phospholipase D signaling: orchestration by PIP2 and small GTPases.", "journal": "Naunyn-Schmiedeberg's archives of pharmacology", "date": "2007", "authors": "Oude Weernink PA, Lopez de Jesus M, Schmidt M", "evidence": [ { "database": "Reactome", "id": "R-HSA-1660499", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1660499" } ], "reference": [ { "type": "PubMed", "id": "17245604", "url": "https://glygen.org/publication/PubMed/17245604" } ] }, { "title": "Role of class II phosphoinositide 3-kinase in cell signalling.", "journal": "Biochem. Soc. Trans.", "date": "2007", "authors": "Falasca M, Maffucci T", "evidence": [ { "database": "UniProtKB", "id": "O00443", "url": "https://www.uniprot.org/uniprot/O00443" } ], "reference": [ { "type": "PubMed", "id": "17371240", "url": "https://glygen.org/publication/PubMed/17371240" } ] }, { "title": "A novel AAK1 splice variant functions at multiple steps of the endocytic pathway.", "journal": "Molecular biology of the cell", "date": "2007", "authors": "Henderson DM, Conner SD", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "17494869", "url": "https://glygen.org/publication/PubMed/17494869" } ] }, { "title": "Curved EFC/F-BAR-domain dimers are joined end to end into a filament for membrane invagination in endocytosis.", "journal": "Cell", "date": "2007", "authors": "Shimada A, Niwa H, Tsujita K, Suetsugu S, Nitta K, Hanawa-Suetsugu K, Akasaka R, Nishino Y, Toyama M, Chen L, Liu ZJ, Wang BC, Yamamoto M, Terada T, Miyazawa A, Tanaka A, Sugano S, Shirouzu M, Nagayama K, Takenawa T, Yokoyama S", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "17512409", "url": "https://glygen.org/publication/PubMed/17512409" } ] }, { "title": "Structure and analysis of FCHo2 F-BAR domain: a dimerizing and membrane recruitment module that effects membrane curvature.", "journal": "Structure (London, England : 1993)", "date": "2007", "authors": "Henne WM, Kent HM, Ford MG, Hegde BG, Daumke O, Butler PJ, Mittal R, Langen R, Evans PR, McMahon HT", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "17540576", "url": "https://glygen.org/publication/PubMed/17540576" } ] }, { "title": "Specificity, promiscuity and localization of ARF protein interactions with NCS-1 and phosphatidylinositol-4 kinase-III beta.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2007", "authors": "Haynes LP, Sherwood MW, Dolman NJ, Burgoyne RD", "evidence": [ { "database": "Reactome", "id": "R-HSA-1660514", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1660514" } ], "reference": [ { "type": "PubMed", "id": "17555535", "url": "https://glygen.org/publication/PubMed/17555535" } ] }, { "title": "Core protein machinery for mammalian phosphatidylinositol 3,5-bisphosphate synthesis and turnover that regulates the progression of endosomal transport. Novel Sac phosphatase joins the ArPIKfyve-PIKfyve complex.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Sbrissa D, Ikonomov OC, Fu Z, Ijuin T, Gruenberg J, Takenawa T, Shisheva A", "evidence": [ { "database": "Reactome", "id": "R-HSA-1660517", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1660517" } ], "reference": [ { "type": "PubMed", "id": "17556371", "url": "https://glygen.org/publication/PubMed/17556371" } ] }, { "title": "SNX9 couples actin assembly to phosphoinositide signals and is required for membrane remodeling during endocytosis.", "journal": "Developmental cell", "date": "2007", "authors": "Yarar D, Waterman-Storer CM, Schmid SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "17609109", "url": "https://glygen.org/publication/PubMed/17609109" } ] }, { "title": "Myotubularin lipid phosphatase binds the hVPS15/hVPS34 lipid kinase complex on endosomes.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2007", "authors": "Cao C, Laporte J, Backer JM, Wandinger-Ness A, Stein MP", "evidence": [ { "database": "Reactome", "id": "R-HSA-1660517", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1660517" } ], "reference": [ { "type": "PubMed", "id": "17651088", "url": "https://glygen.org/publication/PubMed/17651088" } ] }, { "title": "Sorting nexin 9 interacts with dynamin 1 and N-WASP and coordinates synaptic vesicle endocytosis.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Shin N, Lee S, Ahn N, Kim SA, Ahn SG, YongPark Z, Chang S", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "17681954", "url": "https://glygen.org/publication/PubMed/17681954" } ] }, { "title": "The NECAP PHear domain increases clathrin accessory protein binding potential.", "journal": "The EMBO journal", "date": "2007", "authors": "Ritter B, Denisov AY, Philie J, Allaire PD, Legendre-Guillemin V, Zylbergold P, Gehring K, McPherson PS", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "17762867", "url": "https://glygen.org/publication/PubMed/17762867" } ] }, { "title": "A role of the Lowe syndrome protein OCRL in early steps of the endocytic pathway.", "journal": "Developmental cell", "date": "2007", "authors": "Erdmann KS, Mao Y, McCrea HJ, Zoncu R, Lee S, Paradise S, Modregger J, Biemesderfer D, Toomre D, De Camilli P", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "17765681", "url": "https://glygen.org/publication/PubMed/17765681" } ] }, { "title": "A motif in the clathrin heavy chain required for the Hsc70/auxilin uncoating reaction.", "journal": "Molecular biology of the cell", "date": "2008", "authors": "Rapoport I, Boll W, Yu A, Bocking T, Kirchhausen T", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "17978091", "url": "https://glygen.org/publication/PubMed/17978091" } ] }, { "title": "The dual phosphatase activity of synaptojanin1 is required for both efficient synaptic vesicle endocytosis and reavailability at nerve terminals.", "journal": "Neuron", "date": "2007", "authors": "Mani M, Lee SY, Lucast L, Cremona O, Di Paolo G, De Camilli P, Ryan TA", "evidence": [ { "database": "Reactome", "id": "R-HSA-1660499", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1660499" } ], "reference": [ { "type": "PubMed", "id": "18093523", "url": "https://glygen.org/publication/PubMed/18093523" } ] }, { "title": "SNX9 regulates tubular invagination of the plasma membrane through interaction with actin cytoskeleton and dynamin 2.", "journal": "Journal of cell science", "date": "2008", "authors": "Shin N, Ahn N, Chang-Ileto B, Park J, Takei K, Ahn SG, Kim SA, Di Paolo G, Chang S", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "18388313", "url": "https://glygen.org/publication/PubMed/18388313" } ] }, { "title": "Interaction of phosphoinositide cycle intermediates with the plasma membrane-associated clathrin assembly protein AP-2.", "journal": "The Journal of biological chemistry", "date": "1991", "authors": "Beck KA, Keen JH", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "1847920", "url": "https://glygen.org/publication/PubMed/1847920" } ] }, { "title": "Sequential actions of myotubularin lipid phosphatases regulate endosomal PI(3)P and growth factor receptor trafficking.", "journal": "Molecular biology of the cell", "date": "2008", "authors": "Cao C, Backer JM, Laporte J, Bedrick EJ, Wandinger-Ness A", "evidence": [ { "database": "Reactome", "id": "R-HSA-1660517", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1660517" } ], "reference": [ { "type": "PubMed", "id": "18524850", "url": "https://glygen.org/publication/PubMed/18524850" } ] }, { "title": "A quantitative atlas of mitotic phosphorylation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2008", "authors": "Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP", "evidence": [ { "database": "UniProtKB", "id": "O00443", "url": "https://www.uniprot.org/uniprot/O00443" }, { "database": "iPTMnet", "id": "O00443-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O00443-1" } ], "reference": [ { "type": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" } ] }, { "title": "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.", "journal": "Molecular cell", "date": "2008", "authors": "Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M", "evidence": [ { "database": "UniProtKB", "id": "O00443", "url": "https://www.uniprot.org/uniprot/O00443" }, { "database": "iPTMnet", "id": "O00443-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O00443-1" } ], "reference": [ { "type": "PubMed", "id": "18691976", "url": "https://glygen.org/publication/PubMed/18691976" } ] }, { "title": "Localization of phosphatidylinositol phosphate kinase IIgamma in kidney to a membrane trafficking compartment within specialized cells of the nephron.", "journal": "American journal of physiology. Renal physiology", "date": "2008", "authors": "Clarke JH, Emson PC, Irvine RF", "evidence": [ { "database": "Reactome", "id": "R-HSA-1660499", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1660499" } ], "reference": [ { "type": "PubMed", "id": "18753295", "url": "https://glygen.org/publication/PubMed/18753295" } ] }, { "title": "Successive and selective release of phosphorylated peptides captured by hydroxy acid-modified metal oxide chromatography.", "journal": "Journal of proteome research", "date": "2008", "authors": "Kyono Y, Sugiyama N, Imami K, Tomita M, Ishihama Y", "evidence": [ { "database": "iPTMnet", "id": "O00443-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O00443-1" } ], "reference": [ { "type": "PubMed", "id": "18767875", "url": "https://glygen.org/publication/PubMed/18767875" } ] }, { "title": "Actin binding by Hip1 (huntingtin-interacting protein 1) and Hip1R (Hip1-related protein) is regulated by clathrin light chain.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Wilbur JD, Chen CY, Manalo V, Hwang PK, Fletterick RJ, Brodsky FM", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "18790740", "url": "https://glygen.org/publication/PubMed/18790740" } ] }, { "title": "ArPIKfyve homomeric and heteromeric interactions scaffold PIKfyve and Sac3 in a complex to promote PIKfyve activity and functionality.", "journal": "Journal of molecular biology", "date": "2008", "authors": "Sbrissa D, Ikonomov OC, Fenner H, Shisheva A", "evidence": [ { "database": "Reactome", "id": "R-HSA-1660514", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1660514" } ], "reference": [ { "type": "PubMed", "id": "18950639", "url": "https://glygen.org/publication/PubMed/18950639" } ] }, { "title": "Coordinated regulation of AP2 uncoating from clathrin-coated vesicles by rab5 and hRME-6.", "journal": "The Journal of cell biology", "date": "2008", "authors": "Semerdjieva S, Shortt B, Maxwell E, Singh S, Fonarev P, Hansen J, Schiavo G, Grant BD, Smythe E", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "18981233", "url": "https://glygen.org/publication/PubMed/18981233" } ] }, { "title": "Evaluation of the low-specificity protease elastase for large-scale phosphoproteome analysis.", "journal": "Analytical chemistry", "date": "2008", "authors": "Wang B, Malik R, Nigg EA, Korner R", "evidence": [ { "database": "iPTMnet", "id": "O00443-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O00443-1" } ], "reference": [ { "type": "PubMed", "id": "19007248", "url": "https://glygen.org/publication/PubMed/19007248" } ] }, { "title": "MTMR9 increases MTMR6 enzyme activity, stability, and role in apoptosis.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Zou J, Chang SC, Marjanovic J, Majerus PW", "evidence": [ { "database": "Reactome", "id": "R-HSA-1660499", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1660499" } ], "reference": [ { "type": "PubMed", "id": "19038970", "url": "https://glygen.org/publication/PubMed/19038970" } ] }, { "title": "SNX9 - a prelude to vesicle release.", "journal": "Journal of cell science", "date": "2009", "authors": "Lundmark R, Carlsson SR", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "19092055", "url": "https://glygen.org/publication/PubMed/19092055" } ] }, { "title": "Differential clathrin binding and subcellular localization of OCRL1 splice isoforms.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Choudhury R, Noakes CJ, McKenzie E, Kox C, Lowe M", "evidence": [ { "database": "Reactome", "id": "R-HSA-1660514", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1660514" } ], "reference": [ { "type": "PubMed", "id": "19211563", "url": "https://glygen.org/publication/PubMed/19211563" } ] }, { "title": "Clathrin regulates the association of PIPKIgamma661 with the AP-2 adaptor beta2 appendage.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Thieman JR, Mishra SK, Ling K, Doray B, Anderson RA, Traub LM", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "19287005", "url": "https://glygen.org/publication/PubMed/19287005" } ] }, { "title": "Cargo and dynamin regulate clathrin-coated pit maturation.", "journal": "PLoS biology", "date": "2009", "authors": "Loerke D, Mettlen M, Yarar D, Jaqaman K, Jaqaman H, Danuser G, Schmid SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "19296720", "url": "https://glygen.org/publication/PubMed/19296720" } ] }, { "title": "Large-scale proteomics analysis of the human kinome.", "journal": "Molecular & cellular proteomics : MCP", "date": "2009", "authors": "Oppermann FS, Gnad F, Olsen JV, Hornberger R, Greff Z, Keri G, Mann M, Daub H", "evidence": [ { "database": "UniProtKB", "id": "O00443", "url": "https://www.uniprot.org/uniprot/O00443" }, { "database": "iPTMnet", "id": "O00443", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O00443" } ], "reference": [ { "type": "PubMed", "id": "19369195", "url": "https://glygen.org/publication/PubMed/19369195" } ] }, { "title": "Endocytic accessory proteins are functionally distinguished by their differential effects on the maturation of clathrin-coated pits.", "journal": "Molecular biology of the cell", "date": "2009", "authors": "Mettlen M, Stoeber M, Loerke D, Antonescu CN, Danuser G, Schmid SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "19458185", "url": "https://glygen.org/publication/PubMed/19458185" } ] }, { "title": "A PH domain within OCRL bridges clathrin-mediated membrane trafficking to phosphoinositide metabolism.", "journal": "The EMBO journal", "date": "2009", "authors": "Mao Y, Balkin DM, Zoncu R, Erdmann KS, Tomasini L, Hu F, Jin MM, Hodsdon ME, De Camilli P", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "19536138", "url": "https://glygen.org/publication/PubMed/19536138" } ] }, { "title": "Molecular circuitry of endocytosis at nerve terminals.", "journal": "Annual review of cell and developmental biology", "date": "2009", "authors": "Dittman J, Ryan TA", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "19575674", "url": "https://glygen.org/publication/PubMed/19575674" } ] }, { "title": "Rab GTPases as coordinators of vesicle traffic.", "journal": "Nature reviews. Molecular cell biology", "date": "2009", "authors": "Stenmark H", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "19603039", "url": "https://glygen.org/publication/PubMed/19603039" } ] }, { "title": "Phosphoproteomic analysis of human embryonic stem cells.", "journal": "Cell stem cell", "date": "2009", "authors": "Brill LM, Xiong W, Lee KB, Ficarro SB, Crain A, Xu Y, Terskikh A, Snyder EY, Ding S", "evidence": [ { "database": "iPTMnet", "id": "O00443-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O00443-1" } ], "reference": [ { "type": "PubMed", "id": "19664994", "url": "https://glygen.org/publication/PubMed/19664994" } ] }, { "title": "Phosphorylation dynamics during early differentiation of human embryonic stem cells.", "journal": "Cell stem cell", "date": "2009", "authors": "Van Hoof D, Munoz J, Braam SR, Pinkse MW, Linding R, Heck AJ, Mummery CL, Krijgsveld J", "evidence": [ { "database": "iPTMnet", "id": "O00443-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O00443-1" } ], "reference": [ { "type": "PubMed", "id": "19664995", "url": "https://glygen.org/publication/PubMed/19664995" } ] }, { "title": "Mutations in INPP5E, encoding inositol polyphosphate-5-phosphatase E, link phosphatidyl inositol signaling to the ciliopathies.", "journal": "Nature genetics", "date": "2009", "authors": "Bielas SL, Silhavy JL, Brancati F, Kisseleva MV, Al-Gazali L, Sztriha L, Bayoumi RA, Zaki MS, Abdel-Aleem A, Rosti RO, Kayserili H, Swistun D, Scott LC, Bertini E, Boltshauser E, Fazzi E, Travaglini L, Field SJ, Gayral S, Jacoby M, Schurmans S, Dallapiccola B, Majerus PW, Valente EM, Gleeson JG", "evidence": [ { "database": "Reactome", "id": "R-HSA-1660514", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1660514" } ], "reference": [ { "type": "PubMed", "id": "19668216", "url": "https://glygen.org/publication/PubMed/19668216" } ] }, { "title": "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.", "journal": "Science signaling", "date": "2009", "authors": "Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK", "evidence": [ { "database": "UniProtKB", "id": "O00443", "url": "https://www.uniprot.org/uniprot/O00443" }, { "database": "iPTMnet", "id": "O00443", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O00443" } ], "reference": [ { "type": "PubMed", "id": "19690332", "url": "https://glygen.org/publication/PubMed/19690332" } ] }, { "title": "Quantitative analysis of the human spindle phosphoproteome at distinct mitotic stages.", "journal": "Journal of proteome research", "date": "2009", "authors": "Malik R, Lenobel R, Santamaria A, Ries A, Nigg EA, Korner R", "evidence": [ { "database": "iPTMnet", "id": "O00443-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O00443-1" } ], "reference": [ { "type": "PubMed", "id": "19691289", "url": "https://glygen.org/publication/PubMed/19691289" } ] }, { "title": "Tickets to ride: selecting cargo for clathrin-regulated internalization.", "journal": "Nature reviews. Molecular cell biology", "date": "2009", "authors": "Traub LM", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "19696796", "url": "https://glygen.org/publication/PubMed/19696796" } ] }, { "title": "Syp1 is a conserved endocytic adaptor that contains domains involved in cargo selection and membrane tubulation.", "journal": "The EMBO journal", "date": "2009", "authors": "Reider A, Barker SL, Mishra SK, Im YJ, Maldonado-Baez L, Hurley JH, Traub LM, Wendland B", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "19713939", "url": "https://glygen.org/publication/PubMed/19713939" } ] }, { "title": "Early-arriving Syp1p and Ede1p function in endocytic site placement and formation in budding yeast.", "journal": "Molecular biology of the cell", "date": "2009", "authors": "Stimpson HE, Toret CP, Cheng AT, Pauly BS, Drubin DG", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "19776351", "url": "https://glygen.org/publication/PubMed/19776351" } ] }, { "title": "Distinct dynamics of endocytic clathrin-coated pits and coated plaques.", "journal": "PLoS biology", "date": "2009", "authors": "Saffarian S, Cocucci E, Kirchhausen T", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "19809571", "url": "https://glygen.org/publication/PubMed/19809571" } ] }, { "title": "Localization, regulation and function of type II phosphatidylinositol 5-phosphate 4-kinases.", "journal": "Advances in enzyme regulation", "date": "2010", "authors": "Clarke JH, Wang M, Irvine RF", "evidence": [ { "database": "Reactome", "id": "R-HSA-1660499", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1660499" } ], "reference": [ { "type": "PubMed", "id": "19896968", "url": "https://glygen.org/publication/PubMed/19896968" } ] }, { "title": "Structure of clathrin coat with bound Hsc70 and auxilin: mechanism of Hsc70-facilitated disassembly.", "journal": "The EMBO journal", "date": "2010", "authors": "Xing Y, Bocking T, Wolf M, Grigorieff N, Kirchhausen T, Harrison SC", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "20033059", "url": "https://glygen.org/publication/PubMed/20033059" } ] }, { "title": "Coordinated actions of actin and BAR proteins upstream of dynamin at endocytic clathrin-coated pits.", "journal": "Developmental cell", "date": "2009", "authors": "Ferguson SM, Raimondi A, Paradise S, Shen H, Mesaki K, Ferguson A, Destaing O, Ko G, Takasaki J, Cremona O, O' Toole E, De Camilli P", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "20059951", "url": "https://glygen.org/publication/PubMed/20059951" } ] }, { "title": "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.", "journal": "Science signaling", "date": "2010", "authors": "Olsen JV, Vermeulen M, Santamaria A, Kumar C, Miller ML, Jensen LJ, Gnad F, Cox J, Jensen TS, Nigg EA, Brunak S, Mann M", "evidence": [ { "database": "UniProtKB", "id": "O00443", "url": "https://www.uniprot.org/uniprot/O00443" }, { "database": "iPTMnet", "id": "O00443-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O00443-1" } ], "reference": [ { "type": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ] }, { "title": "ArfGAP1 interacts with coat proteins through tryptophan-based motifs.", "journal": "Biochemical and biophysical research communications", "date": "2010", "authors": "Rawet M, Levi-Tal S, Szafer-Glusman E, Parnis A, Cassel D", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "20211604", "url": "https://glygen.org/publication/PubMed/20211604" } ] }, { "title": "Cargo- and adaptor-specific mechanisms regulate clathrin-mediated endocytosis.", "journal": "The Journal of cell biology", "date": "2010", "authors": "Mettlen M, Loerke D, Yarar D, Danuser G, Schmid SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "20231386", "url": "https://glygen.org/publication/PubMed/20231386" } ] }, { "title": "G domain dimerization controls dynamin's assembly-stimulated GTPase activity.", "journal": "Nature", "date": "2010", "authors": "Chappie JS, Acharya S, Leonard M, Schmid SL, Dyda F", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "20428113", "url": "https://glygen.org/publication/PubMed/20428113" } ] }, { "title": "FCHo proteins are nucleators of clathrin-mediated endocytosis.", "journal": "Science (New York, N.Y.)", "date": "2010", "authors": "Henne WM, Boucrot E, Meinecke M, Evergren E, Vallis Y, Mittal R, McMahon HT", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "20448150", "url": "https://glygen.org/publication/PubMed/20448150" } ] }, { "title": "Structure of the PTEN-like region of auxilin, a detector of clathrin-coated vesicle budding.", "journal": "Structure (London, England : 1993)", "date": "2010", "authors": "Guan R, Dai H, Harrison SC, Kirchhausen T", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "20826345", "url": "https://glygen.org/publication/PubMed/20826345" } ] }, { "title": "Intersectin 1 forms complexes with SGIP1 and Reps1 in clathrin-coated pits.", "journal": "Biochemical and biophysical research communications", "date": "2010", "authors": "Dergai O, Novokhatska O, Dergai M, Skrypkina I, Tsyba L, Moreau J, Rynditch A", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "20946875", "url": "https://glygen.org/publication/PubMed/20946875" } ] }, { "title": "PI3KC2alpha, a class II PI3K, is required for dynamin-independent internalization pathways.", "journal": "Journal of cell science", "date": "2010", "authors": "Krag C, Malmberg EK, Salcini AE", "evidence": [ { "database": "UniProtKB", "id": "O00443", "url": "https://www.uniprot.org/uniprot/O00443" }, { "database": "Reactome", "id": "R-HSA-1660516", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1660516" } ], "reference": [ { "type": "PubMed", "id": "21081650", "url": "https://glygen.org/publication/PubMed/21081650" } ] }, { "title": "Class II phosphoinositide 3-kinase regulates exocytosis of insulin granules in pancreatic beta cells.", "journal": "J. Biol. Chem.", "date": "2011", "authors": "Dominguez Veronica, Raimondi Claudio, Somanath Sangeeta, Bugliani Marco, Loder Merewyn K, Edling Charlotte E, Divecha Nullin, da Silva-Xavier Gabriela, Marselli Lorella, Persaud Shanta J, Turner Mark D, Rutter Guy A, Marchetti Piero, Falasca Marco, Maffucci Tania", "evidence": [ { "database": "UniProtKB", "id": "O00443", "url": "https://www.uniprot.org/uniprot/O00443" } ], "reference": [ { "type": "PubMed", "id": "21127054", "url": "https://glygen.org/publication/PubMed/21127054" } ] }, { "title": "Localization of low molecular weight GTP binding proteins to exocytic and endocytic compartments.", "journal": "Cell", "date": "1990", "authors": "Chavrier P, Parton RG, Hauri HP, Simons K, Zerial M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "2115402", "url": "https://glygen.org/publication/PubMed/2115402" } ] }, { "title": "Local clustering of transferrin receptors promotes clathrin-coated pit initiation.", "journal": "The Journal of cell biology", "date": "2010", "authors": "Liu AP, Aguet F, Danuser G, Schmid SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "21187331", "url": "https://glygen.org/publication/PubMed/21187331" } ] }, { "title": "Role of TAPP1 and TAPP2 adaptor binding to PtdIns(3,4)P2 in regulating insulin sensitivity defined by knock-in analysis.", "journal": "The Biochemical journal", "date": "2011", "authors": "Wullschleger S, Wasserman DH, Gray A, Sakamoto K, Alessi DR", "evidence": [ { "database": "Reactome", "id": "R-HSA-1660499", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1660499" } ], "reference": [ { "type": "PubMed", "id": "21204784", "url": "https://glygen.org/publication/PubMed/21204784" } ] }, { "title": "Single-molecule analysis of a molecular disassemblase reveals the mechanism of Hsc70-driven clathrin uncoating.", "journal": "Nature structural & molecular biology", "date": "2011", "authors": "Bocking T, Aguet F, Harrison SC, Kirchhausen T", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "21278753", "url": "https://glygen.org/publication/PubMed/21278753" } ] }, { "title": "Synaptojanin 1-mediated PI(4,5)P2 hydrolysis is modulated by membrane curvature and facilitates membrane fission.", "journal": "Developmental cell", "date": "2011", "authors": "Chang-Ileto B, Frere SG, Chan RB, Voronov SV, Roux A, Di Paolo G", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "21316588", "url": "https://glygen.org/publication/PubMed/21316588" } ] }, { "title": "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.", "journal": "Science signaling", "date": "2011", "authors": "Rigbolt KT, Prokhorova TA, Akimov V, Henningsen J, Johansen PT, Kratchmarova I, Kassem M, Mann M, Olsen JV, Blagoev B", "evidence": [ { "database": "UniProtKB", "id": "O00443", "url": "https://www.uniprot.org/uniprot/O00443" }, { "database": "iPTMnet", "id": "O00443", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O00443" } ], "reference": [ { "type": "PubMed", "id": "21406692", "url": "https://glygen.org/publication/PubMed/21406692" } ] }, { "title": "A high precision survey of the molecular dynamics of mammalian clathrin-mediated endocytosis.", "journal": "PLoS biology", "date": "2011", "authors": "Taylor MJ, Perrais D, Merrifield CJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "21445324", "url": "https://glygen.org/publication/PubMed/21445324" } ] }, { "title": "A sequential mechanism for clathrin cage disassembly by 70-kDa heat-shock cognate protein (Hsc70) and auxilin.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2011", "authors": "Rothnie A, Clarke AR, Kuzmic P, Cameron A, Smith CJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "21482805", "url": "https://glygen.org/publication/PubMed/21482805" } ] }, { "title": "ARFGAP1 promotes AP-2-dependent endocytosis.", "journal": "Nature cell biology", "date": "2011", "authors": "Bai M, Gad H, Turacchio G, Cocucci E, Yang JS, Li J, Beznoussenko GV, Nie Z, Luo R, Fu L, Collawn JF, Kirchhausen T, Luini A, Hsu VW", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "21499258", "url": "https://glygen.org/publication/PubMed/21499258" } ] }, { "title": "Phosphatidylinositol-(4,5)-bisphosphate regulates clathrin-coated pit initiation, stabilization, and size.", "journal": "Molecular biology of the cell", "date": "2011", "authors": "Antonescu CN, Aguet F, Danuser G, Schmid SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "21613550", "url": "https://glygen.org/publication/PubMed/21613550" } ] }, { "title": "Molecular mechanism and physiological functions of clathrin-mediated endocytosis.", "journal": "Nature reviews. Molecular cell biology", "date": "2011", "authors": "McMahon HT, Boucrot E", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "21779028", "url": "https://glygen.org/publication/PubMed/21779028" } ] }, { "title": "Actin dynamics counteract membrane tension during clathrin-mediated endocytosis.", "journal": "Nature cell biology", "date": "2011", "authors": "Boulant S, Kural C, Zeeh JC, Ubelmann F, Kirchhausen T", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "21841790", "url": "https://glygen.org/publication/PubMed/21841790" } ] }, { "title": "Hotspots organize clathrin-mediated endocytosis by efficient recruitment and retention of nucleating resources.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2011", "authors": "Nunez D, Antonescu C, Mettlen M, Liu A, Schmid SL, Loerke D, Danuser G", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "21883765", "url": "https://glygen.org/publication/PubMed/21883765" } ] }, { "title": "Crystal structure of nucleotide-free dynamin.", "journal": "Nature", "date": "2011", "authors": "Faelber K, Posor Y, Gao S, Held M, Roske Y, Schulze D, Haucke V, Noe F, Daumke O", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "21927000", "url": "https://glygen.org/publication/PubMed/21927000" } ] }, { "title": "The crystal structure of dynamin.", "journal": "Nature", "date": "2011", "authors": "Ford MG, Jenni S, Nunnari J", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "21927001", "url": "https://glygen.org/publication/PubMed/21927001" } ] }, { "title": "A pseudoatomic model of the dynamin polymer identifies a hydrolysis-dependent powerstroke.", "journal": "Cell", "date": "2011", "authors": "Chappie JS, Mears JA, Fang S, Leonard M, Schmid SL, Milligan RA, Hinshaw JE, Dyda F", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "21962517", "url": "https://glygen.org/publication/PubMed/21962517" } ] }, { "title": "Identification and characterization of splicing variants of PLEKHA5 (Plekha5) during brain development.", "journal": "Gene", "date": "2012", "authors": "Yamada K, Nomura N, Yamano A, Yamada Y, Wakamatsu N", "evidence": [ { "database": "Reactome", "id": "R-HSA-1660499", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1660499" } ], "reference": [ { "type": "PubMed", "id": "22037487", "url": "https://glygen.org/publication/PubMed/22037487" } ] }, { "title": "Recruitment of endophilin to clathrin-coated pit necks is required for efficient vesicle uncoating after fission.", "journal": "Neuron", "date": "2011", "authors": "Milosevic I, Giovedi S, Lou X, Raimondi A, Collesi C, Shen H, Paradise S, O'Toole E, Ferguson S, Cremona O, De Camilli P", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "22099461", "url": "https://glygen.org/publication/PubMed/22099461" } ] }, { "title": "Dynamin, a membrane-remodelling GTPase.", "journal": "Nature reviews. Molecular cell biology", "date": "2012", "authors": "Ferguson SM, De Camilli P", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "22233676", "url": "https://glygen.org/publication/PubMed/22233676" } ] }, { "title": "Distinct and separable activities of the endocytic clathrin-coat components Fcho1/2 and AP-2 in developmental patterning.", "journal": "Nature cell biology", "date": "2012", "authors": "Umasankar PK, Sanker S, Thieman JR, Chakraborty S, Wendland B, Tsang M, Traub LM", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "22484487", "url": "https://glygen.org/publication/PubMed/22484487" } ] }, { "title": "A feedback loop between dynamin and actin recruitment during clathrin-mediated endocytosis.", "journal": "PLoS biology", "date": "2012", "authors": "Taylor MJ, Lampe M, Merrifield CJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "22505844", "url": "https://glygen.org/publication/PubMed/22505844" } ] }, { "title": "Myotubularin-related protein (MTMR) 9 determines the enzymatic activity, substrate specificity, and role in autophagy of MTMR8.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2012", "authors": "Zou J, Zhang C, Marjanovic J, Kisseleva MV, Majerus PW, Wilson MP", "evidence": [ { "database": "Reactome", "id": "R-HSA-1660499", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1660499" } ], "reference": [ { "type": "PubMed", "id": "22647598", "url": "https://glygen.org/publication/PubMed/22647598" } ] }, { "title": "BRAG2/GEP100/IQSec1 interacts with clathrin and regulates alpha5beta1 integrin endocytosis through activation of ADP ribosylation factor 5 (Arf5).", "journal": "The Journal of biological chemistry", "date": "2012", "authors": "Moravec R, Conger KK, D'Souza R, Allison AB, Casanova JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "22815487", "url": "https://glygen.org/publication/PubMed/22815487" } ] }, { "title": "The first five seconds in the life of a clathrin-coated pit.", "journal": "Cell", "date": "2012", "authors": "Cocucci E, Aguet F, Boulant S, Kirchhausen T", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "22863004", "url": "https://glygen.org/publication/PubMed/22863004" } ] }, { "title": "Toward a comprehensive characterization of a human cancer cell phosphoproteome.", "journal": "Journal of proteome research", "date": "2013", "authors": "Zhou H, Di Palma S, Preisinger C, Peng M, Polat AN, Heck AJ, Mohammed S", "evidence": [ { "database": "UniProtKB", "id": "O00443", "url": "https://www.uniprot.org/uniprot/O00443" }, { "database": "iPTMnet", "id": "O00443", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O00443" } ], "reference": [ { "type": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" } ] }, { "title": "Cooperative recruitment of dynamin and BIN/amphiphysin/Rvs (BAR) domain-containing proteins leads to GTP-dependent membrane scission.", "journal": "The Journal of biological chemistry", "date": "2013", "authors": "Meinecke M, Boucrot E, Camdere G, Hon WC, Mittal R, McMahon HT", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "23297414", "url": "https://glygen.org/publication/PubMed/23297414" } ] }, { "title": "RUFY, Rab and Rap Family Proteins Involved in a Regulation of Cell Polarity and Membrane Trafficking.", "journal": "International journal of molecular sciences", "date": "2013", "authors": "Kitagishi Y, Matsuda S", "evidence": [ { "database": "Reactome", "id": "R-HSA-1660499", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1660499" } ], "reference": [ { "type": "PubMed", "id": "23519112", "url": "https://glygen.org/publication/PubMed/23519112" } ] }, { "title": "Divergent modes for cargo-mediated control of clathrin-coated pit dynamics.", "journal": "Molecular biology of the cell", "date": "2013", "authors": "Soohoo AL, Puthenveedu MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "23536704", "url": "https://glygen.org/publication/PubMed/23536704" } ] }, { "title": "Evolutionarily conserved structural changes in phosphatidylinositol 5-phosphate 4-kinase (PI5P4K) isoforms are responsible for differences in enzyme activity and localization.", "journal": "The Biochemical journal", "date": "2013", "authors": "Clarke JH, Irvine RF", "evidence": [ { "database": "Reactome", "id": "R-HSA-1660499", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1660499" } ], "reference": [ { "type": "PubMed", "id": "23758345", "url": "https://glygen.org/publication/PubMed/23758345" } ] }, { "title": "Loss of catalytically inactive lipid phosphatase myotubularin-related protein 12 impairs myotubularin stability and promotes centronuclear myopathy in zebrafish.", "journal": "PLoS genetics", "date": "2013", "authors": "Gupta VA, Hnia K, Smith LL, Gundry SR, McIntire JE, Shimazu J, Bass JR, Talbot EA, Amoasii L, Goldman NE, Laporte J, Beggs AH", "evidence": [ { "database": "Reactome", "id": "R-HSA-1660516", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1660516" } ], "reference": [ { "type": "PubMed", "id": "23818870", "url": "https://glygen.org/publication/PubMed/23818870" } ] }, { "title": "Spatiotemporal control of endocytosis by phosphatidylinositol-3,4-bisphosphate.", "journal": "Nature", "date": "2013", "authors": "Posor Y, Eichhorn-Gruenig M, Puchkov D, Schoneberg J, Ullrich A, Lampe A, Muller R, Zarbakhsh S, Gulluni F, Hirsch E, Krauss M, Schultz C, Schmoranzer J, Noe F, Haucke V", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "23823722", "url": "https://glygen.org/publication/PubMed/23823722" } ] }, { "title": "Dual role of BAR domain-containing proteins in regulating vesicle release catalyzed by the GTPase, dynamin-2.", "journal": "The Journal of biological chemistry", "date": "2013", "authors": "Neumann S, Schmid SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "23861397", "url": "https://glygen.org/publication/PubMed/23861397" } ] }, { "title": "Advances in analysis of low signal-to-noise images link dynamin and AP2 to the functions of an endocytic checkpoint.", "journal": "Developmental cell", "date": "2013", "authors": "Aguet F, Antonescu CN, Mettlen M, Schmid SL, Danuser G", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "23891661", "url": "https://glygen.org/publication/PubMed/23891661" } ] }, { "title": "NECAP 1 regulates AP-2 interactions to control vesicle size, number, and cargo during clathrin-mediated endocytosis.", "journal": "PLoS biology", "date": "2013", "authors": "Ritter B, Murphy S, Dokainish H, Girard M, Gudheti MV, Kozlov G, Halin M, Philie J, Jorgensen EM, Gehring K, McPherson PS", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "24130457", "url": "https://glygen.org/publication/PubMed/24130457" } ] }, { "title": "Cargo recognition in clathrin-mediated endocytosis.", "journal": "Cold Spring Harbor perspectives in biology", "date": "2013", "authors": "Traub LM, Bonifacino JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "24186068", "url": "https://glygen.org/publication/PubMed/24186068" } ] }, { "title": "An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.", "journal": "Journal of proteomics", "date": "2014", "authors": "Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H", "evidence": [ { "database": "UniProtKB", "id": "O00443", "url": "https://www.uniprot.org/uniprot/O00443" }, { "database": "iPTMnet", "id": "O00443", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O00443" } ], "reference": [ { "type": "PubMed", "id": "24275569", "url": "https://glygen.org/publication/PubMed/24275569" } ] }, { "title": "BAR domain scaffolds in dynamin-mediated membrane fission.", "journal": "Cell", "date": "2014", "authors": "Daumke O, Roux A, Haucke V", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "24581490", "url": "https://glygen.org/publication/PubMed/24581490" } ] }, { "title": "Molecular structure, function, and dynamics of clathrin-mediated membrane traffic.", "journal": "Cold Spring Harbor perspectives in biology", "date": "2014", "authors": "Kirchhausen T, Owen D, Harrison SC", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "24789820", "url": "https://glygen.org/publication/PubMed/24789820" } ] }, { "title": "Inositol lipid phosphatases in membrane trafficking and human disease.", "journal": "The Biochemical journal", "date": "2014", "authors": "Billcliff PG, Lowe M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "24966051", "url": "https://glygen.org/publication/PubMed/24966051" } ] }, { "title": "A role of OCRL in clathrin-coated pit dynamics and uncoating revealed by studies of Lowe syndrome cells.", "journal": "eLife", "date": "2014", "authors": "Nandez R, Balkin DM, Messa M, Liang L, Paradise S, Czapla H, Hein MY, Duncan JS, Mann M, De Camilli P", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "25107275", "url": "https://glygen.org/publication/PubMed/25107275" } ] }, { "title": "The membrane-associated proteins FCHo and SGIP are allosteric activators of the AP2 clathrin adaptor complex.", "journal": "eLife", "date": "2014", "authors": "Hollopeter G, Lange JJ, Zhang Y, Vu TN, Gu M, Ailion M, Lambie EJ, Slaughter BD, Unruh JR, Florens L, Jorgensen EM", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "25303366", "url": "https://glygen.org/publication/PubMed/25303366" } ] }, { "title": "Rab proteins and the compartmentalization of the endosomal system.", "journal": "Cold Spring Harbor perspectives in biology", "date": "2014", "authors": "Wandinger-Ness A, Zerial M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "25341920", "url": "https://glygen.org/publication/PubMed/25341920" } ] }, { "title": "The function of phosphatidylinositol 5-phosphate 4-kinase gamma (PI5P4Kgamma) explored using a specific inhibitor that targets the PI5P-binding site.", "journal": "The Biochemical journal", "date": "2015", "authors": "Clarke JH, Giudici ML, Burke JE, Williams RL, Maloney DJ, Marugan J, Irvine RF", "evidence": [ { "database": "Reactome", "id": "R-HSA-1660499", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1660499" } ], "reference": [ { "type": "PubMed", "id": "25495341", "url": "https://glygen.org/publication/PubMed/25495341" } ] }, { "title": "Sac2/INPP5F is an inositol 4-phosphatase that functions in the endocytic pathway.", "journal": "The Journal of cell biology", "date": "2015", "authors": "Nakatsu F, Messa M, Nandez R, Czapla H, Zou Y, Strittmatter SM, De Camilli P", "evidence": [ { "database": "Reactome", "id": "R-HSA-1660516", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1660516" } ], "reference": [ { "type": "PubMed", "id": "25869668", "url": "https://glygen.org/publication/PubMed/25869668" } ] }, { "title": "The role of molecular chaperones in clathrin mediated vesicular trafficking.", "journal": "Frontiers in molecular biosciences", "date": "2015", "authors": "Sousa R, Lafer EM", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "26042225", "url": "https://glygen.org/publication/PubMed/26042225" } ] }, { "title": "Forty Years of Clathrin-coated Vesicles.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2015", "authors": "Robinson MS", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "26403691", "url": "https://glygen.org/publication/PubMed/26403691" } ] }, { "title": "A human interactome in three quantitative dimensions organized by stoichiometries and abundances.", "journal": "Cell", "date": "2015", "authors": "Hein MY, Hubner NC, Poser I, Cox J, Nagaraj N, Toyoda Y, Gak IA, Weisswange I, Mansfeld J, Buchholz F, Hyman AA, Mann M", "evidence": [ { "database": "Reactome", "id": "R-HSA-1660516", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1660516" } ], "reference": [ { "type": "PubMed", "id": "26496610", "url": "https://glygen.org/publication/PubMed/26496610" } ] }, { "title": "Quantitative proteomics identifies altered O-GlcNAcylation of structural, synaptic and memory-associated proteins in Alzheimer's disease.", "journal": "The Journal of pathology", "date": "2017", "authors": "Wang S, Yang F, Petyuk VA, Shukla AK, Monroe ME, Gritsenko MA, Rodland KD, Smith RD, Qian WJ, Gong CX, Liu T", "evidence": [ { "database": "O-GlcNAc Database", "id": "O00443", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O00443" }, { "database": "O-GlcNAc Atlas", "id": "O00443", "url": "https://oglcnac.org/atlas/detail/O00443" } ], "reference": [ { "type": "PubMed", "id": "28657654", "url": "https://glygen.org/publication/PubMed/28657654" } ] }, { "title": "Mapping and Quantification of Over 2000 O-linked Glycopeptides in Activated Human T Cells with Isotope-Targeted Glycoproteomics (Isotag).", "journal": "Molecular & cellular proteomics : MCP", "date": "2018", "authors": "Woo CM, Lund PJ, Huang AC, Davis MM, Bertozzi CR, Pitteri SJ", "evidence": [ { "database": "O-GlcNAc Database", "id": "O00443", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O00443" }, { "database": "O-GlcNAc Atlas", "id": "O00443", "url": "https://oglcnac.org/atlas/detail/O00443" } ], "reference": [ { "type": "PubMed", "id": "29351928", "url": "https://glygen.org/publication/PubMed/29351928" } ] }, { "title": "A triarylphosphine-trimethylpiperidine reagent for the one-step derivatization and enrichment of protein post-translational modifications and identification by mass spectrometry.", "journal": "Chemical communications (Cambridge, England)", "date": "2018", "authors": "Huo B, Zhang W, Zhao X, Dong H, Yu Y, Wang J, Qian X, Qin W", "evidence": [ { "database": "O-GlcNAc Database", "id": "O00443", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O00443" }, { "database": "O-GlcNAc Atlas", "id": "O00443", "url": "https://oglcnac.org/atlas/detail/O00443" } ], "reference": [ { "type": "PubMed", "id": "30379171", "url": "https://glygen.org/publication/PubMed/30379171" } ] }, { "title": "Mutations in PIK3C2A cause syndromic short stature, skeletal abnormalities, and cataracts associated with ciliary dysfunction.", "journal": "PLoS genetics", "date": "2019", "authors": "Tiosano D, Baris HN, Chen A, Hitzert MM, Schueler M, Gulluni F, Wiesener A, Bergua A, Mory A, Copeland B, Gleeson JG, Rump P, van Meer H, Sival DA, Haucke V, Kriwinsky J, Knaup KX, Reis A, Hauer NN, Hirsch E, Roepman R, Pfundt R, Thiel CT, Wiesener MS, Aslanyan MG, Buchner DA", "evidence": [ { "database": "UniProtKB", "id": "O00443", "url": "https://www.uniprot.org/uniprot/O00443" } ], "reference": [ { "type": "PubMed", "id": "31034465", "url": "https://glygen.org/publication/PubMed/31034465" } ] }, { "title": "Next-generation unnatural monosaccharides reveal that ESRRB O-GlcNAcylation regulates pluripotency of mouse embryonic stem cells.", "journal": "Nature communications", "date": "2019", "authors": "Hao Y, Fan X, Shi Y, Zhang C, Sun DE, Qin K, Qin W, Zhou W, Chen X", "evidence": [ { "database": "O-GlcNAc Database", "id": "O00443", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O00443" } ], "reference": [ { "type": "PubMed", "id": "31492838", "url": "https://glygen.org/publication/PubMed/31492838" } ] }, { "title": "TGFbeta receptor endocytosis and Smad signaling require synaptojanin1, PI3K-C2alpha-, and INPP4B-mediated phosphoinositide conversions.", "journal": "Molecular biology of the cell", "date": "2020", "authors": "Aki S, Yoshioka K, Takuwa N, Takuwa Y", "evidence": [ { "database": "RefSeq", "id": "NP_001308307", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001308307" } ], "reference": [ { "type": "PubMed", "id": "31913757", "url": "https://glygen.org/publication/PubMed/31913757" } ] }, { "title": "The molecular mechanisms mediating class II PI 3-kinase function in cell physiology.", "journal": "The FEBS journal", "date": "2021", "authors": "Koch PA, Dornan GL, Hessenberger M, Haucke V", "evidence": [ { "database": "RefSeq", "id": "NP_001308307", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001308307" } ], "reference": [ { "type": "PubMed", "id": "33387369", "url": "https://glygen.org/publication/PubMed/33387369" } ] }, { "title": "Class II phosphatidylinositol 3-kinase-C2alpha is essential for Notch signaling by regulating the endocytosis of gamma-secretase in endothelial cells.", "journal": "Scientific reports", "date": "2021", "authors": "Shimizu S, Yoshioka K, Aki S, Takuwa Y", "evidence": [ { "database": "RefSeq", "id": "NP_001308307", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001308307" } ], "reference": [ { "type": "PubMed", "id": "33664344", "url": "https://glygen.org/publication/PubMed/33664344" } ] }, { "title": "PI(3,4)P2-mediated cytokinetic abscission prevents early senescence and cataract formation.", "journal": "Science (New York, N.Y.)", "date": "2021", "authors": "Gulluni F, Prever L, Li H, Krafcikova P, Corrado I, Lo WT, Margaria JP, Chen A, De Santis MC, Cnudde SJ, Fogerty J, Yuan A, Massarotti A, Sarijalo NT, Vadas O, Williams RL, Thelen M, Powell DR, Schueler M, Wiesener MS, Balla T, Baris HN, Tiosano D, McDermott BM Jr, Perkins BD, Ghigo A, Martini M, Haucke V, Boura E, Merlo GR, Buchner DA, Hirsch E", "evidence": [ { "database": "RefSeq", "id": "NP_001308307", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001308307" } ], "reference": [ { "type": "PubMed", "id": "34882480", "url": "https://glygen.org/publication/PubMed/34882480" } ] }, { "title": "Various Expressions of PIK3C2A and TXNIP Genes and Their Potential Role as Independent Risk Factors for Chronic Stable Angina and Acute Coronary Syndrome.", "journal": "Biomolecules", "date": "2023-02-06", "authors": "Soliman Shimaa E, Abouelenin Mai A H, Samy Neven I, Omar Marwa M, Alrefai Abeer A", "evidence": [ { "database": "RefSeq", "id": "NP_001308307", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001308307" } ], "reference": [ { "type": "PubMed", "id": "36830671", "url": "https://glygen.org/publication/PubMed/36830671" } ] }, { "title": "An enzyme that removes clathrin coats: purification of an uncoating ATPase.", "journal": "The Journal of cell biology", "date": "1984", "authors": "Schlossman DM, Schmid SL, Braell WA, Rothman JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "6146630", "url": "https://glygen.org/publication/PubMed/6146630" } ] }, { "title": "The isolation and characterization of cDNA encoding human and rat brain inositol polyphosphate 4-phosphatase.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Norris FA, Auethavekiat V, Majerus PW", "evidence": [ { "database": "Reactome", "id": "R-HSA-1660516", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1660516" } ], "reference": [ { "type": "PubMed", "id": "7608176", "url": "https://glygen.org/publication/PubMed/7608176" } ] }, { "title": "Cloning and characterization of a G protein-activated human phosphoinositide-3 kinase.", "journal": "Science (New York, N.Y.)", "date": "1995", "authors": "Stoyanov B, Volinia S, Hanck T, Rubio I, Loubtchenkov M, Malek D, Stoyanova S, Vanhaesebroeck B, Dhand R, Nurnberg B, et al.", "evidence": [ { "database": "Reactome", "id": "R-HSA-1660499", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1660499" } ], "reference": [ { "type": "PubMed", "id": "7624799", "url": "https://glygen.org/publication/PubMed/7624799" } ] }, { "title": "A human phosphatidylinositol 3-kinase complex related to the yeast Vps34p-Vps15p protein sorting system.", "journal": "The EMBO journal", "date": "1995", "authors": "Volinia S, Dhand R, Vanhaesebroeck B, MacDougall LK, Stein R, Zvelebil MJ, Domin J, Panaretou C, Waterfield MD", "evidence": [ { "database": "Reactome", "id": "R-HSA-1660516", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1660516" } ], "reference": [ { "type": "PubMed", "id": "7628435", "url": "https://glygen.org/publication/PubMed/7628435" } ] }, { "title": "The protein deficient in Lowe syndrome is a phosphatidylinositol-4,5-bisphosphate 5-phosphatase.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1995", "authors": "Zhang X, Jefferson AB, Auethavekiat V, Majerus PW", "evidence": [ { "database": "Reactome", "id": "R-HSA-1660514", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1660514" } ], "reference": [ { "type": "PubMed", "id": "7761412", "url": "https://glygen.org/publication/PubMed/7761412" } ] }, { "title": "Dynamin self-assembles into rings suggesting a mechanism for coated vesicle budding.", "journal": "Nature", "date": "1995", "authors": "Hinshaw JE, Schmid SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "7877694", "url": "https://glygen.org/publication/PubMed/7877694" } ] }, { "title": "Alteration of clathrin light chain expression by transfection and gene disruption.", "journal": "Molecular biology of the cell", "date": "1993", "authors": "Acton SL, Wong DH, Parham P, Brodsky FM, Jackson AP", "evidence": [ { "database": "Reactome", "id": "R-HSA-432722", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-432722" } ], "reference": [ { "type": "PubMed", "id": "8374173", "url": "https://glygen.org/publication/PubMed/8374173" } ] }, { "title": "Role of auxilin in uncoating clathrin-coated vesicles.", "journal": "Nature", "date": "1995", "authors": "Ungewickell E, Ungewickell H, Holstein SE, Lindner R, Prasad K, Barouch W, Martin B, Greene LE, Eisenberg E", "evidence": [ { "database": "Reactome", "id": "R-HSA-432722", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-432722" } ], "reference": [ { "type": "PubMed", "id": "8524399", "url": "https://glygen.org/publication/PubMed/8524399" } ] }, { "title": "A role of amphiphysin in synaptic vesicle endocytosis suggested by its binding to dynamin in nerve terminals.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1996", "authors": "David C, McPherson PS, Mundigl O, de Camilli P", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "8552632", "url": "https://glygen.org/publication/PubMed/8552632" } ] }, { "title": "Lowe syndrome, a deficiency of phosphatidylinositol 4,5-bisphosphate 5-phosphatase in the Golgi apparatus.", "journal": "Human molecular genetics", "date": "1995", "authors": "Suchy SF, Olivos-Glander IM, Nussabaum RL", "evidence": [ { "database": "Reactome", "id": "R-HSA-1660514", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1660514" } ], "reference": [ { "type": "PubMed", "id": "8634694", "url": "https://glygen.org/publication/PubMed/8634694" } ] }, { "title": "Dynamin II binds to the trans-Golgi network.", "journal": "Biochemical and biophysical research communications", "date": "1996", "authors": "Maier O, Knoblich M, Westermann P", "evidence": [ { "database": "Reactome", "id": "R-HSA-432722", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-432722" } ], "reference": [ { "type": "PubMed", "id": "8670264", "url": "https://glygen.org/publication/PubMed/8670264" } ] }, { "title": "Purification and characterization of the phosphatidylinositol-3,4,5-trisphosphate phosphatase in bovine thymus.", "journal": "European journal of biochemistry", "date": "1996", "authors": "Kabuyama Y, Nakatsu N, Homma Y, Fukui Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-1660499", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1660499" } ], "reference": [ { "type": "PubMed", "id": "8681945", "url": "https://glygen.org/publication/PubMed/8681945" } ] }, { "title": "Multiple forms of an inositol polyphosphate 5-phosphatase form signaling complexes with Shc and Grb2.", "journal": "Current biology : CB", "date": "1996", "authors": "Kavanaugh WM, Pot DA, Chin SM, Deuter-Reinhard M, Jefferson AB, Norris FA, Masiarz FR, Cousens LS, Majerus PW, Williams LT", "evidence": [ { "database": "Reactome", "id": "R-HSA-1660499", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1660499" } ], "reference": [ { "type": "PubMed", "id": "8723348", "url": "https://glygen.org/publication/PubMed/8723348" } ] }, { "title": "Cloning and expression of a human placenta inositol 1,3,4,5-tetrakisphosphate and phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase.", "journal": "Biochemical and biophysical research communications", "date": "1996", "authors": "Drayer AL, Pesesse X, De Smedt F, Woscholski R, Parker P, Erneux C", "evidence": [ { "database": "Reactome", "id": "R-HSA-1660499", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1660499" } ], "reference": [ { "type": "PubMed", "id": "8769125", "url": "https://glygen.org/publication/PubMed/8769125" } ] }, { "title": "Characterization of p150, an adaptor protein for the human phosphatidylinositol (PtdIns) 3-kinase. Substrate presentation by phosphatidylinositol transfer protein to the p150.Ptdins 3-kinase complex.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Panaretou C, Domin J, Cockcroft S, Waterfield MD", "evidence": [ { "database": "Reactome", "id": "R-HSA-1660516", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1660516" } ], "reference": [ { "type": "PubMed", "id": "8999962", "url": "https://glygen.org/publication/PubMed/8999962" } ] }, { "title": "Synaptic vesicle endocytosis impaired by disruption of dynamin-SH3 domain interactions.", "journal": "Science (New York, N.Y.)", "date": "1997", "authors": "Shupliakov O, Low P, Grabs D, Gad H, Chen H, David C, Takei K, De Camilli P, Brodin L", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "9092476", "url": "https://glygen.org/publication/PubMed/9092476" } ] }, { "title": "The G beta gamma sensitivity of a PI3K is dependent upon a tightly associated adaptor, p101.", "journal": "Cell", "date": "1997", "authors": "Stephens LR, Eguinoa A, Erdjument-Bromage H, Lui M, Cooke F, Coadwell J, Smrcka AS, Thelen M, Cadwallader K, Tempst P, Hawkins PT", "evidence": [ { "database": "Reactome", "id": "R-HSA-1660499", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1660499" } ], "reference": [ { "type": "PubMed", "id": "9094719", "url": "https://glygen.org/publication/PubMed/9094719" } ] }, { "title": "Auxilin-induced interaction of the molecular chaperone Hsc70 with clathrin baskets.", "journal": "Biochemistry", "date": "1997", "authors": "Barouch W, Prasad K, Greene L, Eisenberg E", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "9100026", "url": "https://glygen.org/publication/PubMed/9100026" } ] }, { "title": "P110delta, a novel phosphoinositide 3-kinase in leukocytes.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1997", "authors": "Vanhaesebroeck B, Welham MJ, Kotani K, Stein R, Warne PH, Zvelebil MJ, Higashi K, Volinia S, Downward J, Waterfield MD", "evidence": [ { "database": "Reactome", "id": "R-HSA-1660499", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1660499" } ], "reference": [ { "type": "PubMed", "id": "9113989", "url": "https://glygen.org/publication/PubMed/9113989" } ] }, { "title": "Subcellular locations of phosphatidylinositol 4-kinase isoforms.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Wong K, Meyers ddR, Cantley LC", "evidence": [ { "database": "Reactome", "id": "R-HSA-1660514", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1660514" } ], "reference": [ { "type": "PubMed", "id": "9148941", "url": "https://glygen.org/publication/PubMed/9148941" } ] }, { "title": "Phosphatidylinositol-4-phosphate 5-kinase isozymes catalyze the synthesis of 3-phosphate-containing phosphatidylinositol signaling molecules.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Zhang X, Loijens JC, Boronenkov IV, Parker GJ, Norris FA, Chen J, Thum O, Prestwich GD, Majerus PW, Anderson RA", "evidence": [ { "database": "Reactome", "id": "R-HSA-1660499", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1660499" } ], "reference": [ { "type": "PubMed", "id": "9211928", "url": "https://glygen.org/publication/PubMed/9211928" } ] }, { "title": "Phosphatidylinositol 3-kinase in bovine photoreceptor rod outer segments.", "journal": "Investigative ophthalmology & visual science", "date": "1997", "authors": "Guo X, Ghalayini AJ, Chen H, Anderson RE", "evidence": [ { "database": "Reactome", "id": "R-HSA-1660499", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1660499" } ], "reference": [ { "type": "PubMed", "id": "9286278", "url": "https://glygen.org/publication/PubMed/9286278" } ] }, { "title": "The cDNA cloning and characterization of inositol polyphosphate 4-phosphatase type II. Evidence for conserved alternative splicing in the 4-phosphatase family.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Norris FA, Atkins RC, Majerus PW", "evidence": [ { "database": "Reactome", "id": "R-HSA-1660516", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1660516" } ], "reference": [ { "type": "PubMed", "id": "9295334", "url": "https://glygen.org/publication/PubMed/9295334" } ] }, { "title": "Cloning of a human phosphoinositide 3-kinase with a C2 domain that displays reduced sensitivity to the inhibitor wortmannin.", "journal": "The Biochemical journal", "date": "1997-08-15", "authors": "Domin J, Pages F, Volinia S, Rittenhouse S E, Zvelebil M J, Stein R C, Waterfield M D", "evidence": [ { "database": "UniProtKB", "id": "O00443", "url": "https://www.uniprot.org/uniprot/O00443" } ], "reference": [ { "type": "PubMed", "id": "9337861", "url": "https://glygen.org/publication/PubMed/9337861" } ] }, { "title": "A new pathway for synthesis of phosphatidylinositol-4,5-bisphosphate.", "journal": "Nature", "date": "1997", "authors": "Rameh LE, Tolias KF, Duckworth BC, Cantley LC", "evidence": [ { "database": "Reactome", "id": "R-HSA-1660499", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1660499" } ], "reference": [ { "type": "PubMed", "id": "9367159", "url": "https://glygen.org/publication/PubMed/9367159" } ] }, { "title": "Identification and characterization of a novel human phosphatidylinositol 4-kinase.", "journal": "DNA research : an international journal for rapid publication of reports on genes and genomes", "date": "1997", "authors": "Suzuki K, Hirano H, Okutomi K, Suzuki M, Kuga Y, Fujiwara T, Kanemoto N, Isono K, Horie M", "evidence": [ { "database": "Reactome", "id": "R-HSA-1660514", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1660514" } ], "reference": [ { "type": "PubMed", "id": "9405935", "url": "https://glygen.org/publication/PubMed/9405935" } ] }, { "title": "A novel role for Rab5-GDI in ligand sequestration into clathrin-coated pits.", "journal": "Current biology : CB", "date": "1998", "authors": "McLauchlan H, Newell J, Morrice N, Osborne A, West M, Smythe E", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "9427626", "url": "https://glygen.org/publication/PubMed/9427626" } ] }, { "title": "Synaptojanin 1: localization on coated endocytic intermediates in nerve terminals and interaction of its 170 kDa isoform with Eps15.", "journal": "FEBS letters", "date": "1997", "authors": "Haffner C, Takei K, Chen H, Ringstad N, Hudson A, Butler MH, Salcini AE, Di Fiore PP, De Camilli P", "evidence": [ { "database": "Reactome", "id": "R-HSA-1660499", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1660499" } ], "reference": [ { "type": "PubMed", "id": "9428629", "url": "https://glygen.org/publication/PubMed/9428629" } ] }, { "title": "Cloning and characterization of a novel class II phosphoinositide 3-kinase containing C2 domain.", "journal": "Biochemical and biophysical research communications", "date": "1998", "authors": "Misawa H, Ohtsubo M, Copeland NG, Gilbert DJ, Jenkins NA, Yoshimura A", "evidence": [ { "database": "Reactome", "id": "R-HSA-1660499", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1660499" } ], "reference": [ { "type": "PubMed", "id": "9514948", "url": "https://glygen.org/publication/PubMed/9514948" } ] }, { "title": "A novel class II phosphoinositide 3-kinase predominantly expressed in the liver and its enhanced expression during liver regeneration.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Ono F, Nakagawa T, Saito S, Owada Y, Sakagami H, Goto K, Suzuki M, Matsuno S, Kondo H", "evidence": [ { "database": "Reactome", "id": "R-HSA-1660514", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1660514" } ], "reference": [ { "type": "PubMed", "id": "9516481", "url": "https://glygen.org/publication/PubMed/9516481" } ] }, { "title": "Cloning of human p55 gamma, a regulatory subunit of phosphatidylinositol 3-kinase, by a yeast two-hybrid library screen with the insulin-like growth factor-I receptor.", "journal": "Gene", "date": "1998", "authors": "Dey BR, Furlanetto RW, Nissley SP", "evidence": [ { "database": "Reactome", "id": "R-HSA-1660499", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1660499" } ], "reference": [ { "type": "PubMed", "id": "9524259", "url": "https://glygen.org/publication/PubMed/9524259" } ] }, { "title": "The tumor suppressor, PTEN/MMAC1, dephosphorylates the lipid second messenger, phosphatidylinositol 3,4,5-trisphosphate.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Maehama T, Dixon JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-1660499", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1660499" } ], "reference": [ { "type": "PubMed", "id": "9593664", "url": "https://glygen.org/publication/PubMed/9593664" } ] }, { "title": "Dynamin undergoes a GTP-dependent conformational change causing vesiculation.", "journal": "Cell", "date": "1998", "authors": "Sweitzer SM, Hinshaw JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "9635431", "url": "https://glygen.org/publication/PubMed/9635431" } ] }, { "title": "Type I phosphatidylinositol-4-phosphate 5-kinases synthesize the novel lipids phosphatidylinositol 3,5-bisphosphate and phosphatidylinositol 5-phosphate.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Tolias KF, Rameh LE, Ishihara H, Shibasaki Y, Chen J, Prestwich GD, Cantley LC, Carpenter CL", "evidence": [ { "database": "Reactome", "id": "R-HSA-1660499", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1660499" } ], "reference": [ { "type": "PubMed", "id": "9660759", "url": "https://glygen.org/publication/PubMed/9660759" } ] }, { "title": "Growth factors and insulin stimulate tyrosine phosphorylation of the 51C/SHIP2 protein.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Habib T, Hejna JA, Moses RE, Decker SJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-1660499", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1660499" } ], "reference": [ { "type": "PubMed", "id": "9660833", "url": "https://glygen.org/publication/PubMed/9660833" } ] }, { "title": "Crystal structure of the amphiphysin-2 SH3 domain and its role in the prevention of dynamin ring formation.", "journal": "The EMBO journal", "date": "1998", "authors": "Owen DJ, Wigge P, Vallis Y, Moore JD, Evans PR, McMahon HT", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "9736607", "url": "https://glygen.org/publication/PubMed/9736607" } ] }, { "title": "The lipid phosphatase activity of PTEN is critical for its tumor supressor function.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1998", "authors": "Myers MP, Pass I, Batty IH, Van der Kaay J, Stolarov JP, Hemmings BA, Wigler MH, Downes CP, Tonks NK", "evidence": [ { "database": "Reactome", "id": "R-HSA-1660499", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1660499" } ], "reference": [ { "type": "PubMed", "id": "9811831", "url": "https://glygen.org/publication/PubMed/9811831" } ] }, { "title": "Human phosphoinositide 3-kinase C2beta, the role of calcium and the C2 domain in enzyme activity.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Arcaro A, Volinia S, Zvelebil MJ, Stein R, Watton SJ, Layton MJ, Gout I, Ahmadi K, Downward J, Waterfield MD", "evidence": [ { "database": "Reactome", "id": "R-HSA-1660499", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1660499" } ], "reference": [ { "type": "PubMed", "id": "9830063", "url": "https://glygen.org/publication/PubMed/9830063" } ] }, { "title": "cDNA cloning of a third human C2-domain-containing class II phosphoinositide 3-kinase, PI3K-C2gamma, and chromosomal assignment of this gene (PIK3C2G) to 12p12.", "journal": "Genomics", "date": "1998", "authors": "Rozycka M, Lu YJ, Brown RA, Lau MR, Shipley JM, Fry MJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-1660514", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1660514" } ], "reference": [ { "type": "PubMed", "id": "9878262", "url": "https://glygen.org/publication/PubMed/9878262" } ] } ], "pathway": [ { "id": "hsa:5286", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:5286", "resource": "KEGG Pathway" }, { "id": "R-HSA-1660499", "name": "Synthesis of PIPs at the plasma membrane", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1660499", "resource": "Reactome", "description": "Synthesis of PIPs at the plasma membrane" }, { "id": "R-HSA-1660514", "name": "Synthesis of PIPs at the Golgi membrane", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1660514", "resource": "Reactome", "description": "Synthesis of PIPs at the Golgi membrane" }, { "id": "R-HSA-1660516", "name": "Synthesis of PIPs at the early endosome membrane", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1660516", "resource": "Reactome", "description": "Synthesis of PIPs at the early endosome membrane" }, { "id": "R-HSA-1660517", "name": "Synthesis of PIPs at the late endosome membrane", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1660517", "resource": "Reactome", "description": "Synthesis of PIPs at the late endosome membrane" }, { "id": "R-HSA-432722", "name": "Golgi Associated Vesicle Biogenesis", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-432722", "resource": "Reactome", "description": "Golgi Associated Vesicle Biogenesis" }, { "id": "R-HSA-8856828", "name": "Clathrin-mediated endocytosis", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828", "resource": "Reactome", "description": "Clathrin-mediated endocytosis" } ], "orthologs": [ { "uniprot_canonical_ac": "D3ZTF6-1", "protein_name": "Phosphatidylinositol-4-phosphate 3-kinase, catalytic subunit type 2 alpha", "gene_name": "Pik3c2a", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MAQISNNSEFKQCSSSHPEPIRTKDVDKAEALQMEAEALAKLQKDRHMTDSPRGFELSNSTRQRTQGFNKQDYDLMVFPESDSQKRALDIDVEKLTQAELEKILLDDNFETRKTPASPVTPVLSPSFSAQLYLRPAVQRSQWPPGLCGPSTYTLPSIYPSAYSKQATFQNGFSPRMPTFPSTESIYLRLPGQSPYFSYPLTPATPFHPQGSLPVYRPLVSPDMAKLFDKIASTSEFLKNGKARTDLEIANSKASVCNLQISPKSEDINKFDWLDLDPLSKPKIDCVEVLEHEEEKKNPVLLAEDPWDAVLLEERSPTSRHLERKVNGKSLSGATVTRSQSLIVRTTQVTKAQSQVSQKDPNGTSSLATGSSLLQEFEVQNEEVAAFCQSIMKLKTKFPYTDHCTNPGYLLSPVTVQRNMCGENASVKVSIEIEGFQQPVTFTCDVSSTVDIIIMQALCWVHDDLNQVDVGSYILKVCGQEEVLQNNHCLGSHEHIQNCRKWDTEIKLQLLTFSAMCQNLARTAEDDEAPVDLNKYLYQIEKPYKEVMTRHPVEELLDSYHYQVELALQTENQHRAIDQVIKAVRKICSALDGVETPAVTEAVKKLKRAVNLPRNKSADVTSLSGGDTSKNSTRGSLNLENPVQVSMDHLTAAIYDLLRLHTNSCKSSTVCPQGSRNIKEAWTATEQLQFTVYAAHGISSNWVSNYEKYYLICSLSHNGKDLFKPIQSKKVGTYKNFFYLIKWDELIIFPIQISQLPLESVLHLTLFGVLNQSSGSSPDSNKQRKGPEALGKVSLTLFDFKRFLTCGTKLLYLWTSSHTNSIPGAIPQKSYVMERIVLQVDFPSPAFDIIYTSPQIDRNIIQQYKLEALENEIKGKLLDIVHRDSSFGLSKEDKAFLWEKRYYCLKHPNCLPKILASAPNWKWANLAKTYSLLHQWPPLCPLAALELLDAKFADQEVRSLAVSWIEAISDDELTDLLPQFVQALKYEIYLNSSLVRFLLSRALGNIQIAHSLYWLLKDALHDTRFGSRYEHVLGALLSVGGKGLREELSKQMKLVQLLGGVAEKVRQASGSARQVVLQKSMERVQSFFLRNKCRVPLKPSLVAKELNIKSCSFFSSNAMPLKVTMVNADPLGEEINVMFKVGEDLRQDMLALQMIKIMDKIWLKEGLDLRMVIFKCLSTGRDQGMVELVPASDTLRKIQVEYGVTGSFKDKPLAEWLRKYNPSEEEYEKASENFIYSCAGCCVATYVLGICDRHNDNIMLRSTGHMFHIDFGKFLGHAQMFGSFKRDRAPFVLTSDMAYVINGGEKPTIRFQLFVDLCCQAYNLIRKQTNLFLNLLSLMIPSGLPELTSIQDLKYVRDALQPQTTDAEATIFFTRLIESSLGSIATKFNFFIHNLAQLRFSGLPSNDEPILSFSPKTYSFRQDGRIKEVSVFTYHKKYNPDKHYIYVVRILREGHLEPSFVFRTFDEFQELHNKLSIIFPLWKLPGFPNRMVLGRTHIKDVAAKRKIELNSYLQSLMNASTDVAECDLVCTFFHPLLRDEKAEGIARSTGTSPFSPTLGQIGGAVKLSVSYRNGTLFIMVMHIKDLVTEDGADPNPYVKTYLLPDTHKTSKRKTKISRKTRNPTFNEMLVYSGYSRETLRQRELQLSVLSAESLRENFFLGGITLPLKDFNLSKETVKWYQLTAATYL", "length": 1687 }, "evidence": [ { "id": "45920948", "url": "http://www.informatics.jax.org/homology/45920948", "database": "MGI" }, { "id": "O00443", "url": "https://omabrowser.org/oma/group/O00443/", "database": "OMA" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q61194-1", "protein_name": "Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha", "gene_name": "Pik3c2a", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MAQISNNSEFKQCSSSHPEPIRTKDVNKAEALQMEAEALAKLQKDRQMTDSPRGFELSSSTRQRTQGFNKQDYDLMVFPELDSQKRAVDIDVEKLTQAELEKILLDDNFETRKPPALPVTPVLSPSFSTQLYLRPSGQRGQWPPGLCGPSTYTLPSTYPSAYSKQATFQNGFSPRMPTFPSTESVYLRLPGQSPYFSYPLTPATPFHPQGSLPVYRPLVSPDMAKLFEKIASTSEFLKNGKARTDLEIANSKASVCNLQISPKSEDINKFDWLDLDPLSKPKVDYVEVLEHEEEKKDPVLLAEDPWDAVLLEERSPSCHLERKVNGKSLSGATVTRSQSLIIRTAQFTKAQGQVSQKDPNGTSSLPTGSSLLQEFEVQNDEVAAFCQSIMKLKTKFPYTDHCTNPGYLLSPVTVQRNMCGENASVKVSIEIEGLQLPVTFTCDVSSTVEIIIMQALCWVHDDLNQVDVGSYILKVCGQEEVLQNNHCLGSHEHIQNCRKWDTEIKLQLLTLSAMCQNLARTAEDDEAPVDLNKYLYQIEKPYKEVMTRHPVEELLDSYHYQVELALQTENQHRAVDQVIKAVRKICSALDGVETPSVTEAVKKLKRAVNLPRNKSADVTSLSGSDTRKNSTKGSLNPENPVQVSMDHLTTAIYDLLRLHANSSRCSTACPRGSRNIKEAWTATEQLQFTVYAAHGISSNWVSNYEKYYLICSLSHNGKDLFKPIQSKKVGTYKNFFYLIKWDELIIFPIQISQLPLESVLHLTLFGVLNQSSGSSPDSNKQRKGPEALGKVSLTLFDFKRFLTCGTKLLYLWTSSHTNSIPGAIPKKSYVMERIVLQVDFPSPAFDIIYTSPQIDRNIIQQDKLETLESDIKGKLLDIIHRDSSFGLSKEDKVFLWENRYYCLKHPNCLPKILASAPNWKWANLAKTYSLLHQWPPLCPLAALELLDAKFADQEVRSLAVSWMEAISDDELADLLPQFVQALKYEIYLNSSLVRFLLSRALGNIQIAHSLYWLLKDALHDTHFGSRYEHVLGALLSVGGKGLREELSKQMKLVQLLGGVAEKVRQASGSTRQVVLQKSMERVQSFFLRNKCRLPLKPSLVAKELNIKSCSFFSSNAMPLKVTMVNADPLGEEINVMFKVGEDLRQDMLALQMIKIMDKIWLKEGLDLRMVIFRCLSTGRDRGMVELVPASDTLRKIQVEYGVTGSFKDKPLAEWLRKYNPSEEEYEKASENFIYSCAGCCVATYVLGICDRHNDNIMLRSTGHMFHIDFGKFLGHAQMFGSFKRDRAPFVLTSDMAYVINGGEKPTIRFQLFVDLCCQAYNLIRKQTNLFLNLLSLMIPSGLPELTSIQDLKYVRDALQPQTTDAEATIFFTRLIESSLGSIATKFNFFIHNLAQLRFSGLPSNDEPILSFSPKTYSFRQDGRIKEVSVFTYHKKYNPDKHYIYVVRILREGHLEPSFVFRTFDEFQELHNKLSIIFPLWKLPGFPNRMVLGRTHIKDVAAKRKIELNSYLQSLMNASTDVAECDLVCTFFHPLLRDEKAEGIARSAGAVPFSPTLGQIGGAVKLSVSYRNGTLFIMVMHIKDLVTEDGADPNPYVKTYLLPDTHKTSKRKTKISRKTRNPTFNEMLVYSGYSKETLRQRELQLSVLSAESLRENFFLGGITLPLKDFNLSKETVKWYQLTAATYL", "length": 1686 }, "evidence": [ { "id": "45920948", "url": "http://www.informatics.jax.org/homology/45920948", "database": "MGI" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 15, "go_terms": [ { "name": "phosphatidylinositol-3-phosphate biosynthetic process", "id": "GO:0036092", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0036092", "evidence": [ { "database": "UniProtKB", "id": "O00443", "url": "https://www.uniprot.org/uniprot/O00443" } ], "pmid": "" }, { "name": "endocytosis", "id": "GO:0006897", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006897", "evidence": [ { "database": "UniProtKB", "id": "O00443", "url": "https://www.uniprot.org/uniprot/O00443" } ], "pmid": "" }, { "name": "membrane organization", "id": "GO:0061024", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0061024", "evidence": [ { "database": "UniProtKB", "id": "O00443", "url": "https://www.uniprot.org/uniprot/O00443" } ], "pmid": "" }, { "name": "epidermal growth factor receptor signaling pathway", "id": "GO:0007173", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007173", "evidence": [ { "database": "UniProtKB", "id": "O00443", "url": "https://www.uniprot.org/uniprot/O00443" } ], "pmid": "" }, { "name": "phosphorylation", "id": "GO:0016310", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016310", "evidence": [ { "database": "UniProtKB", "id": "O00443", "url": "https://www.uniprot.org/uniprot/O00443" } ], "pmid": "" }, { "name": "positive regulation of cell migration involved in sprouting angiogenesis", "id": "GO:0090050", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0090050", "evidence": [ { "database": "UniProtKB", "id": "O00443", "url": "https://www.uniprot.org/uniprot/O00443" } ], "pmid": "" }, { "name": "positive regulation of autophagy", "id": "GO:0010508", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010508", "evidence": [ { "database": "UniProtKB", "id": "O00443", "url": "https://www.uniprot.org/uniprot/O00443" } ], "pmid": "" }, { "name": "insulin receptor signaling pathway", "id": "GO:0008286", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008286", "evidence": [ { "database": "UniProtKB", "id": "O00443", "url": "https://www.uniprot.org/uniprot/O00443" } ], "pmid": "" }, { "name": "vascular associated smooth muscle contraction", "id": "GO:0014829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0014829", "evidence": [ { "database": "UniProtKB", "id": "O00443", "url": "https://www.uniprot.org/uniprot/O00443" } ], "pmid": "" }, { "name": "phosphatidylinositol-mediated signaling", "id": "GO:0048015", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048015", "evidence": [ { "database": "UniProtKB", "id": "O00443", "url": "https://www.uniprot.org/uniprot/O00443" } ], "pmid": "" }, { "name": "clathrin coat assembly", "id": "GO:0048268", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048268", "evidence": [ { "database": "UniProtKB", "id": "O00443", "url": "https://www.uniprot.org/uniprot/O00443" } ], "pmid": "" }, { "name": "phosphatidylinositol biosynthetic process", "id": "GO:0006661", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006661", "evidence": [ { "database": "UniProtKB", "id": "O00443", "url": "https://www.uniprot.org/uniprot/O00443" } ], "pmid": "" }, { "name": "exocytosis", "id": "GO:0006887", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006887", "evidence": [ { "database": "UniProtKB", "id": "O00443", "url": "https://www.uniprot.org/uniprot/O00443" } ], "pmid": "" }, { "name": "phosphatidylinositol 3-kinase/protein kinase B signal transduction", "id": "GO:0043491", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043491", "evidence": [ { "database": "UniProtKB", "id": "O00443", "url": "https://www.uniprot.org/uniprot/O00443" } ], "pmid": "" }, { "name": "platelet-derived growth factor receptor signaling pathway", "id": "GO:0048008", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048008", "evidence": [ { "database": "UniProtKB", "id": "O00443", "url": "https://www.uniprot.org/uniprot/O00443" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 6, "go_terms": [ { "name": "ATP binding", "id": "GO:0005524", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005524", "evidence": [ { "database": "UniProtKB", "id": "O00443", "url": "https://www.uniprot.org/uniprot/O00443" } ], "pmid": "" }, { "name": "clathrin binding", "id": "GO:0030276", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030276", "evidence": [ { "database": "UniProtKB", "id": "O00443", "url": "https://www.uniprot.org/uniprot/O00443" } ], "pmid": "" }, { "name": "phosphatidylinositol binding", "id": "GO:0035091", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035091", "evidence": [ { "database": "UniProtKB", "id": "O00443", "url": "https://www.uniprot.org/uniprot/O00443" } ], "pmid": "" }, { "name": "1-phosphatidylinositol-3-kinase activity", "id": "GO:0016303", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016303", "evidence": [ { "database": "UniProtKB", "id": "O00443", "url": "https://www.uniprot.org/uniprot/O00443" } ], "pmid": "" }, { "name": "1-phosphatidylinositol-4,5-bisphosphate 3-kinase activity", "id": "GO:0046934", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046934", "evidence": [ { "database": "UniProtKB", "id": "O00443", "url": "https://www.uniprot.org/uniprot/O00443" } ], "pmid": "" }, { "name": "1-phosphatidylinositol-4-phosphate 3-kinase activity", "id": "GO:0035005", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035005", "evidence": [ { "database": "UniProtKB", "id": "O00443", "url": "https://www.uniprot.org/uniprot/O00443" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 11, "go_terms": [ { "name": "nucleoplasm", "id": "GO:0005654", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654", "evidence": [ { "database": "UniProtKB", "id": "O00443", "url": "https://www.uniprot.org/uniprot/O00443" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "O00443", "url": "https://www.uniprot.org/uniprot/O00443" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "O00443", "url": "https://www.uniprot.org/uniprot/O00443" } ], "pmid": "" }, { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "O00443", "url": "https://www.uniprot.org/uniprot/O00443" } ], "pmid": "" }, { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "O00443", "url": "https://www.uniprot.org/uniprot/O00443" } ], "pmid": "" }, { "name": "intracellular membrane-bounded organelle", "id": "GO:0043231", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043231", "evidence": [ { "database": "UniProtKB", "id": "O00443", "url": "https://www.uniprot.org/uniprot/O00443" } ], "pmid": "" }, { "name": "extracellular exosome", "id": "GO:0070062", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070062", "evidence": [ { "database": "UniProtKB", "id": "O00443", "url": "https://www.uniprot.org/uniprot/O00443" } ], "pmid": "" }, { "name": "clathrin-coated vesicle", "id": "GO:0030136", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030136", "evidence": [ { "database": "UniProtKB", "id": "O00443", "url": "https://www.uniprot.org/uniprot/O00443" } ], "pmid": "" }, { "name": "vesicle", "id": "GO:0031982", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031982", "evidence": [ { "database": "UniProtKB", "id": "O00443", "url": "https://www.uniprot.org/uniprot/O00443" } ], "pmid": "" }, { "name": "trans-Golgi network", "id": "GO:0005802", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005802", "evidence": [ { "database": "UniProtKB", "id": "O00443", "url": "https://www.uniprot.org/uniprot/O00443" } ], "pmid": "" }, { "name": "phosphatidylinositol 3-kinase complex", "id": "GO:0005942", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005942", "evidence": [ { "database": "UniProtKB", "id": "O00443", "url": "https://www.uniprot.org/uniprot/O00443" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 1516, "end_pos": 1518, "annotation": "n_glycosylation_sequon" }, { "start_pos": 1571, "end_pos": 1573, "annotation": "n_glycosylation_sequon" }, { "start_pos": 1669, "end_pos": 1671, "annotation": "n_glycosylation_sequon" }, { "start_pos": 294, "end_pos": 296, "annotation": "n_glycosylation_sequon" }, { "start_pos": 359, "end_pos": 361, "annotation": "n_glycosylation_sequon" }, { "start_pos": 421, "end_pos": 423, "annotation": "n_glycosylation_sequon" }, { "start_pos": 769, "end_pos": 771, "annotation": "n_glycosylation_sequon" }, { "start_pos": 989, "end_pos": 991, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "Phosphorylated upon insulin stimulation; which may lead to enzyme activation (By similarity). Phosphorylated on Ser-259 during mitosis and upon UV irradiation; which does not change enzymatic activity but leads to proteasomal degradation. Ser-259 phosphorylation may be mediated by CDK1 or JNK, depending on the physiological state of the cell.", "evidence": [ { "database": "UniProtKB", "id": "O00443", "url": "https://www.uniprot.org/uniprot/O00443" }, { "database": "PubMed", "id": "11606566", "url": "https://glygen.org/publication/PubMed/11606566" }, { "database": "PubMed", "id": "12719431", "url": "https://glygen.org/publication/PubMed/12719431" } ] } ], "interactions": [], "reactions": [ { "id": "12709", "name": "", "equation": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol) + ATP = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3-phosphate) + ADP + H(+)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "O88763-1", "A0A0G2K344-1", "O70173-1", "Q8NEB9-1", "P48736-1", "O00750-1", "P42336-1", "O00443-1", "O00329-1", "O75747-1", "P42337-1", "Q61194-1", "Q6PF93-1", "O35904-1", "Q9JHG7-1", "O70167-1", "P22543-1", "P54673-1", "P54674-1", "P54675-1", "P54676-1", "Q7K3H0-1", "Q9W1M7-1" ], "evidence": [ { "id": "12709", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/12709" } ] }, { "id": "18373", "name": "", "equation": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol 4-phosphate) + ATP = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3,4-bisphosphate) + ADP + H(+)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "O70173-1", "O00750-1", "O75747-1", "O00443-1", "P48736-1", "Q61194-1", "O70167-1", "Q9JHG7-1", "Q7K3H0-1" ], "evidence": [ { "id": "18373", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/18373" } ] }, { "id": "21292", "name": "", "equation": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-4,5-bisphosphate) + ATP = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3,4,5-trisphosphate) + ADP + H(+)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "A0A0G2K344-1", "Q9Z1L0-1", "Q99NI4-1", "A0A8I5Y949-1", "D3ZFJ0-1", "P42336-1", "Q8NFU5-1", "P48736-1", "P42338-1", "O00329-1", "O00443-1", "O35904-1", "Q7TT16-1", "P42337-1", "Q8BTI9-1", "Q9JHG7-1", "Q61194-1", "P07250-1" ], "evidence": [ { "id": "21292", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/21292" } ] }, { "id": "R-HSA-1675928", "name": "PI4P is phosphorylated to PI(3,4)P2 by PIK3C2A/G at the Golgi membrane", "equation": "", "summary": "At the Golgi membrane, phosphatidylinositol-4-phosphate 3-kinase C2 domain-containing subunit alpha (PIK3C2A) (Domin et al. 2000, Arcaro et al. 2000) and phosphatidylinositol-4-phosphate 3-kinase C2 domain-containing subunit gamma (PIK3C2G) (Ono et al. 1998, Rozycka et al. 1998, Misawa et al. 1998) phosphorylate phosphatidylinositol 4-phosphate (PI4P) to phosphatidylinositol 3,4-bisphosphate (PI(3,4)P2). PIK3C2G phosphorylates phosphatidylinositol (PI) and PI4P but not phosphatidylinositol 4,5-bisphosphate (PI(4,5)P2).", "cellular_location": "Golgi membrane, cytosol", "input_participant_list": [], "output_participant_list": [ "R-ALL-1806230" ], "enzyme_list": [ "O00443-1", "O75747-1" ], "evidence": [ { "id": "R-HSA-1675928", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1675928" } ] }, { "id": "R-HSA-1675939", "name": "PI is phosphorylated to PI3P by PIK3C2A/3 at the early endosome membrane", "equation": "", "summary": "At the early endosome membrane, phosphatidylinositol 3-kinase catalytic subunit type 3 (PIK3C3) aka VPS34 binds to phosphoinositide 3-kinase regulatory subunit 4 (PIK3R4). The PIK3C3:PIK3R4 complex and phosphatidylinositol-4-phosphate 3-kinase C2 domain-containing subunit alpha (PIK3C2A) phosphorylate phosphatidylinositol (PI) to phosphatidylinositol 3-phosphate (PI3P).

The following lists the above proteins with their corresponding literature references: PIK3C3:PIK3R4 complex (Panaretou et al. 1997, Volinia et al. 1995, Cao et al. 2007) and PIK3C2A (Arcaro et al. 2000, Domin et al. 2000).", "cellular_location": "cytosol, early endosome membrane", "input_participant_list": [], "output_participant_list": [ "R-ALL-1806200" ], "enzyme_list": [ "Q99570-1", "O00443-1", "Q8NEB9-1" ], "evidence": [ { "id": "R-HSA-1675939", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1675939" } ] }, { "id": "R-HSA-1675961", "name": "PI is phosphorylated to PI3P by PIK3C2A/3 at the Golgi membrane", "equation": "", "summary": "At the Golgi membrane, phosphatidylinositol 3-kinase catalytic subunit type 3 (PIK3C3) aka VPS34 is bound to phosphoinositide 3-kinase regulatory subunit 4 (PIK3R4). This PIK3C3:PIK2R4 complex and phosphatidylinositol-4-phosphate 3-kinase C2 domain-containing subunit alpha (PIK3C2A) phosphorylate phosphatidylinositol (PI) to phosphatidylinositol 3-phosphate (PI3P).

The following lists the above proteins with their corresponding literature references: PIK3C3:PIK2R4 (Panaretou et al. 1997, Volinia et al. 1995) and PIK3C2A (Arcaro et al. 2000, Domin et al. 2000).", "cellular_location": "Golgi membrane, cytosol", "input_participant_list": [], "output_participant_list": [ "R-ALL-1806159" ], "enzyme_list": [ "Q99570-1", "O00443-1", "Q8NEB9-1" ], "evidence": [ { "id": "R-HSA-1675961", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1675961" } ] }, { "id": "R-HSA-1676024", "name": "PI is phosphorylated to PI3P by PIK3C2A/3 at the late endosome membrane", "equation": "", "summary": "At the late endosome membrane, phosphatidylinositol 3-kinase catalytic subunit type 3 (PIK3C3) aka VPS34 binds to phosphoinositide 3-kinase regulatory subunit 4 (PIK3R4). The PIK3C3:PIK3R4 complex and phosphatidylinositol-4-phosphate 3-kinase C2 domain-containing subunit alpha (PIK3C2A) phosphorylate phosphatidylinositol (PI) to phosphatidylinositol 3-phosphate (PI3P).

The following lists the above proteins with their corresponding literature references: PIK3C3:PIK3R4 (Panaretou et al. 1997, Volinia et al. 1995, Cao et al. 2007) and PIK3C2A (Arcaro et al. 2000, Domin et al. 2000).", "cellular_location": "cytosol, late endosome membrane", "input_participant_list": [ "R-ALL-1806195" ], "output_participant_list": [ "R-ALL-1806198" ], "enzyme_list": [ "Q99570-1", "O00443-1", "Q8NEB9-1" ], "evidence": [ { "id": "R-HSA-1676024", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1676024" } ] }, { "id": "R-HSA-1676109", "name": "PI4P is phosphorylated to PI(3,4)P2 by PI3K3C[2] at the plasma membrane", "equation": "", "summary": "At the plasma membrane, phosphatidylinositol-4,5-bisphosphate (PI(4,5)P2) 3-kinase catalytic subunits form complexes with regulatory subunits. These complexes along with phosphatidylinositol-4-phosphate 3-kinase C2 domain-containing subunits alpha (PIK3C2A), beta (PIK3C2B), and gamma (PIK3C2G) phosphorylate phosphatidylinositol 4-phosphate (PI4P) to phosphatidylinositol 3,4-bisphosphate (PI(3,4)P2). The PI(4,5)P2 3-kinase complexes involved are: PI(4,5)P2 3-kinase catalytic subunit alpha isoform (PIK3CA) bound to PI 3-kinase regulatory subunit alpha/beta/gamma (PIK3R1/2/3); beta (PIK3CB) bound to PIK3R1/2/3; delta (PIK3CD) bound to PIK3R1/2/3; and gamma (PIK3CG) bound to PI 3-kinase regulatory subunit 5 (PIK3R5) or 6 (PIK3R6).

The following lists the above proteins with their corresponding literature references: PIK3C2A (Arcaro et al. 2000); PIK3C2B (Arcaro et al. 2000, Arcaro et al. 1998); PIK3C2G (Misawa et al. 1998, Ono et al. 1998); PIK3CA:PIK3R1, PIK3CA:PIK3R2, PIK3CA:PIK3R3 (Vanhaesebroeck et al. 1997); PIK3CB:PIK3R1, PIK3CB:PIK3R2, PIK3CB:PIK3R3 (Meier et al. 2004, Guo et al. 1997); PIK3CD:PIK3R1, PIK3CD:PIK3R2, PIK3CD:PIK3R3 (Vanhaesebroeck et al. 1997); and PIK3CG:PIK3R5, PIK3CG:PIK3R6 (Suire et al. 2005, Stoyanov et al. 1995).", "cellular_location": "cytosol, plasma membrane", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P42336-1", "O00443-1", "O75747-1", "P48736-1", "P42338-1", "O00329-1", "O00750-1" ], "evidence": [ { "id": "R-HSA-1676109", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1676109" } ] }, { "id": "R-HSA-1676206", "name": "PI4P is phosphorylated to PI(3,4)P2 by PIK3C2A at the early endosome membrane", "equation": "", "summary": "At the early endosome membrane, phosphatidylinositol-4-phosphate 3-kinase C2 domain-containing subunit alpha (PIK3C2A) (Kraq et al. 2010, Arcaro et al. 2000) phosphorylates phosphatidylinositol 4-phosphate (PI4P) to phosphatidylinositol 3,4-bisphosphate (PI(3,4)P2).", "cellular_location": "cytosol, early endosome membrane", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "O00443-1" ], "evidence": [ { "id": "R-HSA-1676206", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1676206" } ] }, { "id": "R-HSA-421831", "name": "trans-Golgi Network Coat Assembly", "equation": "", "summary": "Once the basic components of the docking complex are assembled with one end of AP-1 bound to cargo molecules, the other end binds to clathrin. Clathrin triskelions polymerize into hexagons and pentagons, forming a cage, which leads to membrane deformation. This polymerization step drives the sculpting of the vesicle. The number of clathrin triskelions required to sculpt a vesicle appears to be variable, but has been estimated to require 36 - 60 triskelions assocaited with 30 - 66 AP-1 complexes. Here a ~380 angstroms vesicle is represented with 48 clathrin triskelions and 52 AP-1 complexes.", "cellular_location": "Golgi membrane, cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P51148-1", "O00443-1", "P50570-1", "P84077-1", "O14976-1", "Q01968-1", "O75976-1" ], "evidence": [ { "id": "R-HSA-421831", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-421831" } ] }, { "id": "R-HSA-421833", "name": "Vamp And trans-Golgi Network AP-1 Binding Coupled With Cargo Capture", "equation": "", "summary": "Once AP-1 is recruited to the trans-Golgi Network membrane the complex of functional vesicle building proteins is joined by the cargo that will be within that vesicle. As with other types of vesicles the cargo itself is part of the vesicle development. Here the cargo is destined for the Golgi-associated vesicle membrane. It is at this stage that a specific Synaptobrevin (Vamp) molecule also joins the complex. It should be noted that only certain Vamp molecules will be found with specific cargo molecules on the newly forming vesicles. However here we represent this reaction in bulk, without specific Vamp and cargo molecule pairings.", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P51148-1", "O00443-1", "P84077-1", "O14976-1", "Q01968-1", "O75976-1" ], "evidence": [ { "id": "R-HSA-421833", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-421833" } ] }, { "id": "R-HSA-421835", "name": "trans-Golgi Network Vesicle Scission", "equation": "", "summary": "Dynamin is recruited to the growing vesicle and, under conditions that interfere with its GTPase activity, dynamin forms a collar or ring around the neck of the budding vesicle. It is unclear whether dynamin acts as a mechanochemical transducer to generate fission or as a recruiter to attach other proteins that are directly responsible for the fission step. Lipid-modifying enzymes such as endophilin are also involved in vesicle formation. Endophilin is an acyltransferase that interacts with dynamin and that generates lysophosphatidic acid. The current view is that this reaction produces a negative curvature at the neck of the vesicle.", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P51148-1", "O00443-1", "P50570-1", "O14976-1", "Q01968-1", "O75976-1" ], "evidence": [ { "id": "R-HSA-421835", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-421835" } ] }, { "id": "R-HSA-421836", "name": "trans-Golgi Network Derived Vesicle Uncoating", "equation": "", "summary": "The heat shock protein Hsc70 and auxilin, a J-domain containing protein, are responsible for clathrin disassembly through an ATP-dependent reaction. This uncoating step may be a point in the pathway subject to regulation. This final step releases the vesicle from the clathrin cage. The vesicle still contatins a specific Vamp molecule, part of the targeting and fusion mechanism that delivers the vesicle to its ultimate destination. This vesicle also contains its cargo, membrane proteins embeded in the Golgi-associated vesicle membrane.", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P51148-1", "O00443-1", "P11142-1", "O14976-1", "Q01968-1", "O75976-1", "O75061-1" ], "evidence": [ { "id": "R-HSA-421836", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-421836" } ] }, { "id": "R-HSA-8867754", "name": "F- and N- BAR domain proteins bind the clathrin-coated pit", "equation": "", "summary": "BAR (BIN/amphiphysin/Rvs) domain proteins sense and contribute to membrane curvature. BAR domain proteins generally form long, coiled-coil homo- or hetero-dimers with a concave inner surface that interacts with membranes (reviewed in Gallop and McMahon, 2005; Daumke et al, 2014). F-BAR domain proteins such as FCHo 1 and 2 recognize shallow membrane curvature and are generally recruited early in the formation of clathrin-coated pit (Itoh et al, 2005; Kamioka et al, 2004; Henne et al, 2007; Shimada et al, 2007; Henne et al, 2010). FNBP proteins and N-BAR containing endocytic proteins such as SNX9 and 18, amphiphysin (AMPH) and endophilins recognize regions of membrane with greater curvature, interact with dynamin and likely play a later role in CCP formation with spatiotemporal coupling to vesicle scission (Kamioka et al, 2004; Itoh et al, 2005; Soulet et al, 2005; Shimada et al, 2007; Shin et al, 2008; Taylor et al, 2011; reveiwed in McMahon and Boucrot, 2011). These proteins are recruited to the complex through interactions with core components of the clathrin-coated pit, and in the case of SNX9, also through interaction with PI(3,4)P2, which is generated at late stages by clathrin-associated PIK3C2A (Lundmark and Carlson, 2003; Schmid et al, 2006; Dergai et al, 2010; Brett et al, 2002 : Posor et al, 2013; reviewed in Daumke et al, 2014). Early BAR domain containing proteins such as FCHo1 and 2 are not present in either late stage clathrin-coated pits or in free clathrin-coated vesicles. Although the precise timing of their dissociation is not known, in this pathway, they are shown leaving the clathrin-coated pit upon recruitment of the more highly curved N-BAR proteins (Taylor et al, 2011).", "cellular_location": "plasma membrane", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "O00443-1", "P00533-1", "P22681-1", "Q2M2I8-1", "P13569-1" ], "evidence": [ { "id": "R-HSA-8867754", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8867754" } ] }, { "id": "R-HSA-8868071", "name": "Clathrin recruits PIK3C2A", "equation": "", "summary": "PIK3C2A is a member of the class II PI 3 kinases, and phosphorylates PI(4)P to PI(3,4)P2 at the plasma membrane. PIK3C2A interacts with clathrin through a clathrin-binding domain in its unique N-terminal tail and localizes to late-stage clathrin-coated pits (Domin et al, 2000; Gaidarov et al, 2001; Gaidarov et al, 2005). Binding to clathrin stimulates the kinase activity of PIK3C2A and promotes the production of PI(3,4)P2 at the plasma membrane (Gaidarov et al, 2001). PI(3,4)P2 formation by PIK3C2A contributes to maturation of clathrin-coated pits by promoting the recruitment of BAR-domain containing proteins such as SNX9, which stimulate membrane curvature required for vesicle formation and eventual fission (Posor et al, 2013; reveiwed in Daumke et al, 2014).", "cellular_location": "plasma membrane", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "O00443-1", "P00533-1", "P22681-1", "Q2M2I8-1", "P13569-1" ], "evidence": [ { "id": "R-HSA-8868071", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8868071" } ] }, { "id": "R-HSA-8868072", "name": "Clathrin-associated PIK3C2A phosphorylates PI(4)P to PI(3,4)P2", "equation": "", "summary": "Clathrin-associated PIK3C2A catalyzes the conversion of PI(4)P to PI(3,4)P2, which contributes to the recruitment of BAR domain proteins such as SNX9 to the clathrin-coated pit (Domin et al, 2000; Gaidarov et al, 2001; Gaidarov et al, 2005; Posor et al, 2013; reviewed in Daumke et al, 2014).", "cellular_location": "plasma membrane", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "O00443-1", "P00533-1", "P22681-1", "Q2M2I8-1", "P13569-1" ], "evidence": [ { "id": "R-HSA-8868072", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8868072" } ] } ], "reaction_participants": [ { "participant_id": "R-ALL-1806159", "participant_name": "PI3P [Golgi membrane]", "crossref": [ { "id": "58088", "database": "ChEBI", "url": "" }, { "id": "58088", "database": "ChEBI", "url": "" }, { "id": "58088", "database": "ChEBI", "url": "" }, { "id": "58088", "database": "ChEBI", "url": "" }, { "id": "58088", "database": "ChEBI", "url": "" }, { "id": "58088", "database": "ChEBI", "url": "" }, { "id": "58088", "database": "ChEBI", "url": "" } ] }, { "participant_id": "R-ALL-1806195", "participant_name": "PI [late endosome membrane]", "crossref": [ { "id": "C01194", "database": "COMPOUND", "url": "" }, { "id": "57880", "database": "ChEBI", "url": "" }, { "id": "C01194", "database": "COMPOUND", "url": "" }, { "id": "57880", "database": "ChEBI", "url": "" }, { "id": "C01194", "database": "COMPOUND", "url": "" }, { "id": "57880", "database": "ChEBI", "url": "" }, { "id": "57880", "database": "ChEBI", "url": "" }, { "id": "C01194", "database": "COMPOUND", "url": "" }, { "id": "C01194", "database": "COMPOUND", "url": "" }, { "id": "57880", "database": "ChEBI", "url": "" }, { "id": "57880", "database": "ChEBI", "url": "" }, { "id": "C01194", "database": "COMPOUND", "url": "" }, { "id": "C01194", "database": "COMPOUND", "url": "" }, { "id": "57880", "database": "ChEBI", "url": "" } ] }, { "participant_id": "R-ALL-1806198", "participant_name": "PI3P [late endosome membrane]", "crossref": [ { "id": "58088", "database": "ChEBI", "url": "" }, { "id": "58088", "database": "ChEBI", "url": "" }, { "id": "58088", "database": "ChEBI", "url": "" }, { "id": "58088", "database": "ChEBI", "url": "" }, { "id": "58088", "database": "ChEBI", "url": "" }, { "id": "58088", "database": "ChEBI", "url": "" }, { "id": "58088", "database": "ChEBI", "url": "" } ] }, { "participant_id": "R-ALL-1806200", "participant_name": "PI3P [early endosome membrane]", "crossref": [ { "id": "58088", "database": "ChEBI", "url": "" }, { "id": "58088", "database": "ChEBI", "url": "" }, { "id": "58088", "database": "ChEBI", "url": "" }, { "id": "58088", "database": "ChEBI", "url": "" }, { "id": "58088", "database": "ChEBI", "url": "" }, { "id": "58088", "database": "ChEBI", "url": "" }, { "id": "58088", "database": "ChEBI", "url": "" } ] }, { "participant_id": "R-ALL-1806230", "participant_name": "PI(3,4)P2 [Golgi membrane]", "crossref": [ { "id": "16152", "database": "ChEBI", "url": "" }, { "id": "16152", "database": "ChEBI", "url": "" }, { "id": "16152", "database": "ChEBI", "url": "" }, { "id": "16152", "database": "ChEBI", "url": "" }, { "id": "16152", "database": "ChEBI", "url": "" }, { "id": "16152", "database": "ChEBI", "url": "" }, { "id": "16152", "database": "ChEBI", "url": "" } ] } ], "reaction_enzymes": [ { "uniprot_ac": "A0A0G2K344", "gene_name": "Pik3ca", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "A0A0G2K344", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2K344" } ] }, { "ec_number": "2.7.1.153", "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-4,5-bisphosphate) + ATP = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3,4,5-trisphosphate) + ADP + H(+).", "evidence": [ { "id": "A0A0G2K344", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2K344" } ] }, { "ec_number": "2.7.1.137", "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol) + ATP = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3-phosphate) + ADP + H(+).", "evidence": [ { "id": "A0A0G2K344", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2K344" } ] }, { "ec_number": "2.7.1.137", "activity": "", "evidence": [ { "id": "A0A0G2K344", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2K344" } ] }, { "ec_number": "2.7.1.153", "activity": "", "evidence": [ { "id": "A0A0G2K344", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2K344" } ] } ] }, { "uniprot_ac": "A0A8I5Y949", "gene_name": "Pik3cd", "activity": [ { "ec_number": "2.7.1.153", "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-4,5-bisphosphate) + ATP = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3,4,5-trisphosphate) + ADP + H(+).", "evidence": [ { "id": "A0A8I5Y949", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I5Y949" } ] }, { "ec_number": "2.7.1.153", "activity": "", "evidence": [ { "id": "A0A8I5Y949", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I5Y949" } ] } ] }, { "uniprot_ac": "D3ZFJ0", "gene_name": "Pik3cg", "activity": [ { "ec_number": "2.7.1.153", "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-4,5-bisphosphate) + ATP = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3,4,5-trisphosphate) + ADP + H(+).", "evidence": [ { "id": "D3ZFJ0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZFJ0" } ] }, { "ec_number": "2.7.1.153", "activity": "", "evidence": [ { "id": "D3ZFJ0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZFJ0" } ] } ] }, { "uniprot_ac": "O00329", "gene_name": "PIK3CD", "activity": [ { "ec_number": "2.7.1.153", "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-4,5-bisphosphate) + ATP = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3,4,5-trisphosphate) + ADP + H(+).", "evidence": [ { "id": "O00329", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O00329" } ] }, { "ec_number": "2.7.1.153", "activity": "", "evidence": [ { "id": "O00329", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O00329" } ] }, { "ec_number": "2.7.1.137", "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol) + ATP = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3-phosphate) + ADP + H(+).", "evidence": [ { "id": "O00329", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O00329" } ] }, { "ec_number": "2.7.1.137", "activity": "", "evidence": [ { "id": "O00329", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O00329" } ] } ] }, { "uniprot_ac": "O00443", "gene_name": "PIK3C2A", "activity": [ { "ec_number": "2.7.1.153", "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-4,5-bisphosphate) + ATP = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3,4,5-trisphosphate) + ADP + H(+).", "evidence": [ { "id": "O00443", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O00443" } ] }, { "ec_number": "2.7.1.137", "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol) + ATP = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3-phosphate) + ADP + H(+).", "evidence": [ { "id": "O00443", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O00443" } ] }, { "ec_number": "2.7.1.154", "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol 4-phosphate) + ATP = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3,4-bisphosphate) + ADP + H(+).", "evidence": [ { "id": "O00443", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O00443" } ] }, { "ec_number": "2.7.1.137", "activity": "", "evidence": [ { "id": "O00443", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O00443" } ] }, { "ec_number": "2.7.1.154", "activity": "", "evidence": [ { "id": "O00443", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O00443" } ] }, { "ec_number": "2.7.1.153", "activity": "", "evidence": [ { "id": "O00443", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O00443" } ] } ] }, { "uniprot_ac": "O00750", "gene_name": "PIK3C2B", "activity": [ { "ec_number": "2.7.1.137", "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol) + ATP = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3-phosphate) + ADP + H(+).", "evidence": [ { "id": "O00750", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O00750" } ] }, { "ec_number": "2.7.1.154", "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol 4-phosphate) + ATP = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3,4-bisphosphate) + ADP + H(+).", "evidence": [ { "id": "O00750", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O00750" } ] }, { "ec_number": "2.7.1.137", "activity": "", "evidence": [ { "id": "O00750", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O00750" } ] }, { "ec_number": "2.7.1.154", "activity": "", "evidence": [ { "id": "O00750", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O00750" } ] } ] }, { "uniprot_ac": "O14976", "gene_name": "GAK", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "O14976", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O14976" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "O14976", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O14976" } ] } ] }, { "uniprot_ac": "O35904", "gene_name": "Pik3cd", "activity": [ { "ec_number": "2.7.1.153", "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-4,5-bisphosphate) + ATP = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3,4,5-trisphosphate) + ADP + H(+).", "evidence": [ { "id": "O35904", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O35904" } ] }, { "ec_number": "2.7.1.153", "activity": "", "evidence": [ { "id": "O35904", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O35904" } ] }, { "ec_number": "2.7.1.137", "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol) + ATP = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3-phosphate) + ADP + H(+).", "evidence": [ { "id": "O35904", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O35904" } ] }, { "ec_number": "2.7.1.137", "activity": "", "evidence": [ { "id": "O35904", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O35904" } ] } ] }, { "uniprot_ac": "O70167", "gene_name": "Pik3c2g", "activity": [ { "ec_number": "2.7.1.137", "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol) + ATP = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3-phosphate) + ADP + H(+).", "evidence": [ { "id": "O70167", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O70167" } ] }, { "ec_number": "2.7.1.154", "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol 4-phosphate) + ATP = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3,4-bisphosphate) + ADP + H(+).", "evidence": [ { "id": "O70167", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O70167" } ] }, { "ec_number": "2.7.1.137", "activity": "", "evidence": [ { "id": "O70167", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O70167" } ] }, { "ec_number": "2.7.1.154", "activity": "", "evidence": [ { "id": "O70167", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O70167" } ] } ] }, { "uniprot_ac": "O70173", "gene_name": "Pik3c2g", "activity": [ { "ec_number": "2.7.1.137", "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol) + ATP = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3-phosphate) + ADP + H(+).", "evidence": [ { "id": "O70173", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O70173" } ] }, { "ec_number": "2.7.1.154", "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol 4-phosphate) + ATP = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3,4-bisphosphate) + ADP + H(+).", "evidence": [ { "id": "O70173", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O70173" } ] }, { "ec_number": "2.7.1.154", "activity": "", "evidence": [ { "id": "O70173", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O70173" } ] }, { "ec_number": "2.7.1.137", "activity": "", "evidence": [ { "id": "O70173", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O70173" } ] }, { "ec_number": "2.7.7.49", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "O70173", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O70173" } ] }, { "ec_number": "2.7.7.49", "activity": "", "evidence": [ { "id": "O70173", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O70173" } ] } ] }, { "uniprot_ac": "O75061", "gene_name": "DNAJC6", "activity": [ { "ec_number": "3.1.3.48", "activity": "H2O + O-phospho-L-tyrosyl-[protein] = L-tyrosyl-[protein] + phosphate.", "evidence": [ { "id": "O75061", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O75061" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "O75061", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O75061" } ] } ] }, { "uniprot_ac": "O75747", "gene_name": "PIK3C2G", "activity": [ { "ec_number": "2.7.1.137", "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol) + ATP = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3-phosphate) + ADP + H(+).", "evidence": [ { "id": "O75747", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O75747" } ] }, { "ec_number": "2.7.1.154", "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol 4-phosphate) + ATP = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3,4-bisphosphate) + ADP + H(+).", "evidence": [ { "id": "O75747", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O75747" } ] }, { "ec_number": "2.7.1.154", "activity": "", "evidence": [ { "id": "O75747", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O75747" } ] }, { "ec_number": "2.7.1.137", "activity": "", "evidence": [ { "id": "O75747", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O75747" } ] } ] }, { "uniprot_ac": "O75976", "gene_name": "CPD", "activity": [ { "ec_number": "3.4.17.22", "activity": "Releases C-terminal Arg and Lys from polypeptides.", "evidence": [ { "id": "O75976", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O75976" } ] }, { "ec_number": "3.4.17.22", "activity": "", "evidence": [ { "id": "O75976", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O75976" } ] } ] }, { "uniprot_ac": "O88763", "gene_name": "Pik3c3", "activity": [ { "ec_number": "2.7.1.137", "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol) + ATP = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3-phosphate) + ADP + H(+).", "evidence": [ { "id": "O88763", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O88763" } ] }, { "ec_number": "2.7.1.137", "activity": "", "evidence": [ { "id": "O88763", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O88763" } ] } ] }, { "uniprot_ac": "P00533", "gene_name": "EGFR", "activity": [ { "ec_number": "2.7.10.1", "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].", "evidence": [ { "id": "P00533", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00533" } ] }, { "ec_number": "2.7.10.1", "activity": "", "evidence": [ { "id": "P00533", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00533" } ] } ] }, { "uniprot_ac": "P07250", "gene_name": "ARG82", "activity": [ { "ec_number": "2.7.1.127", "activity": "1D-myo-inositol 1,4,5-trisphosphate + ATP = 1D-myo-inositol 1,3,4,5-tetrakisphosphate + ADP + H(+).", "evidence": [ { "id": "P07250", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07250" } ] }, { "ec_number": "2.7.1.151", "activity": "1D-myo-inositol 1,4,5-trisphosphate + 2 ATP = 1D-myo-inositol 1,3,4,5,6-pentakisphosphate + 2 ADP + 2 H(+).", "evidence": [ { "id": "P07250", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07250" } ] }, { "ec_number": "2.7.1.151", "activity": "", "evidence": [ { "id": "P07250", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07250" } ] }, { "ec_number": "2.7.1.127", "activity": "", "evidence": [ { "id": "P07250", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07250" } ] } ] }, { "uniprot_ac": "P11142", "gene_name": "HSPA8", "activity": [ { "ec_number": "3.6.4.10", "activity": "ATP + H2O = ADP + H(+) + phosphate.", "evidence": [ { "id": "P11142", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11142" } ] }, { "ec_number": "3.6.4.10", "activity": "", "evidence": [ { "id": "P11142", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11142" } ] } ] }, { "uniprot_ac": "P13569", "gene_name": "CFTR", "activity": [ { "ec_number": "5.6.1.6", "activity": "ATP + H2O + closed Cl(-) channel = ADP + phosphate + open Cl(-) channel.", "evidence": [ { "id": "P13569", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13569" } ] }, { "ec_number": "5.6.1.6", "activity": "", "evidence": [ { "id": "P13569", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13569" } ] } ] }, { "uniprot_ac": "P22543", "gene_name": "VPS34", "activity": [ { "ec_number": "2.7.1.137", "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol) + ATP = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3-phosphate) + ADP + H(+).", "evidence": [ { "id": "P22543", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P22543" } ] }, { "ec_number": "2.7.1.137", "activity": "", "evidence": [ { "id": "P22543", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P22543" } ] } ] }, { "uniprot_ac": "P22681", "gene_name": "CBL", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "P22681", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P22681" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "P22681", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P22681" } ] } ] }, { "uniprot_ac": "P42336", "gene_name": "PIK3CA", "activity": [ { "ec_number": "2.7.1.153", "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-4,5-bisphosphate) + ATP = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3,4,5-trisphosphate) + ADP + H(+).", "evidence": [ { "id": "P42336", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P42336" } ] }, { "ec_number": "2.7.1.153", "activity": "", "evidence": [ { "id": "P42336", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P42336" } ] }, { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P42336", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P42336" } ] }, { "ec_number": "2.7.1.137", "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol) + ATP = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3-phosphate) + ADP + H(+).", "evidence": [ { "id": "P42336", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P42336" } ] }, { "ec_number": "2.7.1.137", "activity": "", "evidence": [ { "id": "P42336", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P42336" } ] } ] }, { "uniprot_ac": "P42337", "gene_name": "Pik3ca", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P42337", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P42337" } ] }, { "ec_number": "2.7.1.153", "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-4,5-bisphosphate) + ATP = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3,4,5-trisphosphate) + ADP + H(+).", "evidence": [ { "id": "P42337", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P42337" } ] }, { "ec_number": "2.7.1.137", "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol) + ATP = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3-phosphate) + ADP + H(+).", "evidence": [ { "id": "P42337", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P42337" } ] }, { "ec_number": "2.7.1.153", "activity": "", "evidence": [ { "id": "P42337", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P42337" } ] }, { "ec_number": "2.7.1.137", "activity": "", "evidence": [ { "id": "P42337", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P42337" } ] } ] }, { "uniprot_ac": "P42338", "gene_name": "PIK3CB", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P42338", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P42338" } ] }, { "ec_number": "2.7.1.153", "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-4,5-bisphosphate) + ATP = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3,4,5-trisphosphate) + ADP + H(+).", "evidence": [ { "id": "P42338", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P42338" } ] }, { "ec_number": "2.7.1.153", "activity": "", "evidence": [ { "id": "P42338", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P42338" } ] }, { "ec_number": "2.7.1.137", "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol) + ATP = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3-phosphate) + ADP + H(+).", "evidence": [ { "id": "P42338", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P42338" } ] }, { "ec_number": "2.7.1.137", "activity": "", "evidence": [ { "id": "P42338", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P42338" } ] } ] }, { "uniprot_ac": "P48736", "gene_name": "PIK3CG", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P48736", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P48736" } ] }, { "ec_number": "2.7.1.153", "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-4,5-bisphosphate) + ATP = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3,4,5-trisphosphate) + ADP + H(+).", "evidence": [ { "id": "P48736", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P48736" } ] }, { "ec_number": "2.7.1.137", "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol) + ATP = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3-phosphate) + ADP + H(+).", "evidence": [ { "id": "P48736", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P48736" } ] }, { "ec_number": "2.7.1.154", "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol 4-phosphate) + ATP = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3,4-bisphosphate) + ADP + H(+).", "evidence": [ { "id": "P48736", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P48736" } ] }, { "ec_number": "2.7.1.153", "activity": "", "evidence": [ { "id": "P48736", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P48736" } ] }, { "ec_number": "2.7.1.137", "activity": "", "evidence": [ { "id": "P48736", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P48736" } ] }, { "ec_number": "2.7.1.154", "activity": "", "evidence": [ { "id": "P48736", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P48736" } ] } ] }, { "uniprot_ac": "P50570", "gene_name": "DNM2", "activity": [ { "ec_number": "3.6.5.5", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P50570", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P50570" } ] }, { "ec_number": "3.6.5.5", "activity": "", "evidence": [ { "id": "P50570", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P50570" } ] } ] }, { "uniprot_ac": "P51148", "gene_name": "RAB5C", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P51148", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51148" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P51148", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51148" } ] } ] }, { "uniprot_ac": "P54673", "gene_name": "pikA", "activity": [ { "ec_number": "2.7.1.137", "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol) + ATP = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3-phosphate) + ADP + H(+).", "evidence": [ { "id": "P54673", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P54673" } ] }, { "ec_number": "2.7.1.137", "activity": "", "evidence": [ { "id": "P54673", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P54673" } ] } ] }, { "uniprot_ac": "P54674", "gene_name": "pikB", "activity": [ { "ec_number": "2.7.1.137", "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol) + ATP = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3-phosphate) + ADP + H(+).", "evidence": [ { "id": "P54674", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P54674" } ] }, { "ec_number": "2.7.1.137", "activity": "", "evidence": [ { "id": "P54674", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P54674" } ] } ] }, { "uniprot_ac": "P54675", "gene_name": "pikC", "activity": [ { "ec_number": "2.7.1.137", "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol) + ATP = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3-phosphate) + ADP + H(+).", "evidence": [ { "id": "P54675", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P54675" } ] }, { "ec_number": "2.7.1.137", "activity": "", "evidence": [ { "id": "P54675", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P54675" } ] } ] }, { "uniprot_ac": "P54676", "gene_name": "pikE", "activity": [ { "ec_number": "2.7.1.137", "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol) + ATP = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3-phosphate) + ADP + H(+).", "evidence": [ { "id": "P54676", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P54676" } ] }, { "ec_number": "2.7.1.137", "activity": "", "evidence": [ { "id": "P54676", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P54676" } ] } ] }, { "uniprot_ac": "P84077", "gene_name": "ARF1", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P84077", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P84077" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P84077", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P84077" } ] } ] }, { "uniprot_ac": "Q01968", "gene_name": "OCRL", "activity": [ { "ec_number": "3.1.3.86", "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3,4,5-trisphosphate) + H2O = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3,4-bisphosphate) + phosphate.", "evidence": [ { "id": "Q01968", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q01968" } ] }, { "ec_number": "3.1.3.56", "activity": "1D-myo-inositol 1,4,5-trisphosphate + H2O = 1D-myo-inositol 1,4-bisphosphate + phosphate.", "evidence": [ { "id": "Q01968", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q01968" } ] }, { "ec_number": "3.1.3.36", "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-4,5-bisphosphate) + H2O = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol 4-phosphate) + phosphate.", "evidence": [ { "id": "Q01968", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q01968" } ] }, { "ec_number": "3.1.3.56", "activity": "", "evidence": [ { "id": "Q01968", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q01968" } ] }, { "ec_number": "3.1.3.36", "activity": "", "evidence": [ { "id": "Q01968", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q01968" } ] } ] }, { "uniprot_ac": "Q2M2I8", "gene_name": "AAK1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q2M2I8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q2M2I8" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q2M2I8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q2M2I8" } ] } ] }, { "uniprot_ac": "Q61194", "gene_name": "Pik3c2a", "activity": [ { "ec_number": "2.7.1.153", "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-4,5-bisphosphate) + ATP = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3,4,5-trisphosphate) + ADP + H(+).", "evidence": [ { "id": "Q61194", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q61194" } ] }, { "ec_number": "2.7.1.137", "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol) + ATP = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3-phosphate) + ADP + H(+).", "evidence": [ { "id": "Q61194", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q61194" } ] }, { "ec_number": "2.7.1.154", "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol 4-phosphate) + ATP = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3,4-bisphosphate) + ADP + H(+).", "evidence": [ { "id": "Q61194", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q61194" } ] }, { "ec_number": "2.7.1.154", "activity": "", "evidence": [ { "id": "Q61194", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q61194" } ] }, { "ec_number": "2.7.1.137", "activity": "", "evidence": [ { "id": "Q61194", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q61194" } ] }, { "ec_number": "2.7.1.153", "activity": "", "evidence": [ { "id": "Q61194", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q61194" } ] } ] }, { "uniprot_ac": "Q6PF93", "gene_name": "Pik3c3", "activity": [ { "ec_number": "2.7.1.137", "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol) + ATP = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3-phosphate) + ADP + H(+).", "evidence": [ { "id": "Q6PF93", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6PF93" } ] }, { "ec_number": "2.7.1.137", "activity": "", "evidence": [ { "id": "Q6PF93", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6PF93" } ] } ] }, { "uniprot_ac": "Q7K3H0", "gene_name": "Pi3K68D", "activity": [ { "ec_number": "2.7.1.137", "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol) + ATP = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3-phosphate) + ADP + H(+).", "evidence": [ { "id": "Q7K3H0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7K3H0" } ] }, { "ec_number": "2.7.1.154", "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol 4-phosphate) + ATP = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3,4-bisphosphate) + ADP + H(+).", "evidence": [ { "id": "Q7K3H0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7K3H0" } ] } ] }, { "uniprot_ac": "Q7TT16", "gene_name": "Ipmk", "activity": [ { "ec_number": "2.7.-.-", "activity": "", "evidence": [ { "id": "Q7TT16", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7TT16" } ] }, { "ec_number": "2.7.1.153", "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-4,5-bisphosphate) + ATP = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3,4,5-trisphosphate) + ADP + H(+).", "evidence": [ { "id": "Q7TT16", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7TT16" } ] }, { "ec_number": "2.7.1.151", "activity": "1D-myo-inositol 1,4,5-trisphosphate + 2 ATP = 1D-myo-inositol 1,3,4,5,6-pentakisphosphate + 2 ADP + 2 H(+).", "evidence": [ { "id": "Q7TT16", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7TT16" } ] }, { "ec_number": "2.7.1.140", "activity": "1D-myo-inositol 1,3,4,6-tetrakisphosphate + ATP = 1D-myo-inositol 1,3,4,5,6-pentakisphosphate + ADP + H(+).", "evidence": [ { "id": "Q7TT16", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7TT16" } ] }, { "ec_number": "2.7.1.151", "activity": "", "evidence": [ { "id": "Q7TT16", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7TT16" } ] }, { "ec_number": "2.7.1.140", "activity": "", "evidence": [ { "id": "Q7TT16", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7TT16" } ] }, { "ec_number": "2.7.1.153", "activity": "", "evidence": [ { "id": "Q7TT16", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7TT16" } ] } ] }, { "uniprot_ac": "Q8BTI9", "gene_name": "Pik3cb", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q8BTI9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BTI9" } ] }, { "ec_number": "2.7.1.153", "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-4,5-bisphosphate) + ATP = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3,4,5-trisphosphate) + ADP + H(+).", "evidence": [ { "id": "Q8BTI9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BTI9" } ] }, { "ec_number": "2.7.1.153", "activity": "", "evidence": [ { "id": "Q8BTI9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BTI9" } ] } ] }, { "uniprot_ac": "Q8NEB9", "gene_name": "PIK3C3", "activity": [ { "ec_number": "2.7.1.137", "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol) + ATP = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3-phosphate) + ADP + H(+).", "evidence": [ { "id": "Q8NEB9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8NEB9" } ] }, { "ec_number": "2.7.1.137", "activity": "", "evidence": [ { "id": "Q8NEB9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8NEB9" } ] } ] }, { "uniprot_ac": "Q8NFU5", "gene_name": "IPMK", "activity": [ { "ec_number": "2.7.1.153", "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-4,5-bisphosphate) + ATP = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3,4,5-trisphosphate) + ADP + H(+).", "evidence": [ { "id": "Q8NFU5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8NFU5" } ] }, { "ec_number": "2.7.1.151", "activity": "1D-myo-inositol 1,4,5-trisphosphate + 2 ATP = 1D-myo-inositol 1,3,4,5,6-pentakisphosphate + 2 ADP + 2 H(+).", "evidence": [ { "id": "Q8NFU5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8NFU5" } ] }, { "ec_number": "2.7.1.140", "activity": "1D-myo-inositol 1,3,4,6-tetrakisphosphate + ATP = 1D-myo-inositol 1,3,4,5,6-pentakisphosphate + ADP + H(+).", "evidence": [ { "id": "Q8NFU5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8NFU5" } ] }, { "ec_number": "2.7.1.153", "activity": "", "evidence": [ { "id": "Q8NFU5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8NFU5" } ] }, { "ec_number": "2.7.1.140", "activity": "", "evidence": [ { "id": "Q8NFU5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8NFU5" } ] }, { "ec_number": "2.7.1.151", "activity": "", "evidence": [ { "id": "Q8NFU5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8NFU5" } ] } ] }, { "uniprot_ac": "Q99570", "gene_name": "PIK3R4", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q99570", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99570" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q99570", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99570" } ] } ] }, { "uniprot_ac": "Q99NI4", "gene_name": "Ipmk", "activity": [ { "ec_number": "2.7.-.-", "activity": "", "evidence": [ { "id": "Q99NI4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99NI4" } ] }, { "ec_number": "2.7.1.153", "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-4,5-bisphosphate) + ATP = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3,4,5-trisphosphate) + ADP + H(+).", "evidence": [ { "id": "Q99NI4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99NI4" } ] }, { "ec_number": "2.7.1.151", "activity": "1D-myo-inositol 1,4,5-trisphosphate + 2 ATP = 1D-myo-inositol 1,3,4,5,6-pentakisphosphate + 2 ADP + 2 H(+).", "evidence": [ { "id": "Q99NI4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99NI4" } ] }, { "ec_number": "2.7.1.140", "activity": "1D-myo-inositol 1,3,4,6-tetrakisphosphate + ATP = 1D-myo-inositol 1,3,4,5,6-pentakisphosphate + ADP + H(+).", "evidence": [ { "id": "Q99NI4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99NI4" } ] }, { "ec_number": "2.7.1.153", "activity": "", "evidence": [ { "id": "Q99NI4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99NI4" } ] }, { "ec_number": "2.7.1.140", "activity": "", "evidence": [ { "id": "Q99NI4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99NI4" } ] }, { "ec_number": "2.7.1.151", "activity": "", "evidence": [ { "id": "Q99NI4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99NI4" } ] } ] }, { "uniprot_ac": "Q9JHG7", "gene_name": "Pik3cg", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9JHG7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JHG7" } ] }, { "ec_number": "2.7.1.153", "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-4,5-bisphosphate) + ATP = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3,4,5-trisphosphate) + ADP + H(+).", "evidence": [ { "id": "Q9JHG7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JHG7" } ] }, { "ec_number": "2.7.1.137", "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol) + ATP = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3-phosphate) + ADP + H(+).", "evidence": [ { "id": "Q9JHG7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JHG7" } ] }, { "ec_number": "2.7.1.154", "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol 4-phosphate) + ATP = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3,4-bisphosphate) + ADP + H(+).", "evidence": [ { "id": "Q9JHG7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JHG7" } ] }, { "ec_number": "2.7.1.153", "activity": "", "evidence": [ { "id": "Q9JHG7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JHG7" } ] }, { "ec_number": "2.7.1.154", "activity": "", "evidence": [ { "id": "Q9JHG7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JHG7" } ] }, { "ec_number": "2.7.1.137", "activity": "", "evidence": [ { "id": "Q9JHG7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JHG7" } ] } ] }, { "uniprot_ac": "Q9W1M7", "gene_name": "Pi3K59F", "activity": [ { "ec_number": "2.7.1.137", "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol) + ATP = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3-phosphate) + ADP + H(+).", "evidence": [ { "id": "Q9W1M7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9W1M7" } ] }, { "ec_number": "2.7.1.137", "activity": "", "evidence": [ { "id": "Q9W1M7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9W1M7" } ] } ] }, { "uniprot_ac": "Q9Z1L0", "gene_name": "Pik3cb", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q9Z1L0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z1L0" } ] }, { "ec_number": "2.7.1.153", "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-4,5-bisphosphate) + ATP = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3,4,5-trisphosphate) + ADP + H(+).", "evidence": [ { "id": "Q9Z1L0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z1L0" } ] }, { "ec_number": "2.7.1.153", "activity": "", "evidence": [ { "id": "Q9Z1L0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z1L0" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [ 334, 1327, 1335, 1415, 1417, 1648, 1651 ], "snv_sites": [ 59, 186, 264, 334, 366, 442, 444, 486, 509, 518, 610, 612, 629, 648, 663, 720, 871, 1120, 1136, 1220, 1255, 1327, 1394, 1415, 1417, 1621, 1626, 1648 ], "glycation_sites": [], "phosphorylation_sites": [ 60, 73, 108, 259, 327, 338, 630, 1281, 1551, 1553 ], "sequon_annotation_sites": [ { "start_pos": 1516, "end_pos": 1518 }, { "start_pos": 1571, "end_pos": 1573 }, { "start_pos": 1669, "end_pos": 1671 }, { "start_pos": 294, "end_pos": 296 }, { "start_pos": 359, "end_pos": 361 }, { "start_pos": 421, "end_pos": 423 }, { "start_pos": 769, "end_pos": 771 }, { "start_pos": 989, "end_pos": 991 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 7 }, { "field": "total_sites", "count": 7 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 7 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 7 }, { "field": "total_sites", "count": 7 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 7 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 11 }, { "field": "total_sites", "count": 10 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 31 }, { "field": "total_sites", "count": 28 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 28 }, { "field": "total_sites", "count": 26 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 272 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }