{ "uniprot_canonical_ac": "O00303-1", "uniprot_ac": "O00303", "uniprot_id": "EIF3F_HUMAN", "mass": { "chemical_mass": 37564.0, "monoisotopic_mass": 37564.0 }, "refseq": { "ac": "NP_003745", "name": "eukaryotic translation initiation factor 3 subunit F", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003745" }, "gene_names": [ { "name": "EIF3F", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/O00303", "id": "O00303" }, { "name": "EIF3F", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003745", "id": "NP_003745" }, { "name": "EIF3S5", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O00303", "id": "O00303" }, { "name": "eIF3-p47; EIF3S5; MRT67", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003745", "id": "NP_003745" } ], "protein_names": [ { "name": "Eukaryotic translation initiation factor 3 subunit F", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "O00303" }, { "name": "3.4.19.12", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O00303" }, { "name": "Deubiquitinating enzyme eIF3f", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O00303" }, { "name": "Eukaryotic translation initiation factor 3 subunit 5", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O00303" }, { "name": "eIF-3-epsilon", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O00303" }, { "name": "eIF3 p47", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O00303" }, { "name": "eIF3f", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O00303" }, { "name": "eukaryotic translation initiation factor 3 subunit F", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003745", "id": "NP_003745" }, { "name": "eukaryotic translation initiation factor 3, subunit 5 (epsilon, 47kD); eukaryotic translation initiation factor 3, subunit 5 epsilon, 47kDa; eIF3-epsilon; eIF-3-epsilon; deubiquitinating enzyme eIF3f", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003745", "id": "NP_003745" } ], "function": [ { "annotation": "Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis. The eIF-3 complex associates with the 40S ribosome and facilitates the recruitment of eIF-1, eIF-1A, eIF-2:GTP:methionyl-tRNAi and eIF-5 to form the 43S pre-initiation complex (43S PIC). The eIF-3 complex stimulates mRNA recruitment to the 43S PIC and scanning of the mRNA for AUG recognition. The eIF-3 complex is also required for disassembly and recycling of post-termination ribosomal complexes and subsequently prevents premature joining of the 40S and 60S ribosomal subunits prior to initiation. The eIF-3 complex specifically targets and initiates translation of a subset of mRNAs involved in cell proliferation, including cell cycling, differentiation and apoptosis, and uses different modes of RNA stem-loop binding to exert either translational activation or repression.", "evidence": [ { "database": "UniProtKB", "id": "H0YDT6", "url": "https://www.uniprot.org/uniprot/H0YDT6#function" }, { "database": "UniProtKB", "id": "MF_03005", "url": "https://www.uniprot.org/uniprot/MF_03005#function" }, { "database": "UniProtKB", "id": "O00303", "url": "https://www.uniprot.org/uniprot/O00303#function" }, { "database": "PubMed", "id": "17581632", "url": "https://glygen.org/publication/PubMed/17581632" }, { "database": "PubMed", "id": "27462815", "url": "https://glygen.org/publication/PubMed/27462815" }, { "database": "PubMed", "id": "25849773", "url": "https://glygen.org/publication/PubMed/25849773" } ] }, { "annotation": "Deubiquitinates activated NOTCH1, promoting its nuclear import, thereby acting as a positive regulator of Notch signaling.", "evidence": [ { "database": "UniProtKB", "id": "O00303", "url": "https://www.uniprot.org/uniprot/O00303#function" }, { "database": "PubMed", "id": "21124883", "url": "https://glygen.org/publication/PubMed/21124883" } ] }, { "annotation": "EIF3F-related neurodevelopmental disorder: refining the phenotypic and expanding the molecular spectrum. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_003745", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003745" }, { "database": "PubMed", "id": "33736665", "url": "https://glygen.org/publication/PubMed/33736665" } ] }, { "annotation": "EIF3f Mediates SGOC Pathway Reprogramming by Enhancing Deubiquitinating Activity in Colorectal Cancer.", "evidence": [ { "database": "RefSeq", "id": "NP_003745", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003745" }, { "database": "PubMed", "id": "37544925", "url": "https://glygen.org/publication/PubMed/37544925" } ] }, { "annotation": "Study discovered a role of EIF3F-STAT3 interaction in the genetic control of cell migration and metastasis in human lung adenocarcinoma. EIF3F promotes lung cancer cell metastasis in vivo by regulating a cluster of 34 metastasis-promoting genes including Snail2. The interaction between EIF3F and STAT3 controlled the EIF3F-mediated increase in Snail2 expression and cellular invasion.", "evidence": [ { "database": "RefSeq", "id": "NP_003745", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003745" }, { "database": "PubMed", "id": "31527668", "url": "https://glygen.org/publication/PubMed/31527668" } ] } ], "disease": [ { "disease_id": "DOID:0081228", "recommended_name": { "id": "DOID:0081228", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0081228", "name": "autosomal recessive intellectual developmental disorder 67", "description": "An autosomal recessive intellectual developmental disorder that has_material_basis_in homozygous mutation or compound heterozygous mutation in the EIF3F gene on chromosome 11p15." }, "synonyms": [ { "id": "MONDO:0032662", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0032662", "name": "intellectual developmental disorder, autosomal recessive 67", "description": "" }, { "id": "MONDO:0032662", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0032662", "name": "INTELLECTUAL DEVELOPMENTAL DISORDER, AUTOSOMAL RECESSIVE 67", "description": "" }, { "id": "MONDO:0032662", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0032662", "name": "MRT67", "description": "" }, { "id": "MONDO:0032662", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0032662", "name": "Mental Retardation, Autosomal Recessive 67", "description": "" }, { "id": "MIM:618295", "resource": "MIM", "url": "https://www.omim.org/entry/618295", "name": "Intellectual developmental disorder, autosomal recessive 67", "description": "Intellectual developmental disorder, autosomal recessive 67" } ], "evidence": [ { "id": "618295", "database": "MIM", "url": "https://www.omim.org/entry/618295" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "75.98", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000175390", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000175390" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "74.05", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000175390", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000175390" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "79.76", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000175390", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000175390" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "49.96", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000175390", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000175390" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "99.16", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000175390", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000175390" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "98.54", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000175390", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000175390" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "47.76", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000175390", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000175390" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "89.68", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000175390", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000175390" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "95.3", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000175390", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000175390" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "47.6", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000175390", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000175390" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "88.9", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000175390", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000175390" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "96.84", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000175390", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000175390" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "94.87", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000175390", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000175390" } ] } ], "expression_disease": [ { "significant": "Yes", "trend": "up", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "O00303", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O00303" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "O00303", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O00303" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "O00303", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O00303" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "O00303", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O00303" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "O00303", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O00303" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "O00303", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O00303" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "O00303", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O00303" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "O00303", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O00303" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "O00303", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O00303" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "O00303", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O00303" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "O00303", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O00303" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "O00303", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O00303" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O00303", "url": "https://www.uniprot.org/uniprot/O00303" } ], "common_name": "Human" } ], "gene": [ { "name": "EIF3F", "url": "https://www.uniprot.org/uniprot/O00303", "locus": { "chromosome": "11", "start_pos": 8001862, "end_pos": 7970251, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000175390", "url": "https://www.ensembl.org/id/ENSG00000175390" } ] } } ], "crossref": [ { "id": "ENSG00000175390", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000175390", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd08064", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd08064", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "CHEMBL2062352", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL2062352", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "EIF3F", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=EIF3F", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "8665", "url": "https://www.ncbi.nlm.nih.gov/gene/8665", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "3275", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=3275", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "O00303", "url": "https://www.ebi.ac.uk/intact/interactors/id:O00303*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR000555", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000555", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR024969", "url": "https://www.ebi.ac.uk/interpro/entry/IPR024969", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR027531", "url": "https://www.ebi.ac.uk/interpro/entry/IPR027531", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR037518", "url": "https://www.ebi.ac.uk/interpro/entry/IPR037518", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:8665", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:8665", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "603914", "url": "http://www.omim.org/entry/603914", "database": "MIM", "categories": [ "Other" ] }, { "id": "618295", "url": "http://www.omim.org/entry/618295", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_O00303", "url": "https://www.nextprot.org/entry/NX_O00303", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "O00303", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O00303", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "MFTPINV", "url": "https://omabrowser.org/oma/group/MFTPINV/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "231037at2759", "url": "http://www.orthodb.org/?query=231037at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR10540", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10540", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR10540:SF6", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10540:SF6", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "3J8B", "url": "https://www.rcsb.org/structure/3J8B", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3J8C", "url": "https://www.rcsb.org/structure/3J8C", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6YBD", "url": "https://www.rcsb.org/structure/6YBD", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6ZMW", "url": "https://www.rcsb.org/structure/6ZMW", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6ZON", "url": "https://www.rcsb.org/structure/6ZON", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6ZP4", "url": "https://www.rcsb.org/structure/6ZP4", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6ZVJ", "url": "https://www.rcsb.org/structure/6ZVJ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7A09", "url": "https://www.rcsb.org/structure/7A09", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7QP6", "url": "https://www.rcsb.org/structure/7QP6", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7QP7", "url": "https://www.rcsb.org/structure/7QP7", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF01398", "url": "http://pfam.xfam.org/family/PF01398", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF13012", "url": "http://pfam.xfam.org/family/PF13012", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "O00303", "url": "https://pharos.nih.gov/targets/O00303", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_O00303", "url": "http://purl.obolibrary.org/obo/PR_O00303", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-156827", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156827", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-72649", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72649", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-72689", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72689", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-72695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72695", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-72702", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72702", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-72706", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72706", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_003745", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003745", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A1W2PP79", "url": "https://www.uniprot.org/uniprot/A0A1W2PP79", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1W2PP79-1", "url": "https://www.uniprot.org/uniprot/A0A1W2PP79-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V4S2", "url": "https://www.uniprot.org/uniprot/A0A7I2V4S2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V4S2-1", "url": "https://www.uniprot.org/uniprot/A0A7I2V4S2-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2YQA0", "url": "https://www.uniprot.org/uniprot/A0A7I2YQA0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2YQA0-1", "url": "https://www.uniprot.org/uniprot/A0A7I2YQA0-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E9PQV8", "url": "https://www.uniprot.org/uniprot/E9PQV8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E9PQV8-1", "url": "https://www.uniprot.org/uniprot/E9PQV8-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YDT6", "url": "https://www.uniprot.org/uniprot/H0YDT6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YDT6-1", "url": "https://www.uniprot.org/uniprot/H0YDT6-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O00303", "url": "https://www.uniprot.org/uniprot/O00303", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O00303-1", "url": "https://www.uniprot.org/uniprot/O00303-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MATPAVPVSAPPATPTPVPAAAPASVPAPTPAPAAAPVPAAAPASSSDPAAAAAATAAPGQTPASAQAPAQTPAPALPGPALPGPFPGGRVVRLHPVILASIVDSYERRNEGAARVIGTLLGTVDKHSVEVTNCFSVPHNESEDEVAVDMEFAKNMYELHKKVSPNELILGWYATGHDITEHSVLIHEYYSREAPNPIHLTVDTSLQNGRMSIKAYVSTLMGVPGRTMGVMFTPLTVKYAYYDTERIGVDLIMKTCFSPNRVIGLSSDLQQVGGASARIQDALSTVLQYAEDVLSGKVSADNTVGRFLMSLVNQVPKIVPDDFETMLNSNINDLLMVTYLANLTQSQIALNEKLVNL", "length": 357, "header": "sp|O00303-1|EIF3F_HUMAN Isoform 1 of Eukaryotic translation initiation factor 3 subunit F OS=Homo sapiens OX=9606 GN=EIF3F PE=1 SV=1 CANONICAL=O00303-1" }, "isoforms": [ { "isoform_ac": "A0A1W2PP79-1", "url": "", "sequence": { "sequence": "MATPAVPVSAPPATPTPVPAAAPASVPAPTPAPAAAPVPAAAPASSSDPAAAAAATAAPGQTPASAQAPAQTPAPALPGPALPGPFPGGRVVRLHPVILASIVDSYERRNEGAARVIGTLLGTVDKHSVEVTNCFSVPHNESEDEVSGNPSCPSAVFSCSFARLPSRSLPHS", "length": 172, "header": "tr|A0A1W2PP79-1|A0A1W2PP79_HUMAN Computationally mapped isoform of Eukaryotic translation initiation factor 3 subunit F OS=Homo sapiens OX=9606 GN=EIF3F PE=1 SV=2 CANONICAL=O00303-1" }, "locus": { "chromosome": "11", "start_pos": 7991932, "end_pos": 7987353, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000640290.2", "url": "https://www.ensembl.org/id/ENST00000640290.2" }, { "database": "Ensembl Peptide", "id": "ENSP00000491198.2", "url": "https://www.ensembl.org/id/ENSP00000491198.2" } ] } }, { "isoform_ac": "A0A7I2V4S2-1", "url": "", "sequence": { "sequence": "MATPAVPVSAPPATPTPVPAAAPASVPAPTPAPAAAPVPAAAPASSSDPAAAAAATAAPGQTPASAQAPAQTPAPALPGPALPGPFPGGRVVRLHPVILASIVDSYERRNEGAARVIGTLLGGC", "length": 124, "header": "tr|A0A7I2V4S2-1|EIF3F_HUMAN Computationally mapped isoform of Eukaryotic translation initiation factor 3 subunit F OS=Homo sapiens OX=9606 GN=EIF3F PE=1 SV=1 CANONICAL=O00303-1" }, "locus": { "chromosome": "11", "start_pos": 7992091, "end_pos": 7987353, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000678993.1", "url": "https://www.ensembl.org/id/ENST00000678993.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000504201.1", "url": "https://www.ensembl.org/id/ENSP00000504201.1" } ] } }, { "isoform_ac": "A0A7I2YQA0-1", "url": "", "sequence": { "sequence": "MATPAVPVSAPPATPTPVPAAAPASVPAPTPAPAAAPVPAAAPASSSDPAAAAAATAAPGQTPASAQAPAQTPAPALPGPALPGPFPGGRVVRLHPVILASIVDSYERRNEGAARVIGTLLGTVDKHSVEVTNCFSVPHNESEDEVAVDMEFAKNMYELHKKVSPNELILGWYATGHDITEHSVLIHEYYSREAPNPIHLTVDTSLQNGRMSIKAYVR", "length": 218, "header": "tr|A0A7I2YQA0-1|EIF3F_HUMAN Computationally mapped isoform of Eukaryotic translation initiation factor 3 subunit F OS=Homo sapiens OX=9606 GN=EIF3F PE=1 SV=1 CANONICAL=O00303-1" }, "locus": { "chromosome": "11", "start_pos": 7994103, "end_pos": 7987353, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000677121.1", "url": "https://www.ensembl.org/id/ENST00000677121.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000503130.1", "url": "https://www.ensembl.org/id/ENSP00000503130.1" } ] } }, { "isoform_ac": "E9PQV8-1", "url": "", "sequence": { "sequence": "MATPAVPCRTMSQKMKWLLTWNLLRICMNCIKKFLQMSSSWAGTLRAMTSQSTLC", "length": 55, "header": "tr|E9PQV8-1|EIF3F_HUMAN Computationally mapped isoform of Eukaryotic translation initiation factor 3 subunit F OS=Homo sapiens OX=9606 GN=EIF3F PE=1 SV=2 CANONICAL=O00303-1" }, "locus": { "chromosome": "11", "start_pos": 7992924, "end_pos": 7987353, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000531329.6", "url": "https://www.ensembl.org/id/ENST00000531329.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000432489.2", "url": "https://www.ensembl.org/id/ENSP00000432489.2" } ] } }, { "isoform_ac": "H0YDT6-1", "url": "", "sequence": { "sequence": "MATPAVPVSAPPATPTPVPAAAPASVPAPTPAPAAAPVPAAAPASSSDPAAAAAATAAPGQTPASAQAPAQTPAPALPGPALPGPFPGGRVVRLHPVILASIVDSYERRNEGAARVIGTLLGTVDKHSVEVTNCFSVPHNESEDEVAVDMEFAKNMYELHKKVSPNELILGWYATGHDITEHSVLIHEYYSREAPNPIHLTVDTSLQNGRMSIKAYVSTLMGVPGRTMGVMFTPLTVKYAYYDTERIGVDLIMKTCFSPNRVIGLSSDLQQVGGASARIQDALSTVLQYAEDVLSGKVSADNTVGRFLMSLVNQVPKIVPDDFETMLNSNINVSALPEPLLAWFLPPPQHIHSNVKRVG", "length": 359, "header": "tr|H0YDT6-1|EIF3F_HUMAN Computationally mapped isoform of Eukaryotic translation initiation factor 3 subunit F OS=Homo sapiens OX=9606 GN=EIF3F PE=1 SV=2 CANONICAL=O00303-1" }, "locus": { "chromosome": "11", "start_pos": 7995448, "end_pos": 7987353, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000531572.2", "url": "https://www.ensembl.org/id/ENST00000531572.2" }, { "database": "Ensembl Peptide", "id": "ENSP00000434286.2", "url": "https://www.ensembl.org/id/ENSP00000434286.2" } ] } }, { "isoform_ac": "O00303-1", "url": "", "sequence": { "sequence": "MATPAVPVSAPPATPTPVPAAAPASVPAPTPAPAAAPVPAAAPASSSDPAAAAAATAAPGQTPASAQAPAQTPAPALPGPALPGPFPGGRVVRLHPVILASIVDSYERRNEGAARVIGTLLGTVDKHSVEVTNCFSVPHNESEDEVAVDMEFAKNMYELHKKVSPNELILGWYATGHDITEHSVLIHEYYSREAPNPIHLTVDTSLQNGRMSIKAYVSTLMGVPGRTMGVMFTPLTVKYAYYDTERIGVDLIMKTCFSPNRVIGLSSDLQQVGGASARIQDALSTVLQYAEDVLSGKVSADNTVGRFLMSLVNQVPKIVPDDFETMLNSNINDLLMVTYLANLTQSQIALNEKLVNL", "length": 357, "header": "sp|O00303-1|EIF3F_HUMAN Isoform 1 of Eukaryotic translation initiation factor 3 subunit F OS=Homo sapiens OX=9606 GN=EIF3F PE=1 SV=1 CANONICAL=O00303-1" }, "locus": { "chromosome": "11", "start_pos": 7996019, "end_pos": 7987353, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000533626.5", "url": "https://www.ensembl.org/id/ENST00000533626.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000431800.1", "url": "https://www.ensembl.org/id/ENSP00000431800.1" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "evidence": [ { "id": "O00303", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O00303" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "34725712", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725712" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "36580660", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/36580660" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "28510447", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28510447" }, { "id": "34229054", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34229054" } ] } ], "phosphorylation": [ { "start_pos": 119, "end_pos": 119, "kinase_uniprot_canonical_ac": "P21127-1", "kinase_gene_name": "CDK11B", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O00303", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O00303" }, { "database": "PubMed", "id": "19245811", "url": "https://glygen.org/publication/PubMed/19245811" } ], "site_lbl": "Thr119" }, { "start_pos": 119, "end_pos": 119, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "IntAct", "id": "O00303", "url": "https://www.ebi.ac.uk/intact/interactors/id:O00303*" }, { "database": "iPTMnet", "id": "O00303", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O00303" }, { "database": "PubMed", "id": "19245811", "url": "https://glygen.org/publication/PubMed/19245811" }, { "database": "PRO", "id": "O00303", "url": "http://purl.obolibrary.org/obo/O00303" } ], "site_lbl": "Thr119" }, { "start_pos": 216, "end_pos": 216, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O00303", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O00303" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Tyr216" }, { "start_pos": 255, "end_pos": 255, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O00303", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O00303" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "phospho.ELM", "id": "O00303", "url": "http://phospho.elm.eu.org/byAccession/O00303.html" } ], "site_lbl": "Thr255" }, { "start_pos": 258, "end_pos": 258, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O00303", "url": "https://www.uniprot.org/uniprot/O00303" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "PubMed", "id": "17322308", "url": "https://glygen.org/publication/PubMed/17322308" }, { "database": "UniProtKB", "id": "H0YDT6", "url": "https://www.uniprot.org/uniprot/H0YDT6" }, { "database": "iPTMnet", "id": "O00303", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O00303" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "phospho.ELM", "id": "O00303", "url": "http://phospho.elm.eu.org/byAccession/O00303.html" } ], "site_lbl": "Ser258" }, { "start_pos": 46, "end_pos": 46, "kinase_uniprot_canonical_ac": "P21127-1", "kinase_gene_name": "CDK11B", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O00303", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O00303" }, { "database": "PubMed", "id": "12446680", "url": "https://glygen.org/publication/PubMed/12446680" } ], "site_lbl": "Ser46" }, { "start_pos": 46, "end_pos": 46, "kinase_uniprot_canonical_ac": "Q9BWU1-1", "kinase_gene_name": "CDK19", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O00303", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O00303" }, { "database": "PubMed", "id": "12446680", "url": "https://glygen.org/publication/PubMed/12446680" } ], "site_lbl": "Ser46" }, { "start_pos": 46, "end_pos": 46, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by CDK11; in vitro", "evidence": [ { "database": "UniProtKB", "id": "O00303", "url": "https://www.uniprot.org/uniprot/O00303" }, { "database": "IntAct", "id": "O00303", "url": "https://www.ebi.ac.uk/intact/interactors/id:O00303*" }, { "database": "iPTMnet", "id": "O00303", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O00303" }, { "database": "PubMed", "id": "19245811", "url": "https://glygen.org/publication/PubMed/19245811" }, { "database": "phospho.ELM", "id": "O00303", "url": "http://phospho.elm.eu.org/byAccession/O00303.html" }, { "database": "PubMed", "id": "12446680", "url": "https://glygen.org/publication/PubMed/12446680" }, { "database": "PRO", "id": "O00303", "url": "http://purl.obolibrary.org/obo/O00303" } ], "site_lbl": "Ser46" } ], "glycation": [], "keywords": [ "enzyme", "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "Ded1p, a DEAD-box protein required for translation initiation in Saccharomyces cerevisiae, is an RNA helicase.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Iost I, Dreyfus M, Linder P", "evidence": [ { "database": "Reactome", "id": "R-HSA-72702", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72702" } ], "reference": [ { "type": "PubMed", "id": "10364207", "url": "https://glygen.org/publication/PubMed/10364207" } ] }, { "title": "The joining of ribosomal subunits in eukaryotes requires eIF5B.", "journal": "Nature", "date": "2000", "authors": "Pestova TV, Lomakin IB, Lee JH, Choi SK, Dever TE, Hellen CU", "evidence": [ { "database": "Reactome", "id": "R-HSA-72706", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72706" } ], "reference": [ { "type": "PubMed", "id": "10659855", "url": "https://glygen.org/publication/PubMed/10659855" } ] }, { "title": "Purification and characterization of homogeneous initiation factor M2A from rabbit reticulocytes.", "journal": "The Journal of biological chemistry", "date": "1975", "authors": "Merrick WC, Kemper WM, Anderson WF", "evidence": [ { "database": "Reactome", "id": "R-HSA-72706", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72706" } ], "reference": [ { "type": "PubMed", "id": "1095581", "url": "https://glygen.org/publication/PubMed/1095581" } ] }, { "title": "A multifactor complex of eukaryotic initiation factors, eIF1, eIF2, eIF3, eIF5, and initiator tRNA(Met) is an important translation initiation intermediate in vivo.", "journal": "Genes & development", "date": "2000", "authors": "Asano K, Clayton J, Shalev A, Hinnebusch AG", "evidence": [ { "database": "Reactome", "id": "R-HSA-72706", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72706" } ], "reference": [ { "type": "PubMed", "id": "11018020", "url": "https://glygen.org/publication/PubMed/11018020" } ] }, { "title": "Binding of MET-TRNAf and GTP to homogeneous initiation factor MP.", "journal": "The Journal of biological chemistry", "date": "1975", "authors": "Safer B, Adams SL, Anderson WF, Merrick WC", "evidence": [ { "database": "Reactome", "id": "R-HSA-72695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72695" } ], "reference": [ { "type": "PubMed", "id": "1104615", "url": "https://glygen.org/publication/PubMed/1104615" } ] }, { "title": "The p34cdc2-related cyclin-dependent kinase 11 interacts with the p47 subunit of eukaryotic initiation factor 3 during apoptosis.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Shi J, Feng Y, Goulet AC, Vaillancourt RR, Sachs NA, Hershey JW, Nelson MA", "evidence": [ { "database": "UniProtKB", "id": "O00303", "url": "https://www.uniprot.org/uniprot/O00303" }, { "database": "iPTMnet", "id": "O00303", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O00303" } ], "reference": [ { "type": "PubMed", "id": "12446680", "url": "https://glygen.org/publication/PubMed/12446680" } ] }, { "title": "Mammalian translation initiation factor eIF1 functions with eIF1A and eIF3 in the formation of a stable 40 S preinitiation complex.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Majumdar R, Bandyopadhyay A, Maitra U", "evidence": [ { "database": "Reactome", "id": "R-HSA-72689", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72689" } ], "reference": [ { "type": "PubMed", "id": "12493757", "url": "https://glygen.org/publication/PubMed/12493757" } ] }, { "title": "Transcript-selective translational silencing by gamma interferon is directed by a novel structural element in the ceruloplasmin mRNA 3' untranslated region.", "journal": "Molecular and cellular biology", "date": "2003", "authors": "Sampath P, Mazumder B, Seshadri V, Fox PL", "evidence": [ { "database": "Reactome", "id": "R-HSA-156827", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156827" } ], "reference": [ { "type": "PubMed", "id": "12588972", "url": "https://glygen.org/publication/PubMed/12588972" } ] }, { "title": "Regulated release of L13a from the 60S ribosomal subunit as a mechanism of transcript-specific translational control.", "journal": "Cell", "date": "2003", "authors": "Mazumder B, Sampath P, Seshadri V, Maitra RK, DiCorleto PE, Fox PL", "evidence": [ { "database": "Reactome", "id": "R-HSA-156827", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156827" } ], "reference": [ { "type": "PubMed", "id": "14567916", "url": "https://glygen.org/publication/PubMed/14567916" } ] }, { "title": "Binding of eukaryotic initiation factor 3 to ribosomal 40S subunits and its role in ribosomal dissociation and anti-association.", "journal": "RNA", "date": "2005", "authors": "Kolupaeva VG, Unbehaun A, Lomakin IB, Hellen CU, Pestova TV", "evidence": [ { "database": "UniProtKB", "id": "O00303", "url": "https://www.uniprot.org/uniprot/O00303" } ], "reference": [ { "type": "PubMed", "id": "15703437", "url": "https://glygen.org/publication/PubMed/15703437" } ] }, { "title": "mTOR and S6K1 mediate assembly of the translation preinitiation complex through dynamic protein interchange and ordered phosphorylation events.", "journal": "Cell", "date": "2005", "authors": "Holz MK, Ballif BA, Gygi SP, Blenis J", "evidence": [ { "database": "UniProtKB", "id": "O00303", "url": "https://www.uniprot.org/uniprot/O00303" } ], "reference": [ { "type": "PubMed", "id": "16286006", "url": "https://glygen.org/publication/PubMed/16286006" } ] }, { "title": "Structural roles for human translation factor eIF3 in initiation of protein synthesis.", "journal": "Science", "date": "2005", "authors": "Siridechadilok Bunpote, Fraser Christopher S, Hall Richard J, Doudna Jennifer A, Nogales Eva", "evidence": [ { "database": "UniProtKB", "id": "O00303", "url": "https://www.uniprot.org/uniprot/O00303" } ], "reference": [ { "type": "PubMed", "id": "16322461", "url": "https://glygen.org/publication/PubMed/16322461" } ] }, { "title": "Translation initiation factor eIF4G-1 binds to eIF3 through the eIF3e subunit.", "journal": "J. Biol. Chem.", "date": "2006", "authors": "LeFebvre Aaron K, Korneeva Nadejda L, Trutschl Marjan, Cvek Urska, Duzan Roy D, Bradley Christopher A, Hershey John W B, Rhoads Robert E", "evidence": [ { "database": "UniProtKB", "id": "O00303", "url": "https://www.uniprot.org/uniprot/O00303" } ], "reference": [ { "type": "PubMed", "id": "16766523", "url": "https://glygen.org/publication/PubMed/16766523" } ] }, { "title": "Structural characterization of the human eukaryotic initiation factor 3 protein complex by mass spectrometry.", "journal": "Molecular & cellular proteomics : MCP", "date": "2007", "authors": "Damoc E, Fraser CS, Zhou M, Videler H, Mayeur GL, Hershey JW, Doudna JA, Robinson CV, Leary JA", "evidence": [ { "database": "UniProtKB", "id": "O00303", "url": "https://www.uniprot.org/uniprot/O00303" }, { "database": "iPTMnet", "id": "O00303", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O00303" } ], "reference": [ { "type": "PubMed", "id": "17322308", "url": "https://glygen.org/publication/PubMed/17322308" } ] }, { "title": "Reconstitution reveals the functional core of mammalian eIF3.", "journal": "The EMBO journal", "date": "2007", "authors": "Masutani M, Sonenberg N, Yokoyama S, Imataka H", "evidence": [ { "database": "UniProtKB", "id": "O00303", "url": "https://www.uniprot.org/uniprot/O00303" } ], "reference": [ { "type": "PubMed", "id": "17581632", "url": "https://glygen.org/publication/PubMed/17581632" } ] }, { "title": "Function of eukaryotic initiation factor 5 in the formation of an 80 S ribosomal polypeptide chain initiation complex.", "journal": "The Journal of biological chemistry", "date": "1991", "authors": "Chakrabarti A, Maitra U", "evidence": [ { "database": "Reactome", "id": "R-HSA-72706", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72706" } ], "reference": [ { "type": "PubMed", "id": "1856230", "url": "https://glygen.org/publication/PubMed/1856230" } ] }, { "title": "Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "2008", "authors": "Zhou M, Sandercock AM, Fraser CS, Ridlova G, Stephens E, Schenauer MR, Yokoi-Fong T, Barsky D, Leary JA, Hershey JW, Doudna JA, Robinson CV", "evidence": [ { "database": "UniProtKB", "id": "O00303", "url": "https://www.uniprot.org/uniprot/O00303" } ], "reference": [ { "type": "PubMed", "id": "18599441", "url": "https://glygen.org/publication/PubMed/18599441" } ] }, { "title": "A quantitative atlas of mitotic phosphorylation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2008", "authors": "Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP", "evidence": [ { "database": "UniProtKB", "id": "O00303", "url": "https://www.uniprot.org/uniprot/O00303" }, { "database": "iPTMnet", "id": "O00303", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O00303" } ], "reference": [ { "type": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" } ] }, { "title": "Phosphorylation of the eukaryotic initiation factor 3f by cyclin-dependent kinase 11 during apoptosis.", "journal": "FEBS letters", "date": "2009", "authors": "Shi J, Hershey JW, Nelson MA", "evidence": [ { "database": "iPTMnet", "id": "O00303", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O00303" } ], "reference": [ { "type": "PubMed", "id": "19245811", "url": "https://glygen.org/publication/PubMed/19245811" } ] }, { "title": "Lysine acetylation targets protein complexes and co-regulates major cellular functions.", "journal": "Science (New York, N.Y.)", "date": "2009", "authors": "Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M", "evidence": [ { "database": "UniProtKB", "id": "O00303", "url": "https://www.uniprot.org/uniprot/O00303" } ], "reference": [ { "type": "PubMed", "id": "19608861", "url": "https://glygen.org/publication/PubMed/19608861" } ] }, { "title": "The TRC8 ubiquitin ligase is sterol regulated and interacts with lipid and protein biosynthetic pathways.", "journal": "Mol. Cancer Res.", "date": "2010", "authors": "Lee JP, Brauweiler A, Rudolph M, Hooper JE, Drabkin HA, Gemmill RM", "evidence": [ { "database": "UniProtKB", "id": "O00303", "url": "https://www.uniprot.org/uniprot/O00303" } ], "reference": [ { "type": "PubMed", "id": "20068067", "url": "https://glygen.org/publication/PubMed/20068067" } ] }, { "title": "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.", "journal": "Science signaling", "date": "2010", "authors": "Olsen JV, Vermeulen M, Santamaria A, Kumar C, Miller ML, Jensen LJ, Gnad F, Cox J, Jensen TS, Nigg EA, Brunak S, Mann M", "evidence": [ { "database": "iPTMnet", "id": "O00303", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O00303" } ], "reference": [ { "type": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ] }, { "title": "The translation initiation factor 3f (eIF3f) exhibits a deubiquitinase activity regulating Notch activation.", "journal": "PLoS biology", "date": "2010-11-23", "authors": "Moretti Julien, Chastagner Patricia, Gastaldello Stefano, Heuss Sara F, Dirac Annette M, Bernards Ren\u00e9, Masucci Maria G, Isra\u00ebl Alain, Brou Christel", "evidence": [ { "database": "UniProtKB", "id": "O00303", "url": "https://www.uniprot.org/uniprot/O00303" } ], "reference": [ { "type": "PubMed", "id": "21124883", "url": "https://glygen.org/publication/PubMed/21124883" } ] }, { "title": "Toward a comprehensive characterization of a human cancer cell phosphoproteome.", "journal": "Journal of proteome research", "date": "2013", "authors": "Zhou H, Di Palma S, Preisinger C, Peng M, Polat AN, Heck AJ, Mohammed S", "evidence": [ { "database": "UniProtKB", "id": "O00303", "url": "https://www.uniprot.org/uniprot/O00303" }, { "database": "iPTMnet", "id": "O00303", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O00303" } ], "reference": [ { "type": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" } ] }, { "title": "Proteome wide purification and identification of O-GlcNAc-modified proteins using click chemistry and mass spectrometry.", "journal": "Journal of proteome research", "date": "2013", "authors": "Hahne H, Sobotzki N, Nyberg T, Helm D, Borodkin VS, van Aalten DM, Agnew B, Kuster B", "evidence": [ { "database": "O-GlcNAc Database", "id": "O00303", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O00303" } ], "reference": [ { "type": "PubMed", "id": "23301498", "url": "https://glygen.org/publication/PubMed/23301498" } ] }, { "title": "eIF3 targets cell-proliferation messenger RNAs for translational activation or repression.", "journal": "Nature", "date": "2015-06-04", "authors": "Lee Amy S Y, Kranzusch Philip J, Cate Jamie H D", "evidence": [ { "database": "UniProtKB", "id": "O00303", "url": "https://www.uniprot.org/uniprot/O00303" } ], "reference": [ { "type": "PubMed", "id": "25849773", "url": "https://glygen.org/publication/PubMed/25849773" } ] }, { "title": "eIF3d is an mRNA cap-binding protein that is required for specialized translation initiation.", "journal": "Nature", "date": "2016", "authors": "Lee AS, Kranzusch PJ, Doudna JA, Cate JH", "evidence": [ { "database": "UniProtKB", "id": "O00303", "url": "https://www.uniprot.org/uniprot/O00303" } ], "reference": [ { "type": "PubMed", "id": "27462815", "url": "https://glygen.org/publication/PubMed/27462815" } ] }, { "title": "Synthesis of a Highly Azide-Reactive and Thermosensitive Biofunctional Reagent for Efficient Enrichment and Large-Scale Identification of O-GlcNAc Proteins by Mass Spectrometry.", "journal": "Analytical chemistry", "date": "2017", "authors": "Zhang W, Liu T, Dong H, Bai H, Tian F, Shi Z, Chen M, Wang J, Qin W, Qian X", "evidence": [ { "database": "O-GlcNAc Database", "id": "O00303", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O00303" } ], "reference": [ { "type": "PubMed", "id": "28510447", "url": "https://glygen.org/publication/PubMed/28510447" } ] }, { "title": "Quantifying the contribution of recessive coding variation to developmental disorders.", "journal": "Science (New York, N.Y.)", "date": "2018", "authors": "Martin HC, Jones WD, McIntyre R, Sanchez-Andrade G, Sanderson M, Stephenson JD, Jones CP, Handsaker J, Gallone G, Bruntraeger M, McRae JF, Prigmore E, Short P, Niemi M, Kaplanis J, Radford EJ, Akawi N, Balasubramanian M, Dean J, Horton R, Hulbert A, Johnson DS, Johnson K, Kumar D, Lynch SA, Mehta SG, Morton J, Parker MJ, Splitt M, Turnpenny PD, Vasudevan PC, Wright M, Bassett A, Gerety SS, Wright CF, FitzPatrick DR, Firth HV, Hurles ME, Barrett JC", "evidence": [ { "database": "UniProtKB", "id": "O00303", "url": "https://www.uniprot.org/uniprot/O00303" } ], "reference": [ { "type": "PubMed", "id": "30409806", "url": "https://glygen.org/publication/PubMed/30409806" } ] }, { "title": "Nuclear control of lung cancer cells migration, invasion and bioenergetics by eukaryotic translation initiation factor 3F.", "journal": "Oncogene", "date": "2020", "authors": "Esteves P, Dard L, Brillac A, Hubert C, Sarlak S, Rousseau B, Dumon E, Izotte J, Bonneu M, Lacombe D, Dupuy JW, Amoedo N, Rossignol R", "evidence": [ { "database": "RefSeq", "id": "NP_003745", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003745" } ], "reference": [ { "type": "PubMed", "id": "31527668", "url": "https://glygen.org/publication/PubMed/31527668" } ] }, { "title": "Engineering a Proximity-Directed O-GlcNAc Transferase for Selective Protein O-GlcNAcylation in Cells.", "journal": "ACS chemical biology", "date": "2020", "authors": "Ramirez DH, Aonbangkhen C, Wu HY, Naftaly JA, Tang S, O'Meara TR, Woo CM", "evidence": [ { "database": "O-GlcNAc Database", "id": "O00303", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O00303" } ], "reference": [ { "type": "PubMed", "id": "32119511", "url": "https://glygen.org/publication/PubMed/32119511" } ] }, { "title": "EIF3F-related neurodevelopmental disorder: refining the phenotypic and expanding the molecular spectrum.", "journal": "Orphanet journal of rare diseases", "date": "2021", "authors": "Huffmeier U, Kraus C, Reuter MS, Uebe S, Abbott MA, Ahmed SA, Rawson KL, Barr E, Li H, Bruel AL, Faivre L, Tran Mau-Them F, Botti C, Brooks S, Burns K, Ward DI, Dutra-Clarke M, Martinez-Agosto JA, Lee H, Nelson SF, Zacher P, Abou Jamra R, Klockner C, McGaughran J, Kohlhase J, Schuhmann S, Moran E, Pappas J, Raas-Rothschild A, Sacoto MJG, Henderson LB, Palculict TB, Mullegama SV, Zghal Elloumi H, Reich A, Schrier Vergano SA, Wahl E, Reis A, Zweier C", "evidence": [ { "database": "RefSeq", "id": "NP_003745", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003745" } ], "reference": [ { "type": "PubMed", "id": "33736665", "url": "https://glygen.org/publication/PubMed/33736665" } ] }, { "title": "O-GlcNAc modification regulates MTA1 transcriptional activity during breast cancer cell genotoxic adaptation.", "journal": "Biochimica et biophysica acta. General subjects", "date": "2021", "authors": "Xie X, Wu Q, Zhang K, Liu Y, Zhang N, Chen Q, Wang L, Li W, Zhang J, Liu Y", "evidence": [ { "database": "O-GlcNAc Database", "id": "O00303", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O00303" } ], "reference": [ { "type": "PubMed", "id": "34019948", "url": "https://glygen.org/publication/PubMed/34019948" } ] }, { "title": "Synthesis of Na2S2O4 mediated cleavable affinity tag for labeling of O-GlcNAc modified proteins via azide-alkyne cycloaddition.", "journal": "Bioorganic & medicinal chemistry letters", "date": "2021", "authors": "Wang J, Dou B, Zheng L, Cao W, Zeng X, Wen Y, Ma J, Li X", "evidence": [ { "database": "O-GlcNAc Database", "id": "O00303", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O00303" } ], "reference": [ { "type": "PubMed", "id": "34229054", "url": "https://glygen.org/publication/PubMed/34229054" } ] }, { "title": "Truncation of the TPR domain of OGT alters substrate and glycosite selection.", "journal": "Analytical and bioanalytical chemistry", "date": "2021", "authors": "Ramirez DH, Yang B, D'Souza AK, Shen D, Woo CM", "evidence": [ { "database": "O-GlcNAc Database", "id": "O00303", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O00303" } ], "reference": [ { "type": "PubMed", "id": "34725712", "url": "https://glygen.org/publication/PubMed/34725712" } ] }, { "title": "Spatiotemporal Activation of Protein O-GlcNAcylation in Living Cells.", "journal": "Journal of the American Chemical Society", "date": "2022", "authors": "He J, Fan Z, Tian Y, Yang W, Zhou Y, Zhu Q, Zhang W, Qin W, Yi W", "evidence": [ { "database": "O-GlcNAc Database", "id": "O00303", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O00303" } ], "reference": [ { "type": "PubMed", "id": "35138101", "url": "https://glygen.org/publication/PubMed/35138101" } ] }, { "title": "Multi-comparative Thermal Proteome Profiling Uncovers New O-GlcNAc Proteins in a System-wide Method.", "journal": "Analytical chemistry", "date": "2022-12-29", "authors": "Wang Guoli, Li Yang, Wang Ting, Wang Jun, Yao Jun, Yan Guoquan, Zhang Ying, Lu Haojie", "evidence": [ { "database": "O-GlcNAc Database", "id": "O00303", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O00303" } ], "reference": [ { "type": "PubMed", "id": "36580660", "url": "https://glygen.org/publication/PubMed/36580660" } ] }, { "title": "eIF3f Mediates SGOC\u00a0Pathway Reprogramming by Enhancing Deubiquitinating Activity in Colorectal Cancer.", "journal": "Advanced science (Weinheim, Baden-Wurttemberg, Germany)", "date": "2023-09", "authors": "Pan Qihao, Yu Fenghai, Jin Huilin, Zhang Peng, Huang Xiaoling, Peng Jingxuan, Xie Xiaoshan, Li Xiangli, Ma Ning, Wei Yue, Wen Weijie, Zhang Jieping, Zhang Boyu, Yu Hongyan, Xiao Yuanxun, Liu Ran-Yi, Liu Qingxin, Meng Xiangqi, Lee Mong-Hong", "evidence": [ { "database": "RefSeq", "id": "NP_003745", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003745" } ], "reference": [ { "type": "PubMed", "id": "37544925", "url": "https://glygen.org/publication/PubMed/37544925" } ] }, { "title": "Binding and release of radiolabeled eukaryotic initiation factors 2 and 3 during 80 S initiation complex formation.", "journal": "The Journal of biological chemistry", "date": "1979", "authors": "Peterson DT, Merrick WC, Safer B", "evidence": [ { "database": "Reactome", "id": "R-HSA-72695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72695" } ], "reference": [ { "type": "PubMed", "id": "429297", "url": "https://glygen.org/publication/PubMed/429297" } ] }, { "title": "Initiation of mammalian protein synthesis. I. Purification and characterization of seven initiation factors.", "journal": "Journal of molecular biology", "date": "1977", "authors": "Schreier MH, Erni B, Staehelin T", "evidence": [ { "database": "Reactome", "id": "R-HSA-72706", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72706" } ], "reference": [ { "type": "PubMed", "id": "592398", "url": "https://glygen.org/publication/PubMed/592398" } ] }, { "title": "Initiation of mammalian protein synthesis. II. The assembly of the initiation complex with purified initiation factors.", "journal": "Journal of molecular biology", "date": "1977", "authors": "Trachsel H, Erni B, Schreier MH, Staehelin T", "evidence": [ { "database": "Reactome", "id": "R-HSA-72649", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72649" } ], "reference": [ { "type": "PubMed", "id": "592399", "url": "https://glygen.org/publication/PubMed/592399" } ] }, { "title": "The mechanism of action of protein synthesis initiation factors from rabbit reticulocytes.", "journal": "The Journal of biological chemistry", "date": "1978", "authors": "Benne R, Hershey JW", "evidence": [ { "database": "Reactome", "id": "R-HSA-72649", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72649" } ], "reference": [ { "type": "PubMed", "id": "641056", "url": "https://glygen.org/publication/PubMed/641056" } ] }, { "title": "New initiation factor activity required for globin mRNA translation.", "journal": "The Journal of biological chemistry", "date": "1983", "authors": "Grifo JA, Tahara SM, Morgan MA, Shatkin AJ, Merrick WC", "evidence": [ { "database": "Reactome", "id": "R-HSA-72649", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72649" } ], "reference": [ { "type": "PubMed", "id": "6853548", "url": "https://glygen.org/publication/PubMed/6853548" } ] }, { "title": "The role of eIF-4C in protein synthesis initiation complex formation.", "journal": "Biochimica et biophysica acta", "date": "1980", "authors": "Goumans H, Thomas A, Verhoeven A, Voorma HO, Benne R", "evidence": [ { "database": "Reactome", "id": "R-HSA-72689", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72689" } ], "reference": [ { "type": "PubMed", "id": "6901506", "url": "https://glygen.org/publication/PubMed/6901506" } ] }, { "title": "Evaluation of the `scanning model` for initiation of protein synthesis in eucaryotes.", "journal": "Cell", "date": "1980", "authors": "Kozak M", "evidence": [ { "database": "Reactome", "id": "R-HSA-72702", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72702" } ], "reference": [ { "type": "PubMed", "id": "7000367", "url": "https://glygen.org/publication/PubMed/7000367" } ] }, { "title": "Functional dissection of eukaryotic initiation factor 4F: the 4A subunit and the central domain of the 4G subunit are sufficient to mediate internal entry of 43S preinitiation complexes.", "journal": "Molecular and cellular biology", "date": "1996", "authors": "Pestova TV, Shatsky IN, Hellen CU", "evidence": [ { "database": "Reactome", "id": "R-HSA-72702", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72702" } ], "reference": [ { "type": "PubMed", "id": "8943342", "url": "https://glygen.org/publication/PubMed/8943342" } ] }, { "title": "Requirement of the DEAD-Box protein ded1p for messenger RNA translation.", "journal": "Science (New York, N.Y.)", "date": "1997", "authors": "Chuang RY, Weaver PL, Liu Z, Chang TH", "evidence": [ { "database": "Reactome", "id": "R-HSA-72702", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72702" } ], "reference": [ { "type": "PubMed", "id": "9045610", "url": "https://glygen.org/publication/PubMed/9045610" } ] }, { "title": "Structure of cDNAs encoding human eukaryotic initiation factor 3 subunits. Possible roles in RNA binding and macromolecular assembly.", "journal": "J. Biol. Chem.", "date": "1997", "authors": "Asano K, Vornlocher HP, Richter-Cook NJ, Merrick WC, Hinnebusch AG, Hershey JW", "evidence": [ { "database": "UniProtKB", "id": "O00303", "url": "https://www.uniprot.org/uniprot/O00303" } ], "reference": [ { "type": "PubMed", "id": "9341143", "url": "https://glygen.org/publication/PubMed/9341143" } ] }, { "title": "Eukaryotic ribosomes require initiation factors 1 and 1A to locate initiation codons.", "journal": "Nature", "date": "1998", "authors": "Pestova TV, Borukhov SI, Hellen CU", "evidence": [ { "database": "Reactome", "id": "R-HSA-72649", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72649" } ], "reference": [ { "type": "PubMed", "id": "9732867", "url": "https://glygen.org/publication/PubMed/9732867" } ] }, { "title": "A newly identified N-terminal amino acid sequence of human eIF4G binds poly(A)-binding protein and functions in poly(A)-dependent translation.", "journal": "The EMBO journal", "date": "1998", "authors": "Imataka H, Gradi A, Sonenberg N", "evidence": [ { "database": "Reactome", "id": "R-HSA-72649", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72649" } ], "reference": [ { "type": "PubMed", "id": "9857202", "url": "https://glygen.org/publication/PubMed/9857202" } ] } ], "pathway": [ { "id": "hsa:8665", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:8665", "resource": "KEGG Pathway" }, { "id": "R-HSA-156827", "name": "L13a-mediated translational silencing of Ceruloplasmin expression", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156827", "resource": "Reactome", "description": "L13a-mediated translational silencing of Ceruloplasmin expression" }, { "id": "R-HSA-72649", "name": "Translation initiation complex formation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72649", "resource": "Reactome", "description": "Translation initiation complex formation" }, { "id": "R-HSA-72689", "name": "Formation of a pool of free 40S subunits", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72689", "resource": "Reactome", "description": "Formation of a pool of free 40S subunits" }, { "id": "R-HSA-72695", "name": "Formation of the ternary complex, and subsequently, the 43S complex", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72695", "resource": "Reactome", "description": "Formation of the ternary complex, and subsequently, the 43S complex" }, { "id": "R-HSA-72702", "name": "Ribosomal scanning and start codon recognition", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72702", "resource": "Reactome", "description": "Ribosomal scanning and start codon recognition" }, { "id": "R-HSA-72706", "name": "GTP hydrolysis and joining of the 60S ribosomal subunit", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72706", "resource": "Reactome", "description": "GTP hydrolysis and joining of the 60S ribosomal subunit" } ], "orthologs": [ { "uniprot_canonical_ac": "A0A287ARI1-1", "protein_name": "Eukaryotic translation initiation factor 3 subunit F", "gene_name": "EIF3F", "tax_id": 9823, "organism": "Sus scrofa", "sequence": { "sequence": "MAAPAVPASAPPATPAPAPAPAPVPAAASAPAPAPASASAPAPAAAPAPVPAAAPAPASSSDPAAAAAATPAARTPAPSLPGPALPGPFPGGRVVRLHPVILASIVDSYERRNEGAARVIGTLLGTVDKHSVEVTNCFSVPHNESEDEVAVDMEFAKNMYELHKKVSPNELILAGEWYATGHDITEHSVLIHEYYSRESGRMSIKAYVSTLMGVPGRTMGVMFTPLTVKYAYYDTERIGVDLIMKTCFSPNRVIGLSSDLQQVGGASARIQDALSTVLQYAEDVLSGKVAADNTVGRFLMSLVNQVPKIVPEDFETMLNSNINDLLMVTYLANLTQSQIALNEKLVNL", "length": 348 }, "evidence": [ { "id": "O00303", "url": "https://omabrowser.org/oma/group/O00303/", "database": "OMA" } ], "common_name": "Pig" }, { "uniprot_canonical_ac": "D4AC36-1", "protein_name": "Eukaryotic translation initiation factor 3 subunit F", "gene_name": "Eif3f", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MASPAVPASVPPATAAAAPAPAVTSAPASAPTPPTPAPAQAATPAAAPAPVSSDPAVATPAAPGQTSTSTPAPAQTPAPSQPGPALPGPFPGGRVVRLHPVILASIVDSYERRNEGAARVIGTLLGTVDKHSVEVTNCFSVPHNESEDEVAVDMEFAKNMYELHKKVSPNELILGWYATGHDITEHSVLIHEYYSREAPNPIHLTVDTGLQNGRMSIKAYVSTLMGVPGRTMGVMFTPLTVKYAYYDTERIGVDLIMKTCFSPNRVIGLSSDLQQVGGASARIQDALSTVLQYAEDVLSGKVSADNTVGRFLMSLVNQVPKIVPDDFETMLNSNINDLLMVTYLANLTQSQIALNEKLVNL", "length": 361 }, "evidence": [ { "id": "45922812", "url": "http://www.informatics.jax.org/homology/45922812", "database": "MGI" }, { "id": "O00303", "url": "https://omabrowser.org/oma/group/O00303/", "database": "OMA" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q9DCH4-1", "protein_name": "Eukaryotic translation initiation factor 3 subunit F", "gene_name": "Eif3f", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MASPAVPANVPPATAAAAPAPVVTAAPASAPTPSTPAPTPAATPAASPAPVSSDPAVAAPAAPGQTPASAPAPAQTPAPSQPGPALPGPFPGGRVVRLHPVILASIVDSYERRNEGAARVIGTLLGTVDKHSVEVTNCFSVPHNESEDEVAVDMEFAKNMYELHKKVSPNELILGWYATGHDITEHSVLIHEYYSREAPNPIHLTVDTGLQHGRMSIKAYVSTLMGVPGRTMGVMFTPLTVKYAYYDTERIGVDLIMKTCFSPNRVIGLSSDLQQVGGASARIQDALSTVLQYAEDVLSGKVSADNTVGRFLMSLVNQVPKIVPDDFETMLNSNINDLLMVTYLANLTQSQIALNEKLVNL", "length": 361 }, "evidence": [ { "id": "45922812", "url": "http://www.informatics.jax.org/homology/45922812", "database": "MGI" }, { "id": "O00303", "url": "https://omabrowser.org/oma/group/O00303/", "database": "OMA" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q9VN50-1", "protein_name": "Eukaryotic translation initiation factor 3 subunit F-1", "gene_name": "eIF3f1", "tax_id": 7227, "organism": "Drosophila melanogaster", "sequence": { "sequence": "MSALNLTVRVHPVVLFQVVDAFERRNADSHRVIGTLLGSVDKGVVEVTNCFCVPHKEHDDQVEAELSYALDMYDLNRKVNSNESVVGWWATGNDVTNHSSVIHEYYARECNNPVHLTVDTSLQGGRMGLRAYVCIQLGVPGGKSGCMFTPIPVELTSYEPETFGLKLLQKTVGVSPAHRPKTVPPMLDLAQISEASTKLQSLLDLILKYVDDVIAHKVTPDNAVGRQLLDLIHSVPHMTHEQFTQMFNANVRNLLLVITLSQLIKTQLQLNEKLTFLPTA", "length": 280 }, "evidence": [ { "id": "O00303", "url": "https://omabrowser.org/oma/group/O00303/", "database": "OMA" } ], "common_name": "Fruit fly" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 5, "go_terms": [ { "name": "IRES-dependent viral translational initiation", "id": "GO:0075522", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0075522", "evidence": [ { "database": "UniProtKB", "id": "O00303", "url": "https://www.uniprot.org/uniprot/O00303" } ], "pmid": "" }, { "name": "proteolysis", "id": "GO:0006508", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006508", "evidence": [ { "database": "UniProtKB", "id": "O00303", "url": "https://www.uniprot.org/uniprot/O00303" } ], "pmid": "" }, { "name": "protein deubiquitination", "id": "GO:0016579", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016579", "evidence": [ { "database": "UniProtKB", "id": "O00303", "url": "https://www.uniprot.org/uniprot/O00303" } ], "pmid": "" }, { "name": "translational initiation", "id": "GO:0006413", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006413", "evidence": [ { "database": "UniProtKB", "id": "O00303", "url": "https://www.uniprot.org/uniprot/O00303" } ], "pmid": "" }, { "name": "formation of cytoplasmic translation initiation complex", "id": "GO:0001732", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001732", "evidence": [ { "database": "UniProtKB", "id": "O00303", "url": "https://www.uniprot.org/uniprot/O00303" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 7, "go_terms": [ { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "O00303", "url": "https://www.uniprot.org/uniprot/O00303" } ], "pmid": "" }, { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "O00303", "url": "https://www.uniprot.org/uniprot/O00303" } ], "pmid": "" }, { "name": "synapse", "id": "GO:0045202", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045202", "evidence": [ { "database": "UniProtKB", "id": "O00303", "url": "https://www.uniprot.org/uniprot/O00303" } ], "pmid": "" }, { "name": "eukaryotic 43S preinitiation complex", "id": "GO:0016282", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016282", "evidence": [ { "database": "UniProtKB", "id": "O00303", "url": "https://www.uniprot.org/uniprot/O00303" } ], "pmid": "" }, { "name": "eukaryotic 48S preinitiation complex", "id": "GO:0033290", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0033290", "evidence": [ { "database": "UniProtKB", "id": "O00303", "url": "https://www.uniprot.org/uniprot/O00303" } ], "pmid": "" }, { "name": "eukaryotic translation initiation factor 3 complex, eIF3m", "id": "GO:0071541", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071541", "evidence": [ { "database": "UniProtKB", "id": "O00303", "url": "https://www.uniprot.org/uniprot/O00303" } ], "pmid": "" }, { "name": "eukaryotic translation initiation factor 3 complex", "id": "GO:0005852", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005852", "evidence": [ { "database": "UniProtKB", "id": "O00303", "url": "https://www.uniprot.org/uniprot/O00303" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 6, "go_terms": [ { "name": "identical protein binding", "id": "GO:0042802", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042802", "evidence": [ { "database": "UniProtKB", "id": "O00303", "url": "https://www.uniprot.org/uniprot/O00303" } ], "pmid": "" }, { "name": "translation initiation factor activity", "id": "GO:0003743", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003743", "evidence": [ { "database": "UniProtKB", "id": "O00303", "url": "https://www.uniprot.org/uniprot/O00303" } ], "pmid": "" }, { "name": "cysteine-type deubiquitinase activity", "id": "GO:0004843", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004843", "evidence": [ { "database": "UniProtKB", "id": "O00303", "url": "https://www.uniprot.org/uniprot/O00303" } ], "pmid": "" }, { "name": "translation initiation factor binding", "id": "GO:0031369", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031369", "evidence": [ { "database": "UniProtKB", "id": "O00303", "url": "https://www.uniprot.org/uniprot/O00303" } ], "pmid": "" }, { "name": "metal-dependent deubiquitinase activity", "id": "GO:0140492", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0140492", "evidence": [ { "database": "UniProtKB", "id": "O00303", "url": "https://www.uniprot.org/uniprot/O00303" } ], "pmid": "" }, { "name": "metallopeptidase activity", "id": "GO:0008237", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008237", "evidence": [ { "database": "UniProtKB", "id": "O00303", "url": "https://www.uniprot.org/uniprot/O00303" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 140, "end_pos": 142, "annotation": "n_glycosylation_sequon" }, { "start_pos": 342, "end_pos": 344, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "Phosphorylation is enhanced upon serum stimulation. Phosphorylated during apoptosis by caspase-processed CDK11.", "evidence": [ { "database": "UniProtKB", "id": "O00303", "url": "https://www.uniprot.org/uniprot/O00303" }, { "database": "PubMed", "id": "17322308", "url": "https://glygen.org/publication/PubMed/17322308" }, { "database": "PubMed", "id": "12446680", "url": "https://glygen.org/publication/PubMed/12446680" } ] } ], "interactions": [], "reactions": [ { "id": "R-HSA-156808", "name": "Formation of translation initiation complexes yielding circularized Ceruloplasmin mRNA in a 'closed-loop' conformation", "equation": "", "summary": "The precise order of events leading to the circularization of poly (A) mRNA during translation initiation is unknown. Here the association of PABP with the poly (A) mRNA and the association of PABP with eIF4F are represented as occuring simultaneously after formation of the initiation complex. However, it is also possible that these interactions occur during the formation of the translation initiation complex. The binding of eIF4F to the cap and binding of PABP to the poly (A) tail, for example, may occur at the same time. In fact, the eIF4G-PABP interaction helps eIF4F to bind tighter to the cap (Borman et al. 2000.) In addition, eIF4B and eIF4H bind more transiently to the mRNA and may not be part of an initial complex in which PABP has not yet touched eIF4G.", "cellular_location": "cytosol", "input_participant_list": [ "R-HSA-156803" ], "output_participant_list": [], "enzyme_list": [ "P60842-1", "P23396-1", "Q14240-1", "P41091-1", "O00303-1" ], "evidence": [ { "id": "R-HSA-156808", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156808" } ] }, { "id": "R-HSA-156823", "name": "Association of phospho-L13a with GAIT element of Ceruloplasmin mRNA", "equation": "", "summary": "Although the mechanism through which L13a prevents translation initiation has not been determined, Mazumder et al. (2003) have described four alternatives. L13a could (1) inhibit the function of eIF4F, (2) block the recruitment of the 43S preinitiation complex, (3) prevent scanning of the 43S complex to the initiation codon, or 4) interfere with joining of the 60S ribosomal subunit.", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P60842-1", "P23396-1", "Q14240-1", "P41091-1", "O00303-1" ], "evidence": [ { "id": "R-HSA-156823", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156823" } ] }, { "id": "R-HSA-157849", "name": "Formation of translation initiation complexes containing mRNA that does not circularize", "equation": "", "summary": "The translation initiation complex forms when the 43S complex binds the mRNA that is associated with eIF4F, eIF4B and eIF4H. eIF4G in the eIF4F complex can directly contact eIF3 in the 43S complex. eIF1A is necessary for the formation of this complex.", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P60842-1", "P23396-1", "Q14240-1", "P41091-1", "O00303-1" ], "evidence": [ { "id": "R-HSA-157849", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-157849" } ] }, { "id": "R-HSA-72619", "name": "eIF2:GTP is hydrolyzed, eIFs are released", "equation": "", "summary": "Once the Met-tRNAi has recognized the AUG, eIF2-bound GTP is hydrolyzed. The reaction is catalyzed by eIF5 (or eIF5B) and is thought to cause dissociation of all other initiation factors and allow joining of the large 60S ribosomal subunit. Release of the initiation factors from 40S leaves the Met-tRNAi in the ribosomal P-site base-paired to the start codon on the mRNA.", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [ "R-HSA-72555", "R-HSA-72591" ], "enzyme_list": [ "P60842-1", "P23396-1", "Q14240-1", "P41091-1", "O00303-1" ], "evidence": [ { "id": "R-HSA-72619", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72619" } ] }, { "id": "R-HSA-72621", "name": "Ribosomal scanning", "equation": "", "summary": "The mRNA-bound ribosomal complex moves along the 5'-untranslated region (5'-UTR) of the mRNA from its initial site to the initiation codon to form a 48S complex, in which the initiation codon (AUG) is base paired to the anticodon of the Met-tRNAi. It is not known whether eIF4A (or another ATPase, such as DED1) facilitates scanning by melting mRNA secondary structures or by actively propelling the ribosome.", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P60842-1", "P23396-1", "Q14240-1", "P41091-1", "O00303-1" ], "evidence": [ { "id": "R-HSA-72621", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72621" } ] }, { "id": "R-HSA-72676", "name": "eIF3 and eIF1A bind to the 40S subunit", "equation": "", "summary": "eIF3 and eIF1A bind to the 40S ribosomal subunit.", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P23396-1", "O00303-1" ], "evidence": [ { "id": "R-HSA-72676", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72676" } ] }, { "id": "R-HSA-72691", "name": "Formation of the 43S pre-initiation complex", "equation": "", "summary": "The ternary complex (Met-tRNAi:eIF2:GTP) binds to the complex formed by the 40S subunit, eIF3 and eIF1A, to form the 43S complex. eIF1A promotes binding of the ternary complex to the 40S subunit within 43S. The initiator methionyl-tRNA from the ternary complex is positioned at the ribosomal P site.", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P23396-1", "P41091-1", "O00303-1" ], "evidence": [ { "id": "R-HSA-72691", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72691" } ] }, { "id": "R-HSA-72697", "name": "Start codon recognition", "equation": "", "summary": "The AUG initiation codon in the mRNA is recognized by base pairing with the anticodon of the Met-tRNAi. This reaction requires eIF1, eIF1A, eIF2 and eIF5.", "cellular_location": "cytosol", "input_participant_list": [ "R-ALL-72617", "R-HSA-72557", "R-HSA-72616", "R-HSA-72515" ], "output_participant_list": [ "R-ALL-72700" ], "enzyme_list": [ "P60842-1", "P23396-1", "Q14240-1", "P41091-1", "O00303-1" ], "evidence": [ { "id": "R-HSA-72697", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72697" } ] } ], "reaction_participants": [ { "participant_id": "R-ALL-72617", "participant_name": "eIF1 [cytosol]", "crossref": [ { "id": "36080", "database": "ChEBI", "url": "" }, { "id": "36080", "database": "ChEBI", "url": "" }, { "id": "36080", "database": "ChEBI", "url": "" }, { "id": "36080", "database": "ChEBI", "url": "" }, { "id": "36080", "database": "ChEBI", "url": "" }, { "id": "36080", "database": "ChEBI", "url": "" }, { "id": "36080", "database": "ChEBI", "url": "" } ] }, { "participant_id": "R-ALL-72700", "participant_name": "AUG start codon [nucleoplasm]", "crossref": [ { "id": "82726", "database": "ChEBI", "url": "" } ] }, { "participant_id": "R-HSA-156803", "participant_name": "PABPC1 [cytosol]", "crossref": [ { "id": "P11940", "database": "UniProt", "url": "" }, { "id": "ENST00000520142", "database": "Ensembl", "url": "" }, { "id": "ENST00000523555", "database": "Ensembl", "url": "" }, { "id": "ENSP00000429119", "database": "Ensembl", "url": "" }, { "id": "ENST00000522720", "database": "Ensembl", "url": "" }, { "id": "ENSP00000428749", "database": "Ensembl", "url": "" }, { "id": "ENST00000318607", "database": "Ensembl", "url": "" }, { "id": "4F02", "database": "PDB", "url": "" }, { "id": "3PTH", "database": "PDB", "url": "" }, { "id": "ENSG00000070756-PABPC1", "database": "HPA", "url": "" }, { "id": "ENSG00000070756", "database": "Ensembl", "url": "" }, { "id": "5DX1", "database": "PDB", "url": "" }, { "id": "1CVJ", "database": "PDB", "url": "" }, { "id": "ENST00000520804", "database": "Ensembl", "url": "" }, { "id": "ENSP00000313007", "database": "Ensembl", "url": "" }, { "id": "4F26", "database": "PDB", "url": "" }, { "id": "3KUT", "database": "PDB", "url": "" }, { "id": "XP_005250918.1", "database": "RefSeq", "url": "" }, { "id": "3PKN", "database": "PDB", "url": "" }, { "id": "NP_002559.2", "database": "RefSeq", "url": "" }, { "id": "3KUR", "database": "PDB", "url": "" }, { "id": "3KUS", "database": "PDB", "url": "" }, { "id": "3KUI", "database": "PDB", "url": "" }, { "id": "3KUJ", "database": "PDB", "url": "" }, { "id": "2X04", "database": "PDB", "url": "" }, { "id": "7BN3", "database": "PDB", "url": "" }, { "id": "3KTP", "database": "PDB", "url": "" }, { "id": "3KTR", "database": "PDB", "url": "" }, { "id": "P11940", "database": "GeneCards", "url": "" }, { "id": "1JH4", "database": "PDB", "url": "" }, { "id": "5LGQ", "database": "PDB", "url": "" }, { "id": "5LGR", "database": "PDB", "url": "" }, { "id": "P11940", "database": "Pharos - Targets", "url": "" }, { "id": "2K8G", "database": "PDB", "url": "" }, { "id": "5LGS", "database": "PDB", "url": "" }, { "id": "2RQG", "database": "PDB", "url": "" }, { "id": "2RQH", "database": "PDB", "url": "" }, { "id": "5DX8", "database": "PDB", "url": "" }, { "id": "1G9L", "database": "PDB", "url": "" }, { "id": "1JGN", "database": "PDB", "url": "" }, { "id": "5DXA", "database": "PDB", "url": "" }, { "id": "P11940", "database": "PRO", "url": "" }, { "id": "ENSG00000070756", "database": "OpenTargets", "url": "" }, { "id": "5LGP", "database": "PDB", "url": "" }, { "id": "ENSP00000429790", "database": "Ensembl", "url": "" }, { "id": "ENSP00000430012", "database": "Ensembl", "url": "" }, { "id": "4F25", "database": "PDB", "url": "" }, { "id": "ENST00000522658", "database": "Ensembl", "url": "" }, { "id": "ENSP00000428840", "database": "Ensembl", "url": "" }, { "id": "ENSP00000429892", "database": "Ensembl", "url": "" }, { "id": "ENST00000521865", "database": "Ensembl", "url": "" } ] }, { "participant_id": "R-HSA-72515", "participant_name": "EIF2S1:EIF2S2:EIF2S3 [cytosol]", "crossref": [ { "id": "CPX-2716", "database": "ComplexPortal", "url": "" } ] }, { "participant_id": "R-HSA-72555", "participant_name": "eIF3 subunits complex [cytosol]", "crossref": [ { "id": "CPX-6036", "database": "ComplexPortal", "url": "" } ] }, { "participant_id": "R-HSA-72557", "participant_name": "EIF1AX [cytosol]", "crossref": [ { "id": "P47813", "database": "UniProt", "url": "" }, { "id": "7QP6", "database": "PDB", "url": "" }, { "id": "P47813", "database": "PRO", "url": "" }, { "id": "NP_001403.1", "database": "RefSeq", "url": "" }, { "id": "ENSG00000173674-EIF1AX", "database": "HPA", "url": "" }, { "id": "ENST00000379607", "database": "Ensembl", "url": "" }, { "id": "P47813", "database": "Pharos - Targets", "url": "" }, { "id": "P47813", "database": "GeneCards", "url": "" }, { "id": "7SYQ", "database": "PDB", "url": "" }, { "id": "7QP7", "database": "PDB", "url": "" }, { "id": "7TQL", "database": "PDB", "url": "" }, { "id": "6ZP4", "database": "PDB", "url": "" }, { "id": "7A09", "database": "PDB", "url": "" }, { "id": "7SYV", "database": "PDB", "url": "" }, { "id": "4KZY", "database": "PDB", "url": "" }, { "id": "ENSG00000173674", "database": "OpenTargets", "url": "" }, { "id": "4KZZ", "database": "PDB", "url": "" }, { "id": "6YBW", "database": "PDB", "url": "" }, { "id": "23130", "database": "Orphanet", "url": "" }, { "id": "7SYX", "database": "PDB", "url": "" }, { "id": "6ZMW", "database": "PDB", "url": "" }, { "id": "7SYW", "database": "PDB", "url": "" }, { "id": "1D7Q", "database": "PDB", "url": "" }, { "id": "7SYR", "database": "PDB", "url": "" }, { "id": "XP_016855198.1", "database": "RefSeq", "url": "" }, { "id": "3ZJY", "database": "PDB", "url": "" }, { "id": "ENSG00000173674", "database": "Ensembl", "url": "" }, { "id": "ENSP00000368927", "database": "Ensembl", "url": "" }, { "id": "7SYS", "database": "PDB", "url": "" } ] }, { "participant_id": "R-HSA-72591", "participant_name": "EIF4H [cytosol]", "crossref": [ { "id": "ENSG00000106682-EIF4H", "database": "HPA", "url": "" }, { "id": "Q15056", "database": "GeneCards", "url": "" }, { "id": "Q15056", "database": "PRO", "url": "" }, { "id": "ENSP00000504679", "database": "Ensembl", "url": "" }, { "id": "ENSP00000265754", "database": "Ensembl", "url": "" }, { "id": "ENSG00000106682", "database": "Ensembl", "url": "" }, { "id": "ENST00000678438", "database": "Ensembl", "url": "" }, { "id": "Q15056", "database": "UniProt", "url": "" }, { "id": "NP_071496.1", "database": "RefSeq", "url": "" }, { "id": "ENSG00000106682", "database": "OpenTargets", "url": "" }, { "id": "ENST00000353999", "database": "Ensembl", "url": "" }, { "id": "Q15056", "database": "Pharos - Targets", "url": "" }, { "id": "ENST00000265753", "database": "Ensembl", "url": "" }, { "id": "ENSP00000265753", "database": "Ensembl", "url": "" }, { "id": "NP_114381.1", "database": "RefSeq", "url": "" } ] }, { "participant_id": "R-HSA-72616", "participant_name": "EIF5 [cytosol]", "crossref": [ { "id": "P55010", "database": "UniProt", "url": "" }, { "id": "2E9H", "database": "PDB", "url": "" }, { "id": "ENST00000216554", "database": "Ensembl", "url": "" }, { "id": "P55010", "database": "GeneCards", "url": "" }, { "id": "ENST00000558506", "database": "Ensembl", "url": "" }, { "id": "ENSG00000100664", "database": "Ensembl", "url": "" }, { "id": "ENST00000392715", "database": "Ensembl", "url": "" }, { "id": "ENSP00000216554", "database": "Ensembl", "url": "" }, { "id": "ENSP00000376477", "database": "Ensembl", "url": "" }, { "id": "NP_892116.2", "database": "RefSeq", "url": "" }, { "id": "P55010", "database": "Pharos - Targets", "url": "" }, { "id": "ENSG00000100664", "database": "OpenTargets", "url": "" }, { "id": "2IU1", "database": "PDB", "url": "" }, { "id": "ENSP00000453743", "database": "Ensembl", "url": "" }, { "id": "HMDBP08454", "database": "HMDB Protein", "url": "" }, { "id": "P55010", "database": "PRO", "url": "" }, { "id": "ENSG00000100664-EIF5", "database": "HPA", "url": "" }, { "id": "2G2K", "database": "PDB", "url": "" }, { "id": "NP_001960.2", "database": "RefSeq", "url": "" } ] } ], "reaction_enzymes": [ { "uniprot_ac": "O00303", "gene_name": "EIF3F", "activity": [ { "ec_number": "3.4.19.12", "activity": "Thiol-dependent hydrolysis of ester, thioester, amide, peptide and isopeptide bonds formed by the C-terminal Gly of ubiquitin (a 76-residue protein attached to proteins as an intracellular targeting signal).", "evidence": [ { "id": "O00303", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O00303" } ] } ] }, { "uniprot_ac": "P23396", "gene_name": "RPS3", "activity": [ { "ec_number": "4.2.99.18", "activity": "2'-deoxyribonucleotide-(2'-deoxyribose 5'-phosphate)-2'-deoxyribonucleotide-DNA = a 3'-end 2'-deoxyribonucleotide-(2,3-dehydro-2,3-deoxyribose 5'-phosphate)-DNA + a 5'-end 5'-monophospho-2'-deoxyribonucleoside-DNA + H(+).", "evidence": [ { "id": "P23396", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P23396" } ] }, { "ec_number": "4.2.99.18", "activity": "", "evidence": [ { "id": "P23396", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P23396" } ] } ] }, { "uniprot_ac": "P41091", "gene_name": "EIF2S3", "activity": [ { "ec_number": "3.6.5.3", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P41091", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P41091" } ] }, { "ec_number": "3.6.5.3", "activity": "", "evidence": [ { "id": "P41091", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P41091" } ] } ] }, { "uniprot_ac": "P60842", "gene_name": "EIF4A1", "activity": [ { "ec_number": "3.6.4.13", "activity": "ATP + H2O = ADP + H(+) + phosphate.", "evidence": [ { "id": "P60842", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P60842" } ] }, { "ec_number": "3.6.4.13", "activity": "", "evidence": [ { "id": "P60842", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P60842" } ] } ] }, { "uniprot_ac": "Q14240", "gene_name": "EIF4A2", "activity": [ { "ec_number": "3.6.4.13", "activity": "ATP + H2O = ADP + H(+) + phosphate.", "evidence": [ { "id": "Q14240", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q14240" } ] }, { "ec_number": "3.6.4.13", "activity": "", "evidence": [ { "id": "Q14240", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q14240" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.oma", "label": "OMA Homologs" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [ 46, 119, 216, 255, 258 ], "sequon_annotation_sites": [ { "start_pos": 140, "end_pos": 142 }, { "start_pos": 342, "end_pos": 344 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 8 }, { "field": "total_sites", "count": 5 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 50 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }