{ "uniprot_canonical_ac": "O00231-1", "uniprot_ac": "O00231", "uniprot_id": "PSD11_HUMAN", "mass": { "chemical_mass": 47464.0, "monoisotopic_mass": 47464.0 }, "refseq": { "ac": "NP_001257411", "name": "26S proteasome non-ATPase regulatory subunit 11", "summary": "The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. This gene encodes a member of the proteasome subunit S9 family that functions as a non-ATPase subunit of the 19S regulator and is phosphorylated by AMP-activated protein kinase. Alternatively spliced transcript variants have been observed for this gene. [provided by RefSeq, Jul 2012].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001257411" }, "gene_names": [ { "name": "PSMD11", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/O00231", "id": "O00231" }, { "name": "PSMD11", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001257411", "id": "NP_001257411" }, { "name": "p44.5; Rpn6; S9", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001257411", "id": "NP_001257411" } ], "protein_names": [ { "name": "26S proteasome non-ATPase regulatory subunit 11", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "O00231" }, { "name": "26S proteasome non-ATPase regulatory subunit 11", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001257411", "id": "NP_001257411" }, { "name": "26S proteasome regulatory subunit 9; 26S proteasome regulatory subunit S9; 26S proteasome regulatory subunit p44.5; 26S proteasome regulatory subunit RPN6; proteasome (prosome, macropain) 26S subunit, non-ATPase, 11", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001257411", "id": "NP_001257411" }, { "name": "26S proteasome regulatory subunit RPN6", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O00231" }, { "name": "26S proteasome regulatory subunit S9", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O00231" }, { "name": "26S proteasome regulatory subunit p44.5", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O00231" } ], "function": [ { "annotation": "Component of the 26S proteasome, a multiprotein complex involved in the ATP-dependent degradation of ubiquitinated proteins. This complex plays a key role in the maintenance of protein homeostasis by removing misfolded or damaged proteins, which could impair cellular functions, and by removing proteins whose functions are no longer required. Therefore, the proteasome participates in numerous cellular processes, including cell cycle progression, apoptosis, or DNA damage repair. In the complex, PSMD11 is required for proteasome assembly. Plays a key role in increased proteasome activity in embryonic stem cells (ESCs): its high expression in ESCs promotes enhanced assembly of the 26S proteasome, followed by higher proteasome activity.", "evidence": [ { "database": "UniProtKB", "id": "O00231", "url": "https://www.uniprot.org/uniprot/O00231#function" }, { "database": "PubMed", "id": "22972301", "url": "https://glygen.org/publication/PubMed/22972301" }, { "database": "PubMed", "id": "1317798", "url": "https://glygen.org/publication/PubMed/1317798" } ] }, { "annotation": "PSMD11 modulates circadian clock function through PER and CRY nuclear translocation. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_001257411", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001257411" }, { "database": "PubMed", "id": "36961772", "url": "https://glygen.org/publication/PubMed/36961772" } ] }, { "annotation": "PSMD11, PTPRM and PTPRB as novel biomarkers of pancreatic cancer progression.", "evidence": [ { "database": "RefSeq", "id": "NP_001257411", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001257411" }, { "database": "PubMed", "id": "32663515", "url": "https://glygen.org/publication/PubMed/32663515" } ] }, { "annotation": "Prognostic Value and Molecular Mechanisms of Proteasome 26S Subunit, Non-ATPase Family Genes for Pancreatic Ductal Adenocarcinoma Patients after Pancreaticoduodenectomy.", "evidence": [ { "database": "RefSeq", "id": "NP_001257411", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001257411" }, { "database": "PubMed", "id": "33525943", "url": "https://glygen.org/publication/PubMed/33525943" } ] }, { "annotation": "Relationship between the Expression Level of PSMD11 and Other Proteasome Proteins with the Activity of Ricin and Viscumin.", "evidence": [ { "database": "RefSeq", "id": "NP_001257411", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001257411" }, { "database": "PubMed", "id": "32894464", "url": "https://glygen.org/publication/PubMed/32894464" } ] }, { "annotation": "The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. This gene encodes a member of the proteasome subunit S9 family that functions as a non-ATPase subunit of the 19S regulator and is phosphorylated by AMP-activated protein kinase. Alternatively spliced transcript variants have been observed for this gene. [provided by RefSeq, Jul 2012].", "evidence": [ { "database": "RefSeq", "id": "NP_001257411", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001257411" } ] } ], "disease": [], "snv": [ { "evidence": [ { "id": "O00231", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O00231" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 230, "end_pos": 230, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "S", "sequence_mut": "L", "comment": "Somatic mutation passed 1 out of 6 filters: num. of cancers (3).", "chr_id": "17", "chr_pos": "32473846", "ref_nt": "C", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "S230", "disease": [ { "disease_id": "DOID:4159", "recommended_name": { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "skin cancer", "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells." }, "synonyms": [ { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "CA - skin cancer", "description": "" }, { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "malignant neoplasm of skin", "description": "" }, { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "melanoma and Non-melanoma skin cancer", "description": "" } ] }, { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] }, { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "O00231", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O00231" } ], "glycoeffect": [], "start_pos": 340, "end_pos": 340, "subjects_tested": "57", "subjects_positive": "1", "frequency": "1.8", "sequence_org": "E", "sequence_mut": "G", "comment": "Somatic mutation passed 1 out of 6 filters: patient freq. (1.8%). In dbSNP: rs1803015.", "chr_id": "17", "chr_pos": "32479357", "ref_nt": "A", "alt_nt": "G", "minor_allelic_frequency": "", "site_lbl": "E340", "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] } ], "mutagenesis": [ { "start_pos": 14, "end_pos": 14, "sequence_org": "S", "sequence_mut": "A", "comment": "Does not affect phosphorylation by AMPK; when associated with A-79 and A-272.", "evidence": [ { "database": "UniProtKB", "id": "O00231", "url": "https://www.uniprot.org/uniprot/O00231" }, { "database": "PubMed", "id": "19616115", "url": "https://glygen.org/publication/PubMed/19616115" } ] }, { "start_pos": 272, "end_pos": 272, "sequence_org": "S", "sequence_mut": "A", "comment": "Does not affect phosphorylation by AMPK; when associated with A14- and A-79.", "evidence": [ { "database": "UniProtKB", "id": "O00231", "url": "https://www.uniprot.org/uniprot/O00231" }, { "database": "PubMed", "id": "19616115", "url": "https://glygen.org/publication/PubMed/19616115" } ] }, { "start_pos": 79, "end_pos": 79, "sequence_org": "S", "sequence_mut": "A", "comment": "Does not affect phosphorylation by AMPK; when associated with A-14 and A-272.", "evidence": [ { "database": "UniProtKB", "id": "O00231", "url": "https://www.uniprot.org/uniprot/O00231" }, { "database": "PubMed", "id": "19616115", "url": "https://glygen.org/publication/PubMed/19616115" } ] } ], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "89.01", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000108671", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000108671" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "92.2", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000108671", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000108671" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "91.06", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000108671", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000108671" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "67.92", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000108671", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000108671" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "94.03", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000108671", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000108671" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "95.18", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000108671", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000108671" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "87.33", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000108671", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000108671" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "93.09", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000108671", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000108671" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "93.41", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000108671", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000108671" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "83.82", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000108671", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000108671" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "92.94", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000108671", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000108671" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "92.6", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000108671", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000108671" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "93.65", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000108671", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000108671" } ] } ], "expression_disease": [ { "significant": "Yes", "trend": "up", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "O00231", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O00231" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "O00231", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O00231" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "O00231", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O00231" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "O00231", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O00231" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "O00231", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O00231" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "O00231", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O00231" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "O00231", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O00231" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "O00231", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O00231" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "O00231", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O00231" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "O00231", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O00231" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "O00231", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O00231" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "O00231", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O00231" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O00231", "url": "https://www.uniprot.org/uniprot/O00231" } ], "common_name": "Human" } ], "gene": [ { "name": "PSMD11", "url": "https://www.uniprot.org/uniprot/O00231", "locus": { "chromosome": "17", "start_pos": 32483319, "end_pos": 32444379, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000108671", "url": "https://www.ensembl.org/id/ENSG00000108671" } ] } } ], "crossref": [ { "id": "ENSG00000108671", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000108671", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "O00231", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O00231", "database": "BioMuta", "categories": [ "Variation" ] }, { "id": "CHEMBL3831212", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL3831212", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "PSMD11", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=PSMD11", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "5717", "url": "https://www.ncbi.nlm.nih.gov/gene/5717", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "9556", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=9556", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "O00231", "url": "https://www.ebi.ac.uk/intact/interactors/id:O00231*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR000717", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000717", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR011990", "url": "https://www.ebi.ac.uk/interpro/entry/IPR011990", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036390", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036390", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR040773", "url": "https://www.ebi.ac.uk/interpro/entry/IPR040773", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR040780", "url": "https://www.ebi.ac.uk/interpro/entry/IPR040780", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:5717", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:5717", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "604449", "url": "http://www.omim.org/entry/604449", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_O00231", "url": "https://www.nextprot.org/entry/NX_O00231", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "O00231", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O00231", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "YESFEGF", "url": "https://omabrowser.org/oma/group/YESFEGF/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "516300at2759", "url": "http://www.orthodb.org/?query=516300at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR10678", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10678", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR10678:SF2", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10678:SF2", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "5GJQ", "url": "https://www.rcsb.org/structure/5GJQ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5GJR", "url": "https://www.rcsb.org/structure/5GJR", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5L4K", "url": "https://www.rcsb.org/structure/5L4K", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5LN3", "url": "https://www.rcsb.org/structure/5LN3", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5M32", "url": "https://www.rcsb.org/structure/5M32", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5T0C", "url": "https://www.rcsb.org/structure/5T0C", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5T0G", "url": "https://www.rcsb.org/structure/5T0G", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5T0H", "url": "https://www.rcsb.org/structure/5T0H", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5T0I", "url": "https://www.rcsb.org/structure/5T0I", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5T0J", "url": "https://www.rcsb.org/structure/5T0J", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5VFP", "url": "https://www.rcsb.org/structure/5VFP", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5VFQ", "url": "https://www.rcsb.org/structure/5VFQ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5VFR", "url": "https://www.rcsb.org/structure/5VFR", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5VFS", "url": "https://www.rcsb.org/structure/5VFS", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5VFT", "url": "https://www.rcsb.org/structure/5VFT", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5VFU", "url": "https://www.rcsb.org/structure/5VFU", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5VGZ", "url": "https://www.rcsb.org/structure/5VGZ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5VHF", "url": "https://www.rcsb.org/structure/5VHF", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5VHH", "url": "https://www.rcsb.org/structure/5VHH", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5VHI", "url": "https://www.rcsb.org/structure/5VHI", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5VHS", "url": "https://www.rcsb.org/structure/5VHS", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6MSB", "url": "https://www.rcsb.org/structure/6MSB", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6MSD", "url": "https://www.rcsb.org/structure/6MSD", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6MSE", "url": "https://www.rcsb.org/structure/6MSE", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6MSG", "url": "https://www.rcsb.org/structure/6MSG", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6MSH", "url": "https://www.rcsb.org/structure/6MSH", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6MSJ", "url": "https://www.rcsb.org/structure/6MSJ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6MSK", "url": "https://www.rcsb.org/structure/6MSK", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6WJD", "url": "https://www.rcsb.org/structure/6WJD", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6WJN", "url": "https://www.rcsb.org/structure/6WJN", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7QXN", "url": "https://www.rcsb.org/structure/7QXN", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7QXP", "url": "https://www.rcsb.org/structure/7QXP", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7QXU", "url": "https://www.rcsb.org/structure/7QXU", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7QXW", "url": "https://www.rcsb.org/structure/7QXW", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7QXX", "url": "https://www.rcsb.org/structure/7QXX", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7QY7", "url": "https://www.rcsb.org/structure/7QY7", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7QYA", "url": "https://www.rcsb.org/structure/7QYA", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7QYB", "url": "https://www.rcsb.org/structure/7QYB", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7W37", "url": "https://www.rcsb.org/structure/7W37", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7W38", "url": "https://www.rcsb.org/structure/7W38", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7W39", "url": "https://www.rcsb.org/structure/7W39", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7W3A", "url": "https://www.rcsb.org/structure/7W3A", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7W3B", "url": "https://www.rcsb.org/structure/7W3B", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7W3C", "url": "https://www.rcsb.org/structure/7W3C", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7W3F", "url": "https://www.rcsb.org/structure/7W3F", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7W3G", "url": "https://www.rcsb.org/structure/7W3G", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7W3H", "url": "https://www.rcsb.org/structure/7W3H", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7W3I", "url": "https://www.rcsb.org/structure/7W3I", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7W3J", "url": "https://www.rcsb.org/structure/7W3J", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7W3K", "url": "https://www.rcsb.org/structure/7W3K", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7W3M", "url": "https://www.rcsb.org/structure/7W3M", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8CVT", "url": "https://www.rcsb.org/structure/8CVT", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF01399", "url": "http://pfam.xfam.org/family/PF01399", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF18055", "url": "http://pfam.xfam.org/family/PF18055", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF18503", "url": "http://pfam.xfam.org/family/PF18503", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "O00231", "url": "https://pharos.nih.gov/targets/O00231", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_O00231", "url": "http://purl.obolibrary.org/obo/PR_O00231", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-1169091", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169091", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-1234176", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1234176", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-1236974", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1236974", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-1236978", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1236978", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-174084", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-174084", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-174113", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-174113", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-174154", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-174154", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-174178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-174178", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-174184", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-174184", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-180534", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-180534", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-180585", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-180585", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-187577", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-187577", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-195253", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-195253", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-202424", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202424", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-211733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211733", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-2467813", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2467813", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-2871837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871837", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-349425", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-349425", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-350562", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-350562", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-450408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-450408", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-4608870", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4608870", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-4641257", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4641257", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-4641258", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4641258", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-5358346", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5358346", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-5362768", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5362768", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-5607761", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5607761", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-5607764", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5607764", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-5610780", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5610780", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-5610783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5610783", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-5610785", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5610785", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-5632684", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5632684", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-5658442", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5658442", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-5668541", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5668541", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-5676590", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5676590", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-5678895", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5678895", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-5689603", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689603", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-6798695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6798695", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-68867", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-68867", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-68949", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-68949", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-69017", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69017", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-69481", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69481", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-69601", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69601", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-75815", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75815", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-8852276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8852276", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-8854050", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8854050", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-8939236", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8939236", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-8939902", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8939902", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-8941858", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8941858", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-8948751", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8948751", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9010553", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9010553", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9020702", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9020702", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9604323", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9604323", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9755511", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9755511", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9762114", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9762114", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9824272", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9824272", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-983168", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983168", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001257411", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001257411", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "J3KSW3", "url": "https://www.uniprot.org/uniprot/J3KSW3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "J3KSW3-1", "url": "https://www.uniprot.org/uniprot/J3KSW3-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "J3QRY4", "url": "https://www.uniprot.org/uniprot/J3QRY4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "J3QRY4-1", "url": "https://www.uniprot.org/uniprot/J3QRY4-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "J3QS13", "url": "https://www.uniprot.org/uniprot/J3QS13", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "J3QS13-1", "url": "https://www.uniprot.org/uniprot/J3QS13-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O00231", "url": "https://www.uniprot.org/uniprot/O00231", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O00231-1", "url": "https://www.uniprot.org/uniprot/O00231-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O00231-2", "url": "https://www.uniprot.org/uniprot/O00231-2", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MAAAAVVEFQRAQSLLSTDREASIDILHSIVKRDIQENDEEAVQVKEQSILELGSLLAKTGQAAELGGLLKYVRPFLNSISKAKAARLVRSLLDLFLDMEAATGQEVELCLECIEWAKSEKRTFLRQALEARLVSLYFDTKRYQEALHLGSQLLRELKKMDDKALLVEVQLLESKTYHALSNLPKARAALTSARTTANAIYCPPKLQATLDMQSGIIHAAEEKDWKTAYSYFYEAFEGYDSIDSPKAITSLKYMLLCKIMLNTPEDVQALVSGKLALRYAGRQTEALKCVAQASKNRSLADFEKALTDYRAELRDDPIISTHLAKLYDNLLEQNLIRVIEPFSRVQIEHISSLIKLSKADVERKLSQMILDKKFHGILDQGEGVLIIFDEPPVDKTYEAALETIQNMSKVVDSLYNKAKKLT", "length": 422, "header": "sp|O00231-1|PSD11_HUMAN Isoform 1 of 26S proteasome non-ATPase regulatory subunit 11 OS=Homo sapiens OX=9606 GN=PSMD11 PE=1 SV=3 CANONICAL=O00231-1" }, "isoforms": [ { "isoform_ac": "J3KSW3-1", "url": "", "sequence": { "sequence": "MEAATGQEVELCLECIEWAKSEKRTFLRQALEARLVSLYFDTKRY", "length": 45, "header": "tr|J3KSW3-1|J3KSW3_HUMAN Computationally mapped isoform of Proteasome 26S subunit, non-ATPase 11 OS=Homo sapiens OX=9606 GN=PSMD11 PE=1 SV=1 CANONICAL=O00231-1" }, "locus": { "chromosome": "17", "start_pos": 32464559, "end_pos": 32454596, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000578213.5", "url": "https://www.ensembl.org/id/ENST00000578213.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000462683.1", "url": "https://www.ensembl.org/id/ENSP00000462683.1" } ] } }, { "isoform_ac": "J3QRY4-1", "url": "", "sequence": { "sequence": "MAAAAVVEFQRAQSLLSTDREASIDILHSIVKRDIQENDEEAVQVKEQSILELGSLLAKTGQAAELGGLLKYVRPFLNSISKAKAARLVRSLLDLFLDMEAATGQEFLFVTGHLILWVCSMLCFVSGDCQWSLESSLHQGHKLILVFEVELCLECIEWAKSEKRTFLRQALEARLVSLYFDTKRYQE", "length": 187, "header": "tr|J3QRY4-1|J3QRY4_HUMAN Computationally mapped isoform of Proteasome 26S subunit, non-ATPase 11 OS=Homo sapiens OX=9606 GN=PSMD11 PE=1 SV=8 CANONICAL=O00231-1" }, "locus": { "chromosome": "17", "start_pos": 32464565, "end_pos": 32444524, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000579451.1", "url": "https://www.ensembl.org/id/ENST00000579451.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000464434.1", "url": "https://www.ensembl.org/id/ENSP00000464434.1" } ] } }, { "isoform_ac": "J3QS13-1", "url": "", "sequence": { "sequence": "XKTYHALSNLPKARAALTSARTTANAIYCPPKLQATLDMQSGIIHAAEEKDWKTAYSYFYEAFEGYDSIDSPKAITSLKYMLLCKIMLNT", "length": 90, "header": "tr|J3QS13-1|PSD11_HUMAN Computationally mapped isoform of 26S proteasome non-ATPase regulatory subunit 11 OS=Homo sapiens OX=9606 GN=PSMD11 PE=1 SV=1 CANONICAL=O00231-1" }, "locus": { "chromosome": "17", "start_pos": 32473948, "end_pos": 32469072, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000584340.1", "url": "https://www.ensembl.org/id/ENST00000584340.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000464475.1", "url": "https://www.ensembl.org/id/ENSP00000464475.1" } ] } }, { "isoform_ac": "O00231-1", "url": "", "sequence": { "sequence": "MAAAAVVEFQRAQSLLSTDREASIDILHSIVKRDIQENDEEAVQVKEQSILELGSLLAKTGQAAELGGLLKYVRPFLNSISKAKAARLVRSLLDLFLDMEAATGQEVELCLECIEWAKSEKRTFLRQALEARLVSLYFDTKRYQEALHLGSQLLRELKKMDDKALLVEVQLLESKTYHALSNLPKARAALTSARTTANAIYCPPKLQATLDMQSGIIHAAEEKDWKTAYSYFYEAFEGYDSIDSPKAITSLKYMLLCKIMLNTPEDVQALVSGKLALRYAGRQTEALKCVAQASKNRSLADFEKALTDYRAELRDDPIISTHLAKLYDNLLEQNLIRVIEPFSRVQIEHISSLIKLSKADVERKLSQMILDKKFHGILDQGEGVLIIFDEPPVDKTYEAALETIQNMSKVVDSLYNKAKKLT", "length": 422, "header": "sp|O00231-1|PSD11_HUMAN Isoform 1 of 26S proteasome non-ATPase regulatory subunit 11 OS=Homo sapiens OX=9606 GN=PSMD11 PE=1 SV=3 CANONICAL=O00231-1" }, "locus": { "chromosome": "17", "start_pos": 32480628, "end_pos": 32444524, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000261712.8", "url": "https://www.ensembl.org/id/ENST00000261712.8" }, { "database": "Ensembl Peptide", "id": "ENSP00000261712.3", "url": "https://www.ensembl.org/id/ENSP00000261712.3" } ] } }, { "isoform_ac": "O00231-2", "url": "", "sequence": { "sequence": "MAAAAVVEFQRAQSLLSTDREASIDILHSIVKRDIQENDEEAVQVKEQSILELGSLLAKTGQAAELGGLLKYVRPFLNSISKAKAARLVRSLLDLFLDMEAATGQEVELCLECIEWAKSEKRTFLRQALEARLVSLYFDTKRYQEALHLGSQLLRELKKMDDKALLVEVQLLESKTYHALSNLPKARAALTSARTTANAIYCPPKLQATLDMQSGIIHAAEEKDWKTAYSYFYEAFEGYDSIDSPKAITSLKYMLLCKIMLNTPEDVQALVSGKLALRYAGRQTEALKCVAQASKNRSLADFEKALTDYRAELRDDPIISTHLAKLYDNLLEQNLIRVIEPFSRVQIEHISSLIKLSKADVERKLSQMILDKKFHAGILDQGEGVLIIFDEPPVDKTYEAALETIQNMSKVVDSLYNKAKKLT", "length": 423, "header": "sp|O00231-2|PSD11_HUMAN Isoform 2 of 26S proteasome non-ATPase regulatory subunit 11 OS=Homo sapiens OX=9606 GN=PSMD11 PE=1 SV=3 CANONICAL=O00231-1" }, "locus": {} } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "evidence": [ { "id": "O00231", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O00231" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "34725712", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725712" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "32870666", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32870666" } ] } ], "phosphorylation": [ { "start_pos": 14, "end_pos": 14, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O00231", "url": "https://www.uniprot.org/uniprot/O00231" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "17323924", "url": "https://glygen.org/publication/PubMed/17323924" }, { "database": "PubMed", "id": "24275569", "url": "https://glygen.org/publication/PubMed/24275569" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "iPTMnet", "id": "O00231", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O00231" } ], "site_lbl": "Ser14" }, { "start_pos": 23, "end_pos": 23, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O00231", "url": "https://www.uniprot.org/uniprot/O00231" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "iPTMnet", "id": "O00231", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O00231" } ], "site_lbl": "Ser23" }, { "start_pos": 263, "end_pos": 263, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O00231", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O00231" }, { "database": "PubMed", "id": "35494241", "url": "" } ], "site_lbl": "Thr263" }, { "start_pos": 272, "end_pos": 272, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O00231", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O00231" }, { "database": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Ser272" }, { "start_pos": 79, "end_pos": 79, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O00231", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O00231" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Ser79" }, { "start_pos": 81, "end_pos": 81, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O00231", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O00231" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Ser81" } ], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "The human F box protein beta-Trcp associates with the Cul1/Skp1 complex and regulates the stability of beta-catenin.", "journal": "Oncogene", "date": "1999", "authors": "Latres E, Chiaur DS, Pagano M", "evidence": [ { "database": "Reactome", "id": "R-HSA-174113", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-174113" } ], "reference": [ { "type": "PubMed", "id": "10023660", "url": "https://glygen.org/publication/PubMed/10023660" } ] }, { "title": "IkappaBalpha ubiquitination is catalyzed by an SCF-like complex containing Skp1, cullin-1, and two F-box/WD40-repeat proteins, betaTrCP1 and betaTrCP2.", "journal": "Biochemical and biophysical research communications", "date": "1999", "authors": "Suzuki H, Chiba T, Kobayashi M, Takeuchi M, Suzuki T, Ichiyama A, Ikenoue T, Omata M, Furuichi K, Tanaka K", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169091", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169091" } ], "reference": [ { "type": "PubMed", "id": "10066435", "url": "https://glygen.org/publication/PubMed/10066435" } ] }, { "title": "Inducible degradation of IkappaBalpha by the proteasome requires interaction with the F-box protein h-betaTrCP.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Kroll M, Margottin F, Kohl A, Renard P, Durand H, Concordet JP, Bachelerie F, Arenzana-Seisdedos F, Benarous R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9020702", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9020702" } ], "reference": [ { "type": "PubMed", "id": "10075690", "url": "https://glygen.org/publication/PubMed/10075690" } ] }, { "title": "Regulation of beta-catenin signaling by the B56 subunit of protein phosphatase 2A.", "journal": "Science (New York, N.Y.)", "date": "1999", "authors": "Seeling JM, Miller JR, Gil R, Moon RT, White R, Virshup DM", "evidence": [ { "database": "Reactome", "id": "R-HSA-195253", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-195253" } ], "reference": [ { "type": "PubMed", "id": "10092233", "url": "https://glygen.org/publication/PubMed/10092233" } ] }, { "title": "CIPER, a novel NF kappaB-activating protein containing a caspase recruitment domain with homology to Herpesvirus-2 protein E10.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Koseki T, Inohara N, Chen S, Carrio R, Merino J, Hottiger MO, Nabel GJ, Nunez G", "evidence": [ { "database": "Reactome", "id": "R-HSA-5607764", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5607764" } ], "reference": [ { "type": "PubMed", "id": "10187770", "url": "https://glygen.org/publication/PubMed/10187770" } ] }, { "title": "Phosphorylation of axin, a Wnt signal negative regulator, by glycogen synthase kinase-3beta regulates its stability.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Yamamoto H, Kishida S, Kishida M, Ikeda S, Takada S, Kikuchi A", "evidence": [ { "database": "Reactome", "id": "R-HSA-195253", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-195253" } ], "reference": [ { "type": "PubMed", "id": "10196136", "url": "https://glygen.org/publication/PubMed/10196136" } ] }, { "title": "Control of mRNA decay by heat shock-ubiquitin-proteasome pathway.", "journal": "Science (New York, N.Y.)", "date": "1999", "authors": "Laroia G, Cuesta R, Brewer G, Schneider RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-450408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-450408" } ], "reference": [ { "type": "PubMed", "id": "10205060", "url": "https://glygen.org/publication/PubMed/10205060" } ] }, { "title": "A Cbfa1-dependent genetic pathway controls bone formation beyond embryonic development.", "journal": "Genes & development", "date": "1999", "authors": "Ducy P, Starbuck M, Priemel M, Shen J, Pinero G, Geoffroy V, Amling M, Karsenty G", "evidence": [ { "database": "Reactome", "id": "R-HSA-8939902", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8939902" } ], "reference": [ { "type": "PubMed", "id": "10215629", "url": "https://glygen.org/publication/PubMed/10215629" } ] }, { "title": "Recruitment of a ROC1-CUL1 ubiquitin ligase by Skp1 and HOS to catalyze the ubiquitination of I kappa B alpha.", "journal": "Molecular cell", "date": "1999", "authors": "Tan P, Fuchs SY, Chen A, Wu K, Gomez C, Ronai Z, Pan ZQ", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169091", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169091" } ], "reference": [ { "type": "PubMed", "id": "10230406", "url": "https://glygen.org/publication/PubMed/10230406" } ] }, { "title": "HOS, a human homolog of Slimb, forms an SCF complex with Skp1 and Cullin1 and targets the phosphorylation-dependent degradation of IkappaB and beta-catenin.", "journal": "Oncogene", "date": "1999", "authors": "Fuchs SY, Chen A, Xiong Y, Pan ZQ, Ronai Z", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169091", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169091" } ], "reference": [ { "type": "PubMed", "id": "10321728", "url": "https://glygen.org/publication/PubMed/10321728" } ] }, { "title": "Ubiquitination of p27 is regulated by Cdk-dependent phosphorylation and trimeric complex formation.", "journal": "Genes & development", "date": "1999", "authors": "Montagnoli A, Fiore F, Eytan E, Carrano AC, Draetta GF, Hershko A, Pagano M", "evidence": [ { "database": "Reactome", "id": "R-HSA-187577", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-187577" } ], "reference": [ { "type": "PubMed", "id": "10323868", "url": "https://glygen.org/publication/PubMed/10323868" } ] }, { "title": "Multistep regulation of DNA replication by Cdk phosphorylation of HsCdc6.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1999", "authors": "Jiang W, Wells NJ, Hunter T", "evidence": [ { "database": "Reactome", "id": "R-HSA-69017", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69017" } ], "reference": [ { "type": "PubMed", "id": "10339564", "url": "https://glygen.org/publication/PubMed/10339564" } ] }, { "title": "p27(Kip1) ubiquitination and degradation is regulated by the SCF(Skp2) complex through phosphorylated Thr187 in p27.", "journal": "Current biology : CB", "date": "1999", "authors": "Tsvetkov LM, Yeh KH, Lee SJ, Sun H, Zhang H", "evidence": [ { "database": "Reactome", "id": "R-HSA-187577", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-187577" } ], "reference": [ { "type": "PubMed", "id": "10375532", "url": "https://glygen.org/publication/PubMed/10375532" } ] }, { "title": "Identification of a vertebrate sister-chromatid separation inhibitor involved in transformation and tumorigenesis.", "journal": "Science (New York, N.Y.)", "date": "1999", "authors": "Zou H, McGarry TJ, Bernal T, Kirschner MW", "evidence": [ { "database": "Reactome", "id": "R-HSA-2467813", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2467813" } ], "reference": [ { "type": "PubMed", "id": "10411507", "url": "https://glygen.org/publication/PubMed/10411507" } ] }, { "title": "Wnt-induced dephosphorylation of axin releases beta-catenin from the axin complex.", "journal": "Genes & development", "date": "1999", "authors": "Willert K, Shibamoto S, Nusse R", "evidence": [ { "database": "Reactome", "id": "R-HSA-195253", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-195253" } ], "reference": [ { "type": "PubMed", "id": "10421629", "url": "https://glygen.org/publication/PubMed/10421629" } ] }, { "title": "Vertebrate homologs of Drosophila suppressor of fused interact with the gli family of transcriptional regulators.", "journal": "Developmental biology", "date": "1999", "authors": "Pearse RV 2nd, Collier LS, Scott MP, Tabin CJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5632684", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5632684" } ], "reference": [ { "type": "PubMed", "id": "10433824", "url": "https://glygen.org/publication/PubMed/10433824" } ] }, { "title": "Identification, functional characterization, and chromosomal localization of USP15, a novel human ubiquitin-specific protease related to the UNP oncoprotein, and a systematic nomenclature for human ubiquitin-specific proteases.", "journal": "Genomics", "date": "1999", "authors": "Baker RT, Wang XW, Woollatt E, White JA, Sutherland GR", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "10444327", "url": "https://glygen.org/publication/PubMed/10444327" } ] }, { "title": "p21-activated protein kinase: a crucial component of morphological signaling?", "journal": "Trends in biochemical sciences", "date": "1999", "authors": "Daniels RH, Bokoch GM", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "10470034", "url": "https://glygen.org/publication/PubMed/10470034" } ] }, { "title": "Profound differences in the transport of steroids by two mouse P-glycoproteins.", "journal": "Biochemical pharmacology", "date": "1999", "authors": "Gruol DJ, Vo QD, Zee MC", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "10484077", "url": "https://glygen.org/publication/PubMed/10484077" } ] }, { "title": "beta-TrCP mediates the signal-induced ubiquitination of IkappaBbeta.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Wu C, Ghosh S", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169091", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169091" } ], "reference": [ { "type": "PubMed", "id": "10514424", "url": "https://glygen.org/publication/PubMed/10514424" } ] }, { "title": "Molecular dissection of the interactions among IkappaBalpha, FWD1, and Skp1 required for ubiquitin-mediated proteolysis of IkappaBalpha.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Hattori K, Hatakeyama S, Shirane M, Matsumoto M, Nakayama K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9020702", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9020702" } ], "reference": [ { "type": "PubMed", "id": "10514433", "url": "https://glygen.org/publication/PubMed/10514433" } ] }, { "title": "Identification of the von Hippel-lindau tumor-suppressor protein as part of an active E3 ubiquitin ligase complex.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1999", "authors": "Iwai K, Yamanaka K, Kamura T, Minato N, Conaway RC, Conaway JW, Klausner RD, Pause A", "evidence": [ { "database": "Reactome", "id": "R-HSA-1234176", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1234176" } ], "reference": [ { "type": "PubMed", "id": "10535940", "url": "https://glygen.org/publication/PubMed/10535940" } ] }, { "title": "Assembly of AUF1 oligomers on U-rich RNA targets by sequential dimer association.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Wilson GM, Sun Y, Lu H, Brewer G", "evidence": [ { "database": "Reactome", "id": "R-HSA-450408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-450408" } ], "reference": [ { "type": "PubMed", "id": "10559216", "url": "https://glygen.org/publication/PubMed/10559216" } ] }, { "title": "SKP2 is required for ubiquitin-mediated degradation of the CDK inhibitor p27.", "journal": "Nature cell biology", "date": "1999", "authors": "Carrano AC, Eytan E, Hershko A, Pagano M", "evidence": [ { "database": "Reactome", "id": "R-HSA-187577", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-187577" } ], "reference": [ { "type": "PubMed", "id": "10559916", "url": "https://glygen.org/publication/PubMed/10559916" } ] }, { "title": "Characterization of the human suppressor of fused, a negative regulator of the zinc-finger transcription factor Gli.", "journal": "Journal of cell science", "date": "1999", "authors": "Stone DM, Murone M, Luoh S, Ye W, Armanini MP, Gurney A, Phillips H, Brush J, Goddard A, de Sauvage FJ, Rosenthal A", "evidence": [ { "database": "Reactome", "id": "R-HSA-5632684", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5632684" } ], "reference": [ { "type": "PubMed", "id": "10564661", "url": "https://glygen.org/publication/PubMed/10564661" } ] }, { "title": "The murine Bapx1 homeobox gene plays a critical role in embryonic development of the axial skeleton and spleen.", "journal": "Development (Cambridge, England)", "date": "1999", "authors": "Tribioli C, Lufkin T", "evidence": [ { "database": "Reactome", "id": "R-HSA-8939902", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8939902" } ], "reference": [ { "type": "PubMed", "id": "10572046", "url": "https://glygen.org/publication/PubMed/10572046" } ] }, { "title": "A GSK3beta phosphorylation site in axin modulates interaction with beta-catenin and Tcf-mediated gene expression.", "journal": "Biochemical and biophysical research communications", "date": "1999", "authors": "Jho Eh, Lomvardas S, Costantini F", "evidence": [ { "database": "Reactome", "id": "R-HSA-195253", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-195253" } ], "reference": [ { "type": "PubMed", "id": "10581160", "url": "https://glygen.org/publication/PubMed/10581160" } ] }, { "title": "Peptides corresponding to the N and C termini of IkappaB-alpha, -beta, and -epsilon as probes of the two catalytic subunits of IkappaB kinase, IKK-1 and IKK-2.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Burke JR, Wood MK, Ryseck RP, Walther S, Meyers CA", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169091", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169091" } ], "reference": [ { "type": "PubMed", "id": "10593898", "url": "https://glygen.org/publication/PubMed/10593898" } ] }, { "title": "Covalent modification of all members of human cullin family proteins by NEDD8.", "journal": "Oncogene", "date": "1999", "authors": "Hori T, Osaka F, Chiba T, Miyamoto C, Okabayashi K, Shimbara N, Kato S, Tanaka K", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "10597293", "url": "https://glygen.org/publication/PubMed/10597293" } ] }, { "title": "Interaction of docetaxel (`Taxotere`) with human P-glycoprotein.", "journal": "Japanese journal of cancer research : Gann", "date": "1999", "authors": "Shirakawa K, Takara K, Tanigawara Y, Aoyama N, Kasuga M, Komada F, Sakaeda T, Okumura K", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "10665657", "url": "https://glygen.org/publication/PubMed/10665657" } ] }, { "title": "Human p55(CDC)/Cdc20 associates with cyclin A and is phosphorylated by the cyclin A-Cdk2 complex.", "journal": "Biochemical and biophysical research communications", "date": "2000", "authors": "Ohtoshi A, Maeda T, Higashi H, Ashizawa S, Hatakeyama M", "evidence": [ { "database": "Reactome", "id": "R-HSA-174184", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-174184" } ], "reference": [ { "type": "PubMed", "id": "10679238", "url": "https://glygen.org/publication/PubMed/10679238" } ] }, { "title": "Hedgehog-regulated processing of Gli3 produces an anterior/posterior repressor gradient in the developing vertebrate limb.", "journal": "Cell", "date": "2000", "authors": "Wang B, Fallon JF, Beachy PA", "evidence": [ { "database": "Reactome", "id": "R-HSA-5610785", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5610785" } ], "reference": [ { "type": "PubMed", "id": "10693759", "url": "https://glygen.org/publication/PubMed/10693759" } ] }, { "title": "The PI3K-PDK1 connection: more than just a road to PKB.", "journal": "The Biochemical journal", "date": "2000", "authors": "Vanhaesebroeck B, Alessi DR", "evidence": [ { "database": "Reactome", "id": "R-HSA-202424", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202424" } ], "reference": [ { "type": "PubMed", "id": "10698680", "url": "https://glygen.org/publication/PubMed/10698680" } ] }, { "title": "TAK1 mitogen-activated protein kinase kinase kinase is activated by autophosphorylation within its activation loop.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Kishimoto K, Matsumoto K, Ninomiya-Tsuji J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871837" } ], "reference": [ { "type": "PubMed", "id": "10702308", "url": "https://glygen.org/publication/PubMed/10702308" } ] }, { "title": "Structure, function, and biology of SHIP proteins.", "journal": "Genes & development", "date": "2000", "authors": "Rohrschneider LR, Fuller JF, Wolf I, Liu Y, Lucas DM", "evidence": [ { "database": "Reactome", "id": "R-HSA-202424", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202424" } ], "reference": [ { "type": "PubMed", "id": "10716940", "url": "https://glygen.org/publication/PubMed/10716940" } ] }, { "title": "The KEN box: an APC recognition signal distinct from the D box targeted by Cdh1.", "journal": "Genes & development", "date": "2000", "authors": "Pfleger CM, Kirschner MW", "evidence": [ { "database": "Reactome", "id": "R-HSA-174178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-174178" } ], "reference": [ { "type": "PubMed", "id": "10733526", "url": "https://glygen.org/publication/PubMed/10733526" } ] }, { "title": "Characterization of ABCB9, an ATP binding cassette protein associated with lysosomes.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Zhang F, Zhang W, Liu L, Fisher CL, Hui D, Childs S, Dorovini-Zis K, Ling V", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "10748049", "url": "https://glygen.org/publication/PubMed/10748049" } ] }, { "title": "Identification of a novel, dendritic cell-associated molecule, dectin-1, by subtractive cDNA cloning.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Ariizumi K, Shen GL, Shikano S, Xu S, Ritter R 3rd, Kumamoto T, Edelbaum D, Morita A, Bergstresser PR, Takashima A", "evidence": [ { "database": "Reactome", "id": "R-HSA-5607764", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5607764" } ], "reference": [ { "type": "PubMed", "id": "10779524", "url": "https://glygen.org/publication/PubMed/10779524" } ] }, { "title": "Ubiquitin protein ligase activity of IAPs and their degradation in proteasomes in response to apoptotic stimuli.", "journal": "Science (New York, N.Y.)", "date": "2000", "authors": "Yang Y, Fang S, Jensen JP, Weissman AM, Ashwell JD", "evidence": [ { "database": "Reactome", "id": "R-HSA-5668541", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5668541" } ], "reference": [ { "type": "PubMed", "id": "10797013", "url": "https://glygen.org/publication/PubMed/10797013" } ] }, { "title": "A complex of mammalian ufd1 and npl4 links the AAA-ATPase, p97, to ubiquitin and nuclear transport pathways.", "journal": "The EMBO journal", "date": "2000", "authors": "Meyer HH, Shorter JG, Seemann J, Pappin D, Warren G", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "10811609", "url": "https://glygen.org/publication/PubMed/10811609" } ] }, { "title": "Hypoxia inducible factor-alpha binding and ubiquitylation by the von Hippel-Lindau tumor suppressor protein.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Cockman ME, Masson N, Mole DR, Jaakkola P, Chang GW, Clifford SC, Maher ER, Pugh CW, Ratcliffe PJ, Maxwell PH", "evidence": [ { "database": "Reactome", "id": "R-HSA-1234176", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1234176" } ], "reference": [ { "type": "PubMed", "id": "10823831", "url": "https://glygen.org/publication/PubMed/10823831" } ] }, { "title": "Cdc25A stability is controlled by the ubiquitin-proteasome pathway during cell cycle progression and terminal differentiation.", "journal": "Oncogene", "date": "2000", "authors": "Bernardi R, Liebermann DA, Hoffman B", "evidence": [ { "database": "Reactome", "id": "R-HSA-69601", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69601" } ], "reference": [ { "type": "PubMed", "id": "10828887", "url": "https://glygen.org/publication/PubMed/10828887" } ] }, { "title": "Phosphorylation-dependent activation of TAK1 mitogen-activated protein kinase kinase kinase by TAB1.", "journal": "FEBS letters", "date": "2000", "authors": "Sakurai H, Miyoshi H, Mizukami J, Sugita T", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871837" } ], "reference": [ { "type": "PubMed", "id": "10838074", "url": "https://glygen.org/publication/PubMed/10838074" } ] }, { "title": "Tollip, a new component of the IL-1RI pathway, links IRAK to the IL-1 receptor.", "journal": "Nature cell biology", "date": "2000", "authors": "Burns K, Clatworthy J, Martin L, Martinon F, Plumpton C, Maschera B, Lewis A, Ray K, Tschopp J, Volpe F", "evidence": [ { "database": "Reactome", "id": "R-HSA-9020702", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9020702" } ], "reference": [ { "type": "PubMed", "id": "10854325", "url": "https://glygen.org/publication/PubMed/10854325" } ] }, { "title": "Ubiquitination of hypoxia-inducible factor requires direct binding to the beta-domain of the von Hippel-Lindau protein.", "journal": "Nature cell biology", "date": "2000", "authors": "Ohh M, Park CW, Ivan M, Hoffman MA, Kim TY, Huang LE, Pavletich N, Chau V, Kaelin WG", "evidence": [ { "database": "Reactome", "id": "R-HSA-1234176", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1234176" } ], "reference": [ { "type": "PubMed", "id": "10878807", "url": "https://glygen.org/publication/PubMed/10878807" } ] }, { "title": "TAB2, a novel adaptor protein, mediates activation of TAK1 MAPKKK by linking TAK1 to TRAF6 in the IL-1 signal transduction pathway.", "journal": "Molecular cell", "date": "2000", "authors": "Takaesu G, Kishida S, Hiyama A, Yamaguchi K, Shibuya H, Irie K, Ninomiya-Tsuji J, Matsumoto K", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871837" } ], "reference": [ { "type": "PubMed", "id": "10882101", "url": "https://glygen.org/publication/PubMed/10882101" } ] }, { "title": "Electron microscopic observation and single-stranded DNA binding activity of the Mcm4,6,7 complex.", "journal": "Journal of molecular biology", "date": "2000", "authors": "Sato M, Gotow T, You Z, Komamura-Kohno Y, Uchiyama Y, Yabuta N, Nojima H, Ishimi Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-68867", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-68867" } ], "reference": [ { "type": "PubMed", "id": "10884341", "url": "https://glygen.org/publication/PubMed/10884341" } ] }, { "title": "Transcriptional autoregulation of the bone related CBFA1/RUNX2 gene.", "journal": "Journal of cellular physiology", "date": "2000", "authors": "Drissi H, Luc Q, Shakoori R, Chuva De Sousa Lopes S, Choi JY, Terry A, Hu M, Jones S, Neil JC, Lian JB, Stein JL, Van Wijnen AJ, Stein GS", "evidence": [ { "database": "Reactome", "id": "R-HSA-8939902", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8939902" } ], "reference": [ { "type": "PubMed", "id": "10911365", "url": "https://glygen.org/publication/PubMed/10911365" } ] }, { "title": "SCF(beta-TRCP) and phosphorylation dependent ubiquitinationof I kappa B alpha catalyzed by Ubc3 and Ubc4.", "journal": "Oncogene", "date": "2000", "authors": "Strack P, Caligiuri M, Pelletier M, Boisclair M, Theodoras A, Beer-Romero P, Glass S, Parsons T, Copeland RA, Auger KR, Benfield P, Brizuela L, Rolfe M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9020702", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9020702" } ], "reference": [ { "type": "PubMed", "id": "10918611", "url": "https://glygen.org/publication/PubMed/10918611" } ] }, { "title": "Mechanism of regulation of the hypoxia-inducible factor-1 alpha by the von Hippel-Lindau tumor suppressor protein.", "journal": "The EMBO journal", "date": "2000", "authors": "Tanimoto K, Makino Y, Pereira T, Poellinger L", "evidence": [ { "database": "Reactome", "id": "R-HSA-1234176", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1234176" } ], "reference": [ { "type": "PubMed", "id": "10944113", "url": "https://glygen.org/publication/PubMed/10944113" } ] }, { "title": "Hedgehog induces opposite changes in turnover and subcellular localization of patched and smoothened.", "journal": "Cell", "date": "2000", "authors": "Denef N, Neubuser D, Perez L, Cohen SM", "evidence": [ { "database": "Reactome", "id": "R-HSA-5632684", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5632684" } ], "reference": [ { "type": "PubMed", "id": "10966113", "url": "https://glygen.org/publication/PubMed/10966113" } ] }, { "title": "Activation of HIF1alpha ubiquitination by a reconstituted von Hippel-Lindau (VHL) tumor suppressor complex.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2000", "authors": "Kamura T, Sato S, Iwai K, Czyzyk-Krzeska M, Conaway RC, Conaway JW", "evidence": [ { "database": "Reactome", "id": "R-HSA-1234176", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1234176" } ], "reference": [ { "type": "PubMed", "id": "10973499", "url": "https://glygen.org/publication/PubMed/10973499" } ] }, { "title": "Structure of PAK1 in an autoinhibited conformation reveals a multistage activation switch.", "journal": "Cell", "date": "2000", "authors": "Lei M, Lu W, Meng W, Parrini MC, Eck MJ, Mayer BJ, Harrison SC", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "10975528", "url": "https://glygen.org/publication/PubMed/10975528" } ] }, { "title": "A deubiquitinating enzyme UBPY interacts with the Src homology 3 domain of Hrs-binding protein via a novel binding motif PX(V/I)(D/N)RXXKP.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Kato M, Miyazawa K, Kitamura N", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "10982817", "url": "https://glygen.org/publication/PubMed/10982817" } ] }, { "title": "Effects of oncogenic mutations in Smoothened and Patched can be reversed by cyclopamine.", "journal": "Nature", "date": "2000", "authors": "Taipale J, Chen JK, Cooper MK, Wang B, Mann RK, Milenkovic L, Scott MP, Beachy PA", "evidence": [ { "database": "Reactome", "id": "R-HSA-5358346", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5358346" } ], "reference": [ { "type": "PubMed", "id": "10984056", "url": "https://glygen.org/publication/PubMed/10984056" } ] }, { "title": "Cell cycle- and cell growth-regulated proteolysis of mammalian CDC6 is dependent on APC-CDH1.", "journal": "Genes & development", "date": "2000", "authors": "Petersen BO, Wagener C, Marinoni F, Kramer ER, Melixetian M, Lazzerini Denchi E, Gieffers C, Matteucci C, Peters JM, Helin K", "evidence": [ { "database": "Reactome", "id": "R-HSA-69017", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69017" } ], "reference": [ { "type": "PubMed", "id": "10995389", "url": "https://glygen.org/publication/PubMed/10995389" } ] }, { "title": "Role of exon 2-encoded beta -domain of the von Hippel-Lindau tumor suppressor protein.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Bonicalzi ME, Groulx I, de Paulsen N, Lee S", "evidence": [ { "database": "Reactome", "id": "R-HSA-1234176", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1234176" } ], "reference": [ { "type": "PubMed", "id": "11024059", "url": "https://glygen.org/publication/PubMed/11024059" } ] }, { "title": "Receptor-mediated endocytosis of soluble and membrane-tethered Sonic hedgehog by Patched-1.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2000", "authors": "Incardona JP, Lee JH, Robertson CP, Enga K, Kapur RP, Roelink H", "evidence": [ { "database": "Reactome", "id": "R-HSA-5632684", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5632684" } ], "reference": [ { "type": "PubMed", "id": "11027307", "url": "https://glygen.org/publication/PubMed/11027307" } ] }, { "title": "The tumor suppressor PTEN is phosphorylated by the protein kinase CK2 at its C terminus. Implications for PTEN stability to proteasome-mediated degradation.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Torres J, Pulido R", "evidence": [ { "database": "Reactome", "id": "R-HSA-8948751", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8948751" } ], "reference": [ { "type": "PubMed", "id": "11035045", "url": "https://glygen.org/publication/PubMed/11035045" } ] }, { "title": "Chromatin association of human origin recognition complex, cdc6, and minichromosome maintenance proteins during the cell cycle: assembly of prereplication complexes in late mitosis.", "journal": "Molecular and cellular biology", "date": "2000", "authors": "Mendez J, Stillman B", "evidence": [ { "database": "Reactome", "id": "R-HSA-69017", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69017" } ], "reference": [ { "type": "PubMed", "id": "11046155", "url": "https://glygen.org/publication/PubMed/11046155" } ] }, { "title": "CARD9 is a novel caspase recruitment domain-containing protein that interacts with BCL10/CLAP and activates NF-kappa B.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Bertin J, Guo Y, Wang L, Srinivasula SM, Jacobson MD, Poyet JL, Merriam S, Du MQ, Dyer MJ, Robison KE, DiStefano PS, Alnemri ES", "evidence": [ { "database": "Reactome", "id": "R-HSA-5607764", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5607764" } ], "reference": [ { "type": "PubMed", "id": "11053425", "url": "https://glygen.org/publication/PubMed/11053425" } ] }, { "title": "Activation of the IkappaB kinase complex by TRAF6 requires a dimeric ubiquitin-conjugating enzyme complex and a unique polyubiquitin chain.", "journal": "Cell", "date": "2000", "authors": "Deng L, Wang C, Spencer E, Yang L, Braun A, You J, Slaughter C, Pickart C, Chen ZJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5607764", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5607764" } ], "reference": [ { "type": "PubMed", "id": "11057907", "url": "https://glygen.org/publication/PubMed/11057907" } ] }, { "title": "Two new proteases in the MHC class I processing pathway.", "journal": "Nature immunology", "date": "2000", "authors": "Stoltze L, Schirle M, Schwarz G, Schroter C, Thompson MW, Hersh LB, Kalbacher H, Stevanovic S, Rammensee HG, Schild H", "evidence": [ { "database": "Reactome", "id": "R-HSA-983168", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983168" } ], "reference": [ { "type": "PubMed", "id": "11062501", "url": "https://glygen.org/publication/PubMed/11062501" } ] }, { "title": "The ubiquitin-proteasome pathway regulates survivin degradation in a cell cycle-dependent manner.", "journal": "Journal of cell science", "date": "2000", "authors": "Zhao J, Tenev T, Martins LM, Downward J, Lemoine NR", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "11069780", "url": "https://glygen.org/publication/PubMed/11069780" } ] }, { "title": "Two distinct pathways remove mammalian cohesin from chromosome arms in prophase and from centromeres in anaphase.", "journal": "Cell", "date": "2000", "authors": "Waizenegger IC, Hauf S, Meinke A, Peters JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-2467813", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2467813" } ], "reference": [ { "type": "PubMed", "id": "11081627", "url": "https://glygen.org/publication/PubMed/11081627" } ] }, { "title": "Identification of paracaspases and metacaspases: two ancient families of caspase-like proteins, one of which plays a key role in MALT lymphoma.", "journal": "Molecular cell", "date": "2000", "authors": "Uren AG, O'Rourke K, Aravind LA, Pisabarro MT, Seshagiri S, Koonin EV, Dixit VM", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871837" } ], "reference": [ { "type": "PubMed", "id": "11090634", "url": "https://glygen.org/publication/PubMed/11090634" } ] }, { "title": "Physiologic role of interleukin-1 receptor antagonist.", "journal": "Arthritis research", "date": "2000", "authors": "Arend WP, Gabay C", "evidence": [ { "database": "Reactome", "id": "R-HSA-9020702", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9020702" } ], "reference": [ { "type": "PubMed", "id": "11094434", "url": "https://glygen.org/publication/PubMed/11094434" } ] }, { "title": "Inhibition of eukaryotic DNA replication by geminin binding to Cdt1.", "journal": "Science (New York, N.Y.)", "date": "2000", "authors": "Wohlschlegel JA, Dwyer BT, Dhar SK, Cvetic C, Walter JC, Dutta A", "evidence": [ { "database": "Reactome", "id": "R-HSA-68867", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-68867" } ], "reference": [ { "type": "PubMed", "id": "11125146", "url": "https://glygen.org/publication/PubMed/11125146" } ] }, { "title": "The Hsc70 co-chaperone CHIP targets immature CFTR for proteasomal degradation.", "journal": "Nature cell biology", "date": "2001", "authors": "Meacham GC, Patterson C, Zhang W, Younger JM, Cyr DM", "evidence": [ { "database": "Reactome", "id": "R-HSA-5678895", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5678895" } ], "reference": [ { "type": "PubMed", "id": "11146634", "url": "https://glygen.org/publication/PubMed/11146634" } ] }, { "title": "The cell-cycle regulatory protein Cks1 is required for SCF(Skp2)-mediated ubiquitinylation of p27.", "journal": "Nature cell biology", "date": "2001", "authors": "Ganoth D, Bornstein G, Ko TK, Larsen B, Tyers M, Pagano M, Hershko A", "evidence": [ { "database": "Reactome", "id": "R-HSA-187577", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-187577" } ], "reference": [ { "type": "PubMed", "id": "11231585", "url": "https://glygen.org/publication/PubMed/11231585" } ] }, { "title": "NF-kappaB-inducing kinase regulates the processing of NF-kappaB2 p100.", "journal": "Molecular cell", "date": "2001", "authors": "Xiao G, Harhaj EW, Sun SC", "evidence": [ { "database": "Reactome", "id": "R-HSA-5607761", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5607761" } ], "reference": [ { "type": "PubMed", "id": "11239468", "url": "https://glygen.org/publication/PubMed/11239468" } ] }, { "title": "Identification of two residues in MCM5 critical for the assembly of MCM complexes and Stat1-mediated transcription activation in response to IFN-gamma.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2001", "authors": "DaFonseca CJ, Shu F, Zhang JJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-68867", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-68867" } ], "reference": [ { "type": "PubMed", "id": "11248027", "url": "https://glygen.org/publication/PubMed/11248027" } ] }, { "title": "NUB1, a NEDD8-interacting protein, is induced by interferon and down-regulates the NEDD8 expression.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Kito K, Yeh ET, Kamitani T", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "11259415", "url": "https://glygen.org/publication/PubMed/11259415" } ] }, { "title": "Bcl10 and MALT1, independent targets of chromosomal translocation in malt lymphoma, cooperate in a novel NF-kappa B signaling pathway.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Lucas PC, Yonezumi M, Inohara N, McAllister-Lucas LM, Abazeed ME, Chen FF, Yamaoka S, Seto M, Nunez G", "evidence": [ { "database": "Reactome", "id": "R-HSA-5607764", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5607764" } ], "reference": [ { "type": "PubMed", "id": "11262391", "url": "https://glygen.org/publication/PubMed/11262391" } ] }, { "title": "Anaphase-promoting complex/cyclosome-dependent proteolysis of human cyclin A starts at the beginning of mitosis and is not subject to the spindle assembly checkpoint.", "journal": "The Journal of cell biology", "date": "2001", "authors": "Geley S, Kramer E, Gieffers C, Gannon J, Peters JM, Hunt T", "evidence": [ { "database": "Reactome", "id": "R-HSA-174184", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-174184" } ], "reference": [ { "type": "PubMed", "id": "11285280", "url": "https://glygen.org/publication/PubMed/11285280" } ] }, { "title": "Targeting of HIF-alpha to the von Hippel-Lindau ubiquitylation complex by O2-regulated prolyl hydroxylation.", "journal": "Science (New York, N.Y.)", "date": "2001", "authors": "Jaakkola P, Mole DR, Tian YM, Wilson MI, Gielbert J, Gaskell SJ, von Kriegsheim A, Hebestreit HF, Mukherji M, Schofield CJ, Maxwell PH, Pugh CW, Ratcliffe PJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-1234176", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1234176" } ], "reference": [ { "type": "PubMed", "id": "11292861", "url": "https://glygen.org/publication/PubMed/11292861" } ] }, { "title": "HIFalpha targeted for VHL-mediated destruction by proline hydroxylation: implications for O2 sensing.", "journal": "Science (New York, N.Y.)", "date": "2001", "authors": "Ivan M, Kondo K, Yang H, Kim W, Valiando J, Ohh M, Salic A, Asara JM, Lane WS, Kaelin WG Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-1234176", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1234176" } ], "reference": [ { "type": "PubMed", "id": "11292862", "url": "https://glygen.org/publication/PubMed/11292862" } ] }, { "title": "The ATM-Chk2-Cdc25A checkpoint pathway guards against radioresistant DNA synthesis.", "journal": "Nature", "date": "2001", "authors": "Falck J, Mailand N, Syljuasen RG, Bartek J, Lukas J", "evidence": [ { "database": "Reactome", "id": "R-HSA-69601", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69601" } ], "reference": [ { "type": "PubMed", "id": "11298456", "url": "https://glygen.org/publication/PubMed/11298456" } ] }, { "title": "Persistent activation of NF-kappa B by the tax transforming protein involves chronic phosphorylation of IkappaB kinase subunits IKKbeta and IKKgamma.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Carter RS, Geyer BC, Xie M, Acevedo-Suarez CA, Ballard DW", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871837" } ], "reference": [ { "type": "PubMed", "id": "11325957", "url": "https://glygen.org/publication/PubMed/11325957" } ] }, { "title": "26S proteasomes and immunoproteasomes produce mainly N-extended versions of an antigenic peptide.", "journal": "The EMBO journal", "date": "2001", "authors": "Cascio P, Hilton C, Kisselev AF, Rock KL, Goldberg AL", "evidence": [ { "database": "Reactome", "id": "R-HSA-983168", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983168" } ], "reference": [ { "type": "PubMed", "id": "11350924", "url": "https://glygen.org/publication/PubMed/11350924" } ] }, { "title": "Dynamic, site-specific interaction of hypoxia-inducible factor-1alpha with the von Hippel-Lindau tumor suppressor protein.", "journal": "Cancer research", "date": "2001", "authors": "Yu F, White SB, Zhao Q, Lee FS", "evidence": [ { "database": "Reactome", "id": "R-HSA-1234176", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1234176" } ], "reference": [ { "type": "PubMed", "id": "11358837", "url": "https://glygen.org/publication/PubMed/11358837" } ] }, { "title": "Protein kinase C theta is expressed in mast cells and is functionally involved in Fcepsilon receptor I signaling.", "journal": "Journal of leukocyte biology", "date": "2001", "authors": "Liu Y, Graham C, Parravicini V, Brown MJ, Rivera J, Shaw S", "evidence": [ { "database": "Reactome", "id": "R-HSA-202424", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202424" } ], "reference": [ { "type": "PubMed", "id": "11358993", "url": "https://glygen.org/publication/PubMed/11358993" } ] }, { "title": "Securin is required for chromosomal stability in human cells.", "journal": "Cell", "date": "2001", "authors": "Jallepalli PV, Waizenegger IC, Bunz F, Langer S, Speicher MR, Peters JM, Kinzler KW, Vogelstein B, Lengauer C", "evidence": [ { "database": "Reactome", "id": "R-HSA-2467813", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2467813" } ], "reference": [ { "type": "PubMed", "id": "11371342", "url": "https://glygen.org/publication/PubMed/11371342" } ] }, { "title": "Hypoxia-inducible factor-1 alpha (HIF-1 alpha) escapes O(2)-driven proteasomal degradation irrespective of its subcellular localization: nucleus or cytoplasm.", "journal": "EMBO reports", "date": "2001", "authors": "Berra E, Roux D, Richard DE, Pouyssegur J", "evidence": [ { "database": "Reactome", "id": "R-HSA-1234176", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1234176" } ], "reference": [ { "type": "PubMed", "id": "11454738", "url": "https://glygen.org/publication/PubMed/11454738" } ] }, { "title": "TAK1 is a ubiquitin-dependent kinase of MKK and IKK.", "journal": "Nature", "date": "2001", "authors": "Wang C, Deng L, Hong M, Akkaraju GR, Inoue J, Chen ZJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169091", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169091" } ], "reference": [ { "type": "PubMed", "id": "11460167", "url": "https://glygen.org/publication/PubMed/11460167" } ] }, { "title": "Skinny hedgehog, an acyltransferase required for palmitoylation and activity of the hedgehog signal.", "journal": "Science (New York, N.Y.)", "date": "2001", "authors": "Chamoun Z, Mann RK, Nellen D, von Kessler DP, Bellotto M, Beachy PA, Basler K", "evidence": [ { "database": "Reactome", "id": "R-HSA-5358346", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5358346" } ], "reference": [ { "type": "PubMed", "id": "11486055", "url": "https://glygen.org/publication/PubMed/11486055" } ] }, { "title": "Spred is a Sprouty-related suppressor of Ras signalling.", "journal": "Nature", "date": "2001", "authors": "Wakioka T, Sasaki A, Kato R, Shouda T, Matsumoto A, Miyoshi K, Tsuneoka M, Komiya S, Baron R, Yoshimura A", "evidence": [ { "database": "Reactome", "id": "R-HSA-5658442", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5658442" } ], "reference": [ { "type": "PubMed", "id": "11493923", "url": "https://glygen.org/publication/PubMed/11493923" } ] }, { "title": "Kinetics of P-glycoprotein-mediated efflux of paclitaxel.", "journal": "The Journal of pharmacology and experimental therapeutics", "date": "2001", "authors": "Jang SH, Wientjes MG, Au JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "11504826", "url": "https://glygen.org/publication/PubMed/11504826" } ] }, { "title": "HIF-1alpha binding to VHL is regulated by stimulus-sensitive proline hydroxylation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2001", "authors": "Yu F, White SB, Zhao Q, Lee FS", "evidence": [ { "database": "Reactome", "id": "R-HSA-1234176", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1234176" } ], "reference": [ { "type": "PubMed", "id": "11504942", "url": "https://glygen.org/publication/PubMed/11504942" } ] }, { "title": "Cohesin cleavage by separase required for anaphase and cytokinesis in human cells.", "journal": "Science (New York, N.Y.)", "date": "2001", "authors": "Hauf S, Waizenegger IC, Peters JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-2467813", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2467813" } ], "reference": [ { "type": "PubMed", "id": "11509732", "url": "https://glygen.org/publication/PubMed/11509732" } ] }, { "title": "Activation by IKKalpha of a second, evolutionary conserved, NF-kappa B signaling pathway.", "journal": "Science (New York, N.Y.)", "date": "2001", "authors": "Senftleben U, Cao Y, Xiao G, Greten FR, Krahn G, Bonizzi G, Chen Y, Hu Y, Fong A, Sun SC, Karin M", "evidence": [ { "database": "Reactome", "id": "R-HSA-5607761", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5607761" } ], "reference": [ { "type": "PubMed", "id": "11520989", "url": "https://glygen.org/publication/PubMed/11520989" } ] }, { "title": "Substrate recognition by the Cdc20 and Cdh1 components of the anaphase-promoting complex.", "journal": "Genes & development", "date": "2001", "authors": "Pfleger CM, Lee E, Kirschner MW", "evidence": [ { "database": "Reactome", "id": "R-HSA-68867", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-68867" } ], "reference": [ { "type": "PubMed", "id": "11562349", "url": "https://glygen.org/publication/PubMed/11562349" } ] }, { "title": "Na+:HCO(3-) cotransporters (NBC): cloning and characterization.", "journal": "The Journal of membrane biology", "date": "2001", "authors": "Soleimani M, Burnham CE", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "11562789", "url": "https://glygen.org/publication/PubMed/11562789" } ] }, { "title": "A novel active site-directed probe specific for deubiquitylating enzymes reveals proteasome association of USP14.", "journal": "The EMBO journal", "date": "2001", "authors": "Borodovsky A, Kessler BM, Casagrande R, Overkleeft HS, Wilkinson KD, Ploegh HL", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "11566882", "url": "https://glygen.org/publication/PubMed/11566882" } ] }, { "title": "Borg proteins control septin organization and are negatively regulated by Cdc42.", "journal": "Nature cell biology", "date": "2001", "authors": "Joberty G, Perlungher RR, Sheffield PJ, Kinoshita M, Noda M, Haystead T, Macara IG", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "11584266", "url": "https://glygen.org/publication/PubMed/11584266" } ] }, { "title": "Targeting of NEDD8 and its conjugates for proteasomal degradation by NUB1.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Kamitani T, Kito K, Fukuda-Kamitani T, Yeh ET", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "11585840", "url": "https://glygen.org/publication/PubMed/11585840" } ] }, { "title": "A conserved family of prolyl-4-hydroxylases that modify HIF.", "journal": "Science (New York, N.Y.)", "date": "2001", "authors": "Bruick RK, McKnight SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-1234176", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1234176" } ], "reference": [ { "type": "PubMed", "id": "11598268", "url": "https://glygen.org/publication/PubMed/11598268" } ] }, { "title": "Tyrosine residues in phospholipase Cgamma 2 essential for the enzyme function in B-cell signaling.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Rodriguez R, Matsuda M, Perisic O, Bravo J, Paul A, Jones NP, Light Y, Swann K, Williams RL, Katan M", "evidence": [ { "database": "Reactome", "id": "R-HSA-5607764", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5607764" } ], "reference": [ { "type": "PubMed", "id": "11606584", "url": "https://glygen.org/publication/PubMed/11606584" } ] }, { "title": "Mobilization of processed, membrane-tethered SPT23 transcription factor by CDC48(UFD1/NPL4), a ubiquitin-selective chaperone.", "journal": "Cell", "date": "2001", "authors": "Rape M, Hoppe T, Gorr I, Kalocay M, Richly H, Jentsch S", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "11733065", "url": "https://glygen.org/publication/PubMed/11733065" } ] }, { "title": "Mammalian Orc1 protein is selectively released from chromatin and ubiquitinated during the S-to-M transition in the cell division cycle.", "journal": "Molecular and cellular biology", "date": "2002", "authors": "Li CJ, DePamphilis ML", "evidence": [ { "database": "Reactome", "id": "R-HSA-68949", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-68949" } ], "reference": [ { "type": "PubMed", "id": "11739726", "url": "https://glygen.org/publication/PubMed/11739726" } ] }, { "title": "Phosphorylation of the protein kinase C-theta activation loop and hydrophobic motif regulates its kinase activity, but only activation loop phosphorylation is critical to in vivo nuclear-factor-kappaB induction.", "journal": "The Biochemical journal", "date": "2002", "authors": "Liu Y, Graham C, Li A, Fisher RJ, Shaw S", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871837" } ], "reference": [ { "type": "PubMed", "id": "11772397", "url": "https://glygen.org/publication/PubMed/11772397" } ] }, { "title": "Pak1 kinase homodimers are autoinhibited in trans and dissociated upon activation by Cdc42 and Rac1.", "journal": "Molecular cell", "date": "2002", "authors": "Parrini MC, Lei M, Harrison SC, Mayer BJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "11804587", "url": "https://glygen.org/publication/PubMed/11804587" } ] }, { "title": "A principal role for the proteasome in endoplasmic reticulum-associated degradation of misfolded intracellular cystic fibrosis transmembrane conductance regulator.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Gelman MS, Kannegaard ES, Kopito RR", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "11812794", "url": "https://glygen.org/publication/PubMed/11812794" } ] }, { "title": "Ubiquitin-dependent mechanism regulates rapid turnover of AU-rich cytokine mRNAs.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2002", "authors": "Laroia G, Sarkar B, Schneider RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-450408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-450408" } ], "reference": [ { "type": "PubMed", "id": "11842200", "url": "https://glygen.org/publication/PubMed/11842200" } ] }, { "title": "Nuclear import and export signals in control of the p53-related protein p73.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Inoue T, Stuart J, Leno R, Maki CG", "evidence": [ { "database": "Reactome", "id": "R-HSA-8939236", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8939236" } ], "reference": [ { "type": "PubMed", "id": "11847229", "url": "https://glygen.org/publication/PubMed/11847229" } ] }, { "title": "Regulation of the immune response by SHIP.", "journal": "Seminars in immunology", "date": "2002", "authors": "March ME, Ravichandran K", "evidence": [ { "database": "Reactome", "id": "R-HSA-202424", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202424" } ], "reference": [ { "type": "PubMed", "id": "11884229", "url": "https://glygen.org/publication/PubMed/11884229" } ] }, { "title": "Deubiquitination of p53 by HAUSP is an important pathway for p53 stabilization.", "journal": "Nature", "date": "2002", "authors": "Li M, Chen D, Shiloh A, Luo J, Nikolaev AY, Qin J, Gu W", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "11923872", "url": "https://glygen.org/publication/PubMed/11923872" } ] }, { "title": "Human origin recognition complex large subunit is degraded by ubiquitin-mediated proteolysis after initiation of DNA replication.", "journal": "Molecular cell", "date": "2002", "authors": "Mendez J, Zou-Yang XH, Kim SY, Hidaka M, Tansey WP, Stillman B", "evidence": [ { "database": "Reactome", "id": "R-HSA-68949", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-68949" } ], "reference": [ { "type": "PubMed", "id": "11931757", "url": "https://glygen.org/publication/PubMed/11931757" } ] }, { "title": "Suppressor of Fused represses Gli-mediated transcription by recruiting the SAP18-mSin3 corepressor complex.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2002", "authors": "Cheng SY, Bishop JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-5632684", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5632684" } ], "reference": [ { "type": "PubMed", "id": "11960000", "url": "https://glygen.org/publication/PubMed/11960000" } ] }, { "title": "IRAK-4: a novel member of the IRAK family with the properties of an IRAK-kinase.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2002", "authors": "Li S, Strelow A, Fontana EJ, Wesche H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9020702", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9020702" } ], "reference": [ { "type": "PubMed", "id": "11960013", "url": "https://glygen.org/publication/PubMed/11960013" } ] }, { "title": "Structure of the Cul1-Rbx1-Skp1-F boxSkp2 SCF ubiquitin ligase complex.", "journal": "Nature", "date": "2002", "authors": "Zheng N, Schulman BA, Song L, Miller JJ, Jeffrey PD, Wang P, Chu C, Koepp DM, Elledge SJ, Pagano M, Conaway RC, Conaway JW, Harper JW, Pavletich NP", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "11961546", "url": "https://glygen.org/publication/PubMed/11961546" } ] }, { "title": "Dapper, a Dishevelled-associated antagonist of beta-catenin and JNK signaling, is required for notochord formation.", "journal": "Developmental cell", "date": "2002", "authors": "Cheyette BN, Waxman JS, Miller JR, Takemaru K, Sheldahl LC, Khlebtsova N, Fox EP, Earnest T, Moon RT", "evidence": [ { "database": "Reactome", "id": "R-HSA-4641258", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4641258" } ], "reference": [ { "type": "PubMed", "id": "11970895", "url": "https://glygen.org/publication/PubMed/11970895" } ] }, { "title": "The Dlx5 and Dlx6 homeobox genes are essential for craniofacial, axial, and appendicular skeletal development.", "journal": "Genes & development", "date": "2002", "authors": "Robledo RF, Rajan L, Li X, Lufkin T", "evidence": [ { "database": "Reactome", "id": "R-HSA-8939902", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8939902" } ], "reference": [ { "type": "PubMed", "id": "12000792", "url": "https://glygen.org/publication/PubMed/12000792" } ] }, { "title": "Kremen proteins are Dickkopf receptors that regulate Wnt/beta-catenin signalling.", "journal": "Nature", "date": "2002", "authors": "Mao B, Wu W, Davidson G, Marhold J, Li M, Mechler BM, Delius H, Hoppe D, Stannek P, Walter C, Glinka A, Niehrs C", "evidence": [ { "database": "Reactome", "id": "R-HSA-5632684", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5632684" } ], "reference": [ { "type": "PubMed", "id": "12050670", "url": "https://glygen.org/publication/PubMed/12050670" } ] }, { "title": "Phagosome maturation: aging gracefully.", "journal": "The Biochemical journal", "date": "2002", "authors": "Vieira OV, Botelho RJ, Grinstein S", "evidence": [ { "database": "Reactome", "id": "R-HSA-1236978", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1236978" } ], "reference": [ { "type": "PubMed", "id": "12061891", "url": "https://glygen.org/publication/PubMed/12061891" } ] }, { "title": "Mutations in SUFU predispose to medulloblastoma.", "journal": "Nature genetics", "date": "2002", "authors": "Taylor MD, Liu L, Raffel C, Hui CC, Mainprize TG, Zhang X, Agatep R, Chiappa S, Gao L, Lowrance A, Hao A, Goldstein AM, Stavrou T, Scherer SW, Dura WT, Wainwright B, Squire JA, Rutka JT, Hogg D", "evidence": [ { "database": "Reactome", "id": "R-HSA-5632684", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5632684" } ], "reference": [ { "type": "PubMed", "id": "12068298", "url": "https://glygen.org/publication/PubMed/12068298" } ] }, { "title": "Human securin proteolysis is controlled by the spindle checkpoint and reveals when the APC/C switches from activation by Cdc20 to Cdh1.", "journal": "The Journal of cell biology", "date": "2002", "authors": "Hagting A, Den Elzen N, Vodermaier HC, Waizenegger IC, Peters JM, Pines J", "evidence": [ { "database": "Reactome", "id": "R-HSA-174154", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-174154" } ], "reference": [ { "type": "PubMed", "id": "12070128", "url": "https://glygen.org/publication/PubMed/12070128" } ] }, { "title": "Protein kinase C beta controls nuclear factor kappaB activation in B cells through selective regulation of the IkappaB kinase alpha.", "journal": "The Journal of experimental medicine", "date": "2002", "authors": "Saijo K, Mecklenbrauker I, Santana A, Leitger M, Schmedt C, Tarakhovsky A", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169091", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169091" } ], "reference": [ { "type": "PubMed", "id": "12070292", "url": "https://glygen.org/publication/PubMed/12070292" } ] }, { "title": "Oxygen-dependent ubiquitination and degradation of hypoxia-inducible factor requires nuclear-cytoplasmic trafficking of the von Hippel-Lindau tumor suppressor protein.", "journal": "Molecular and cellular biology", "date": "2002", "authors": "Groulx I, Lee S", "evidence": [ { "database": "Reactome", "id": "R-HSA-1234176", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1234176" } ], "reference": [ { "type": "PubMed", "id": "12101228", "url": "https://glygen.org/publication/PubMed/12101228" } ] }, { "title": "PKC-beta controls I kappa B kinase lipid raft recruitment and activation in response to BCR signaling.", "journal": "Nature immunology", "date": "2002", "authors": "Su TT, Guo B, Kawakami Y, Sommer K, Chae K, Humphries LA, Kato RM, Kang S, Patrone L, Wall R, Teitell M, Leitges M, Kawakami T, Rawlings DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169091", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169091" } ], "reference": [ { "type": "PubMed", "id": "12118249", "url": "https://glygen.org/publication/PubMed/12118249" } ] }, { "title": "Sonic hedgehog induces the segregation of patched and smoothened in endosomes.", "journal": "Current biology : CB", "date": "2002", "authors": "Incardona JP, Gruenberg J, Roelink H", "evidence": [ { "database": "Reactome", "id": "R-HSA-5632684", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5632684" } ], "reference": [ { "type": "PubMed", "id": "12123571", "url": "https://glygen.org/publication/PubMed/12123571" } ] }, { "title": "Alternate exon insertion controls selective ubiquitination and degradation of different AUF1 protein isoforms.", "journal": "Nucleic acids research", "date": "2002", "authors": "Laroia G, Schneider RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-450408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-450408" } ], "reference": [ { "type": "PubMed", "id": "12136087", "url": "https://glygen.org/publication/PubMed/12136087" } ] }, { "title": "Regulation of Gli1 transcriptional activity in the nucleus by Dyrk1.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Mao J, Maye P, Kogerman P, Tejedor FJ, Toftgard R, Xie W, Wu G, Wu D", "evidence": [ { "database": "Reactome", "id": "R-HSA-5632684", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5632684" } ], "reference": [ { "type": "PubMed", "id": "12138125", "url": "https://glygen.org/publication/PubMed/12138125" } ] }, { "title": "Analysis of the adenovirus E1B-55K-anchored proteome reveals its link to ubiquitination machinery.", "journal": "Journal of virology", "date": "2002", "authors": "Harada JN, Shevchenko A, Shevchenko A, Pallas DC, Berk AJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "12186903", "url": "https://glygen.org/publication/PubMed/12186903" } ] }, { "title": "Regulation of human separase by securin binding and autocleavage.", "journal": "Current biology : CB", "date": "2002", "authors": "Waizenegger I, Gimenez-Abian JF, Wernic D, Peters JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-2467813", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2467813" } ], "reference": [ { "type": "PubMed", "id": "12194817", "url": "https://glygen.org/publication/PubMed/12194817" } ] }, { "title": "Phosphorylation of Nrf2 at Ser-40 by protein kinase C regulates antioxidant response element-mediated transcription.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Huang HC, Nguyen T, Pickett CB", "evidence": [ { "database": "Reactome", "id": "R-HSA-9755511", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9755511" } ], "reference": [ { "type": "PubMed", "id": "12198130", "url": "https://glygen.org/publication/PubMed/12198130" } ] }, { "title": "Direct identification of PTEN phosphorylation sites.", "journal": "FEBS letters", "date": "2002", "authors": "Miller SJ, Lou DY, Seldin DC, Lane WS, Neel BG", "evidence": [ { "database": "Reactome", "id": "R-HSA-8948751", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8948751" } ], "reference": [ { "type": "PubMed", "id": "12297295", "url": "https://glygen.org/publication/PubMed/12297295" } ] }, { "title": "Biochemical purification and pharmacological inhibition of a mammalian prolyl hydroxylase acting on hypoxia-inducible factor.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2002", "authors": "Ivan M, Haberberger T, Gervasi DC, Michelson KS, Gunzler V, Kondo K, Yang H, Sorokina I, Conaway RC, Conaway JW, Kaelin WG Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-1234176", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1234176" } ], "reference": [ { "type": "PubMed", "id": "12351678", "url": "https://glygen.org/publication/PubMed/12351678" } ] }, { "title": "Structural elements of antizymes 1 and 2 are required for proteasomal degradation of ornithine decarboxylase.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Chen H, MacDonald A, Coffino P", "evidence": [ { "database": "Reactome", "id": "R-HSA-350562", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-350562" } ], "reference": [ { "type": "PubMed", "id": "12359729", "url": "https://glygen.org/publication/PubMed/12359729" } ] }, { "title": "Functional analysis of ABCA8, a new drug transporter.", "journal": "Biochemical and biophysical research communications", "date": "2002", "authors": "Tsuruoka S, Ishibashi K, Yamamoto H, Wakaumi M, Suzuki M, Schwartz GJ, Imai M, Fujimura A", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "12379217", "url": "https://glygen.org/publication/PubMed/12379217" } ] }, { "title": "The role of the efflux transporter P-glycoprotein in brain penetration of prednisolone.", "journal": "The Journal of endocrinology", "date": "2002", "authors": "Karssen AM, Meijer OC, van der Sandt IC, De Boer AG, De Lange EC, De Kloet ER", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "12379510", "url": "https://glygen.org/publication/PubMed/12379510" } ] }, { "title": "The cystic fibrosis transmembrane conductance regulator interacts with and regulates the activity of the HCO3- salvage transporter human Na+-HCO3- cotransport isoform 3.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Park M, Ko SB, Choi JY, Muallem G, Thomas PJ, Pushkin A, Lee MS, Kim JY, Lee MG, Muallem S, Kurtz I", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "12403779", "url": "https://glygen.org/publication/PubMed/12403779" } ] }, { "title": "Characterization of the physical interaction of Gli proteins with SUFU proteins.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Dunaeva M, Michelson P, Kogerman P, Toftgard R", "evidence": [ { "database": "Reactome", "id": "R-HSA-5632684", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5632684" } ], "reference": [ { "type": "PubMed", "id": "12426310", "url": "https://glygen.org/publication/PubMed/12426310" } ] }, { "title": "The D-Box-activating domain (DAD) is a new proteolysis signal that stimulates the silent D-Box sequence of Aurora-A.", "journal": "EMBO reports", "date": "2002", "authors": "Castro A, Vigneron S, Bernis C, Labbe JC, Prigent C, Lorca T", "evidence": [ { "database": "Reactome", "id": "R-HSA-174178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-174178" } ], "reference": [ { "type": "PubMed", "id": "12446569", "url": "https://glygen.org/publication/PubMed/12446569" } ] }, { "title": "Protein kinase C delta (PKC delta): activation mechanisms and functions.", "journal": "Journal of biochemistry", "date": "2002", "authors": "Kikkawa U, Matsuzaki H, Yamamoto T", "evidence": [ { "database": "Reactome", "id": "R-HSA-5607764", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5607764" } ], "reference": [ { "type": "PubMed", "id": "12473183", "url": "https://glygen.org/publication/PubMed/12473183" } ] }, { "title": "Protein kinase C-theta (PKC theta): a key enzyme in T cell life and death.", "journal": "Journal of biochemistry", "date": "2002", "authors": "Altman A, Villalba M", "evidence": [ { "database": "Reactome", "id": "R-HSA-202424", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202424" } ], "reference": [ { "type": "PubMed", "id": "12473184", "url": "https://glygen.org/publication/PubMed/12473184" } ] }, { "title": "Pellino 1 is required for interleukin-1 (IL-1)-mediated signaling through its interaction with the IL-1 receptor-associated kinase 4 (IRAK4)-IRAK-tumor necrosis factor receptor-associated factor 6 (TRAF6) complex.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Jiang Z, Johnson HJ, Nie H, Qin J, Bird TA, Li X", "evidence": [ { "database": "Reactome", "id": "R-HSA-9020702", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9020702" } ], "reference": [ { "type": "PubMed", "id": "12496252", "url": "https://glygen.org/publication/PubMed/12496252" } ] }, { "title": "NEDD8 modification of CUL1 dissociates p120(CAND1), an inhibitor of CUL1-SKP1 binding and SCF ligases.", "journal": "Molecular cell", "date": "2002", "authors": "Liu J, Furukawa M, Matsumoto T, Xiong Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "12504025", "url": "https://glygen.org/publication/PubMed/12504025" } ] }, { "title": "CAND1 binds to unneddylated CUL1 and regulates the formation of SCF ubiquitin E3 ligase complex.", "journal": "Molecular cell", "date": "2002", "authors": "Zheng J, Yang X, Harrell JM, Ryzhikov S, Shim EH, Lykke-Andersen K, Wei N, Sun H, Kobayashi R, Zhang H", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "12504026", "url": "https://glygen.org/publication/PubMed/12504026" } ] }, { "title": "Parc: a cytoplasmic anchor for p53.", "journal": "Cell", "date": "2003", "authors": "Nikolaev AY, Li M, Puskas N, Qin J, Gu W", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "12526791", "url": "https://glygen.org/publication/PubMed/12526791" } ] }, { "title": "Multiple splice variants of the human HIF-3 alpha locus are targets of the von Hippel-Lindau E3 ubiquitin ligase complex.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Maynard MA, Qi H, Chung J, Lee EH, Kondo Y, Hara S, Conaway RC, Conaway JW, Ohh M", "evidence": [ { "database": "Reactome", "id": "R-HSA-1234176", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1234176" } ], "reference": [ { "type": "PubMed", "id": "12538644", "url": "https://glygen.org/publication/PubMed/12538644" } ] }, { "title": "Inhibition of interleukin 1 receptor/Toll-like receptor signaling through the alternatively spliced, short form of MyD88 is due to its failure to recruit IRAK-4.", "journal": "The Journal of experimental medicine", "date": "2003", "authors": "Burns K, Janssens S, Brissoni B, Olivos N, Beyaert R, Tschopp J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9020702", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9020702" } ], "reference": [ { "type": "PubMed", "id": "12538665", "url": "https://glygen.org/publication/PubMed/12538665" } ] }, { "title": "Rapid induction of dendritic spine morphogenesis by trans-synaptic ephrinB-EphB receptor activation of the Rho-GEF kalirin.", "journal": "Neuron", "date": "2003", "authors": "Penzes P, Beeser A, Chernoff J, Schiller MR, Eipper BA, Mains RE, Huganir RL", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "12546821", "url": "https://glygen.org/publication/PubMed/12546821" } ] }, { "title": "Structural basis for recruitment of glycogen synthase kinase 3beta to the axin-APC scaffold complex.", "journal": "The EMBO journal", "date": "2003", "authors": "Dajani R, Fraser E, Roe SM, Yeo M, Good VM, Thompson V, Dale TC, Pearl LH", "evidence": [ { "database": "Reactome", "id": "R-HSA-195253", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-195253" } ], "reference": [ { "type": "PubMed", "id": "12554650", "url": "https://glygen.org/publication/PubMed/12554650" } ] }, { "title": "Dynamic regulation of the Ras pathway via proteolysis of the NF1 tumor suppressor.", "journal": "Genes & development", "date": "2003", "authors": "Cichowski K, Santiago S, Jardim M, Johnson BW, Jacks T", "evidence": [ { "database": "Reactome", "id": "R-HSA-5658442", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5658442" } ], "reference": [ { "type": "PubMed", "id": "12600938", "url": "https://glygen.org/publication/PubMed/12600938" } ] }, { "title": "Distribution of STI-571 to the brain is limited by P-glycoprotein-mediated efflux.", "journal": "The Journal of pharmacology and experimental therapeutics", "date": "2003", "authors": "Dai H, Marbach P, Lemaire M, Hayes M, Elmquist WF", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "12604685", "url": "https://glygen.org/publication/PubMed/12604685" } ] }, { "title": "TIP120A associates with cullins and modulates ubiquitin ligase activity.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Min KW, Hwang JW, Lee JS, Park Y, Tamura TA, Yoon JB", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "12609982", "url": "https://glygen.org/publication/PubMed/12609982" } ] }, { "title": "Intracellular localisation of human HIF-1 alpha hydroxylases: implications for oxygen sensing.", "journal": "Journal of cell science", "date": "2003", "authors": "Metzen E, Berchner-Pfannschmidt U, Stengel P, Marxsen JH, Stolze I, Klinger M, Huang WQ, Wotzlaw C, Hellwig-Burgel T, Jelkmann W, Acker H, Fandrey J", "evidence": [ { "database": "Reactome", "id": "R-HSA-1234176", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1234176" } ], "reference": [ { "type": "PubMed", "id": "12615973", "url": "https://glygen.org/publication/PubMed/12615973" } ] }, { "title": "U-box proteins as a new family of ubiquitin ligases.", "journal": "Biochemical and biophysical research communications", "date": "2003", "authors": "Hatakeyama S, Nakayama KI", "evidence": [ { "database": "Reactome", "id": "R-HSA-983168", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983168" } ], "reference": [ { "type": "PubMed", "id": "12646216", "url": "https://glygen.org/publication/PubMed/12646216" } ] }, { "title": "Molecular cloning of mammalian Spred-3 which suppresses tyrosine kinase-mediated Erk activation.", "journal": "Biochemical and biophysical research communications", "date": "2003", "authors": "Kato R, Nonami A, Taketomi T, Wakioka T, Kuroiwa A, Matsuda Y, Yoshimura A", "evidence": [ { "database": "Reactome", "id": "R-HSA-5658442", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5658442" } ], "reference": [ { "type": "PubMed", "id": "12646235", "url": "https://glygen.org/publication/PubMed/12646235" } ] }, { "title": "Determinants of proteasome recognition of ornithine decarboxylase, a ubiquitin-independent substrate.", "journal": "The EMBO journal", "date": "2003", "authors": "Zhang M, Pickart CM, Coffino P", "evidence": [ { "database": "Reactome", "id": "R-HSA-350562", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-350562" } ], "reference": [ { "type": "PubMed", "id": "12660156", "url": "https://glygen.org/publication/PubMed/12660156" } ] }, { "title": "The role of PI3K in immune cells.", "journal": "Nature immunology", "date": "2003", "authors": "Koyasu S", "evidence": [ { "database": "Reactome", "id": "R-HSA-202424", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202424" } ], "reference": [ { "type": "PubMed", "id": "12660731", "url": "https://glygen.org/publication/PubMed/12660731" } ] }, { "title": "Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides.", "journal": "Nat. Biotechnol.", "date": "2003", "authors": "Gevaert K, Goethals M, Martens L, Van Damme J, Staes A, Thomas GR, Vandekerckhove J", "evidence": [ { "database": "UniProtKB", "id": "O00231", "url": "https://www.uniprot.org/uniprot/O00231" } ], "reference": [ { "type": "PubMed", "id": "12665801", "url": "https://glygen.org/publication/PubMed/12665801" } ] }, { "title": "Keap1-dependent proteasomal degradation of transcription factor Nrf2 contributes to the negative regulation of antioxidant response element-driven gene expression.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "McMahon M, Itoh K, Yamamoto M, Hayes JD", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "12682069", "url": "https://glygen.org/publication/PubMed/12682069" } ] }, { "title": "Atypical protein kinase C mediates activation of NF-E2-related factor 2 in response to oxidative stress.", "journal": "American journal of physiology. Cell physiology", "date": "2003", "authors": "Numazawa S, Ishikawa M, Yoshida A, Tanaka S, Yoshida T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9755511", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9755511" } ], "reference": [ { "type": "PubMed", "id": "12700136", "url": "https://glygen.org/publication/PubMed/12700136" } ] }, { "title": "Identification of Vangl2 and Scrb1 as planar polarity genes in mammals.", "journal": "Nature", "date": "2003", "authors": "Montcouquiol M, Rachel RA, Lanford PJ, Copeland NG, Jenkins NA, Kelley MW", "evidence": [ { "database": "Reactome", "id": "R-HSA-4608870", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4608870" } ], "reference": [ { "type": "PubMed", "id": "12724779", "url": "https://glygen.org/publication/PubMed/12724779" } ] }, { "title": "E3 ubiquitin ligase Smurf1 mediates core-binding factor alpha1/Runx2 degradation and plays a specific role in osteoblast differentiation.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Zhao M, Qiao M, Oyajobi BO, Mundy GR, Chen D", "evidence": [ { "database": "Reactome", "id": "R-HSA-8939902", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8939902" } ], "reference": [ { "type": "PubMed", "id": "12738770", "url": "https://glygen.org/publication/PubMed/12738770" } ] }, { "title": "The cell cycle-regulated protein human GTSE-1 controls DNA damage-induced apoptosis by affecting p53 function.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Monte M, Benetti R, Buscemi G, Sandy P, Del Sal G, Schneider C", "evidence": [ { "database": "Reactome", "id": "R-HSA-69481", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69481" } ], "reference": [ { "type": "PubMed", "id": "12750368", "url": "https://glygen.org/publication/PubMed/12750368" } ] }, { "title": "DEN1 is a dual function protease capable of processing the C terminus of Nedd8 and deconjugating hyper-neddylated CUL1.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Wu K, Yamoah K, Dolios G, Gan-Erdene T, Tan P, Chen A, Lee CG, Wei N, Wilkinson KD, Wang R, Pan ZQ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "12759363", "url": "https://glygen.org/publication/PubMed/12759363" } ] }, { "title": "Structural fingerprints of the Ras-GTPase activating proteins neurofibromin and p120GAP.", "journal": "Journal of molecular biology", "date": "2003", "authors": "Ahmadian MR, Kiel C, Stege P, Scheffzek K", "evidence": [ { "database": "Reactome", "id": "R-HSA-5658442", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5658442" } ], "reference": [ { "type": "PubMed", "id": "12787671", "url": "https://glygen.org/publication/PubMed/12787671" } ] }, { "title": "Characterization of the human prolyl 4-hydroxylases that modify the hypoxia-inducible factor.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Hirsila M, Koivunen P, Gunzler V, Kivirikko KI, Myllyharju J", "evidence": [ { "database": "Reactome", "id": "R-HSA-1234176", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1234176" } ], "reference": [ { "type": "PubMed", "id": "12788921", "url": "https://glygen.org/publication/PubMed/12788921" } ] }, { "title": "Prophase destruction of Emi1 by the SCF(betaTrCP/Slimb) ubiquitin ligase activates the anaphase promoting complex to allow progression beyond prometaphase.", "journal": "Developmental cell", "date": "2003", "authors": "Margottin-Goguet F, Hsu JY, Loktev A, Hsieh HM, Reimann JD, Jackson PK", "evidence": [ { "database": "Reactome", "id": "R-HSA-174113", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-174113" } ], "reference": [ { "type": "PubMed", "id": "12791267", "url": "https://glygen.org/publication/PubMed/12791267" } ] }, { "title": "Differential phosphorylation of the signal-responsive domain of I kappa B alpha and I kappa B beta by I kappa B kinases.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Wu C, Ghosh S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9020702", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9020702" } ], "reference": [ { "type": "PubMed", "id": "12791687", "url": "https://glygen.org/publication/PubMed/12791687" } ] }, { "title": "Rapid turnover of extracellular signal-regulated kinase 3 by the ubiquitin-proteasome pathway defines a novel paradigm of mitogen-activated protein kinase regulation during cellular differentiation.", "journal": "Molecular and cellular biology", "date": "2003", "authors": "Coulombe P, Rodier G, Pelletier S, Pellerin J, Meloche S", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "12808096", "url": "https://glygen.org/publication/PubMed/12808096" } ] }, { "title": "Regulation of the NEDD8 conjugation system by a splicing variant, NUB1L.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Tanaka T, Kawashima H, Yeh ET, Kamitani T", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "12816948", "url": "https://glygen.org/publication/PubMed/12816948" } ] }, { "title": "Regulation of A + U-rich element-directed mRNA turnover involving reversible phosphorylation of AUF1.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Wilson GM, Lu J, Sutphen K, Sun Y, Huynh Y, Brewer G", "evidence": [ { "database": "Reactome", "id": "R-HSA-450408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-450408" } ], "reference": [ { "type": "PubMed", "id": "12819195", "url": "https://glygen.org/publication/PubMed/12819195" } ] }, { "title": "Structure of a beta-TrCP1-Skp1-beta-catenin complex: destruction motif binding and lysine specificity of the SCF(beta-TrCP1) ubiquitin ligase.", "journal": "Molecular cell", "date": "2003", "authors": "Wu G, Xu G, Schulman BA, Jeffrey PD, Harper JW, Pavletich NP", "evidence": [ { "database": "Reactome", "id": "R-HSA-195253", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-195253" } ], "reference": [ { "type": "PubMed", "id": "12820959", "url": "https://glygen.org/publication/PubMed/12820959" } ] }, { "title": "Role of nuclear and cytoplasmic localization in the tumour-suppressor activity of the von Hippel-Lindau protein.", "journal": "Oncogene", "date": "2003", "authors": "Lewis MD, Roberts BJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-1234176", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1234176" } ], "reference": [ { "type": "PubMed", "id": "12821933", "url": "https://glygen.org/publication/PubMed/12821933" } ] }, { "title": "Caspase-activated PAK-2 is regulated by subcellular targeting and proteasomal degradation.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Jakobi R, McCarthy CC, Koeppel MA, Stringer DK", "evidence": [ { "database": "Reactome", "id": "R-HSA-211733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211733" } ], "reference": [ { "type": "PubMed", "id": "12853446", "url": "https://glygen.org/publication/PubMed/12853446" } ] }, { "title": "Characterization of Pellino2, a substrate of IRAK1 and IRAK4.", "journal": "FEBS letters", "date": "2003", "authors": "Strelow A, Kollewe C, Wesche H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9020702", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9020702" } ], "reference": [ { "type": "PubMed", "id": "12860405", "url": "https://glygen.org/publication/PubMed/12860405" } ] }, { "title": "HIF prolyl-hydroxylase 2 is the key oxygen sensor setting low steady-state levels of HIF-1alpha in normoxia.", "journal": "The EMBO journal", "date": "2003", "authors": "Berra E, Benizri E, Ginouves A, Volmat V, Roux D, Pouyssegur J", "evidence": [ { "database": "Reactome", "id": "R-HSA-1234176", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1234176" } ], "reference": [ { "type": "PubMed", "id": "12912907", "url": "https://glygen.org/publication/PubMed/12912907" } ] }, { "title": "Nuclear export of ERK3 by a CRM1-dependent mechanism regulates its inhibitory action on cell cycle progression.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Julien C, Coulombe P, Meloche S", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "12915405", "url": "https://glygen.org/publication/PubMed/12915405" } ] }, { "title": "CYLD is a deubiquitinating enzyme that negatively regulates NF-kappaB activation by TNFR family members.", "journal": "Nature", "date": "2003", "authors": "Trompouki E, Hatzivassiliou E, Tsichritzis T, Farmer H, Ashworth A, Mosialos G", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "12917689", "url": "https://glygen.org/publication/PubMed/12917689" } ] }, { "title": "The tumour suppressor CYLD negatively regulates NF-kappaB signalling by deubiquitination.", "journal": "Nature", "date": "2003", "authors": "Kovalenko A, Chable-Bessia C, Cantarella G, Israel A, Wallach D, Courtois G", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "12917691", "url": "https://glygen.org/publication/PubMed/12917691" } ] }, { "title": "Stat1 functions as a cytoplasmic attenuator of Runx2 in the transcriptional program of osteoblast differentiation.", "journal": "Genes & development", "date": "2003", "authors": "Kim S, Koga T, Isobe M, Kern BE, Yokochi T, Chin YE, Karsenty G, Taniguchi T, Takayanagi H", "evidence": [ { "database": "Reactome", "id": "R-HSA-8939902", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8939902" } ], "reference": [ { "type": "PubMed", "id": "12923053", "url": "https://glygen.org/publication/PubMed/12923053" } ] }, { "title": "Demonstration that a human 26S proteolytic complex consists of a proteasome and multiple associated protein components and hydrolyzes ATP and ubiquitin-ligated proteins by closely linked mechanisms.", "journal": "European journal of biochemistry", "date": "1992", "authors": "Kanayama HO, Tamura T, Ugai S, Kagawa S, Tanahashi N, Yoshimura T, Tanaka K, Ichihara A", "evidence": [ { "database": "UniProtKB", "id": "O00231", "url": "https://www.uniprot.org/uniprot/O00231" } ], "reference": [ { "type": "PubMed", "id": "1317798", "url": "https://glygen.org/publication/PubMed/1317798" } ] }, { "title": "Efficient inhibition of P-glycoprotein-mediated multidrug resistance with a monoclonal antibody.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1992", "authors": "Mechetner EB, Roninson IB", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "1352877", "url": "https://glygen.org/publication/PubMed/1352877" } ] }, { "title": "Partial purification and reconstitution of the human multidrug-resistance pump: characterization of the drug-stimulatable ATP hydrolysis.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1992", "authors": "Ambudkar SV, Lelong IH, Zhang J, Cardarelli CO, Gottesman MM, Pastan I", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "1356264", "url": "https://glygen.org/publication/PubMed/1356264" } ] }, { "title": "P-glycoprotein but not topoisomerase II and glutathione-S-transferase-pi accounts for enhanced intracellular drug-resistance in LoVo MDR human cell lines.", "journal": "Tumori", "date": "1992", "authors": "Boiocchi M, Tumiotto L, Giannini F, Viel A, Biscontin G, Sartor F, Toffoli G", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "1359686", "url": "https://glygen.org/publication/PubMed/1359686" } ] }, { "title": "Phosphorylation of the cystic fibrosis transmembrane conductance regulator.", "journal": "The Journal of biological chemistry", "date": "1992", "authors": "Picciotto MR, Cohn JA, Bertuzzi G, Greengard P, Nairn AC", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "1377674", "url": "https://glygen.org/publication/PubMed/1377674" } ] }, { "title": "Signal-induced ubiquitination of I kappaB Kinase-beta.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Carter RS, Pennington KN, Ungurait BJ, Arrate P, Ballard DW", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871837" } ], "reference": [ { "type": "PubMed", "id": "14514672", "url": "https://glygen.org/publication/PubMed/14514672" } ] }, { "title": "Nrf2 is a direct PERK substrate and effector of PERK-dependent cell survival.", "journal": "Molecular and cellular biology", "date": "2003", "authors": "Cullinan SB, Zhang D, Hannink M, Arvisais E, Kaufman RJ, Diehl JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9755511", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9755511" } ], "reference": [ { "type": "PubMed", "id": "14517290", "url": "https://glygen.org/publication/PubMed/14517290" } ] }, { "title": "The antiretroviral enzyme APOBEC3G is degraded by the proteasome in response to HIV-1 Vif.", "journal": "Nature medicine", "date": "2003", "authors": "Sheehy AM, Gaddis NC, Malim MH", "evidence": [ { "database": "Reactome", "id": "R-HSA-180585", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-180585" } ], "reference": [ { "type": "PubMed", "id": "14528300", "url": "https://glygen.org/publication/PubMed/14528300" } ] }, { "title": "Targeting of protein ubiquitination by BTB-Cullin 3-Roc1 ubiquitin ligases.", "journal": "Nature cell biology", "date": "2003", "authors": "Furukawa M, He YJ, Borchers C, Xiong Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-5632684", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5632684" } ], "reference": [ { "type": "PubMed", "id": "14528312", "url": "https://glygen.org/publication/PubMed/14528312" } ] }, { "title": "Induction of APOBEC3G ubiquitination and degradation by an HIV-1 Vif-Cul5-SCF complex.", "journal": "Science (New York, N.Y.)", "date": "2003", "authors": "Yu X, Yu Y, Liu B, Luo K, Kong W, Mao P, Yu XF", "evidence": [ { "database": "Reactome", "id": "R-HSA-180585", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-180585" } ], "reference": [ { "type": "PubMed", "id": "14564014", "url": "https://glygen.org/publication/PubMed/14564014" } ] }, { "title": "Distinct cysteine residues in Keap1 are required for Keap1-dependent ubiquitination of Nrf2 and for stabilization of Nrf2 by chemopreventive agents and oxidative stress.", "journal": "Molecular and cellular biology", "date": "2003", "authors": "Zhang DD, Hannink M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9755511", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9755511" } ], "reference": [ { "type": "PubMed", "id": "14585973", "url": "https://glygen.org/publication/PubMed/14585973" } ] }, { "title": "The negative regulator of Gli, Suppressor of fused (Sufu), interacts with SAP18, Galectin3 and other nuclear proteins.", "journal": "The Biochemical journal", "date": "2004", "authors": "Paces-Fessy M, Boucher D, Petit E, Paute-Briand S, Blanchet-Tournier MF", "evidence": [ { "database": "Reactome", "id": "R-HSA-5632684", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5632684" } ], "reference": [ { "type": "PubMed", "id": "14611647", "url": "https://glygen.org/publication/PubMed/14611647" } ] }, { "title": "Sequential autophosphorylation steps in the interleukin-1 receptor-associated kinase-1 regulate its availability as an adapter in interleukin-1 signaling.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Kollewe C, Mackensen AC, Neumann D, Knop J, Cao P, Li S, Wesche H, Martin MU", "evidence": [ { "database": "Reactome", "id": "R-HSA-9020702", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9020702" } ], "reference": [ { "type": "PubMed", "id": "14625308", "url": "https://glygen.org/publication/PubMed/14625308" } ] }, { "title": "Two isoforms of otubain 1 regulate T cell anergy via GRAIL.", "journal": "Nature immunology", "date": "2004", "authors": "Soares L, Seroogy C, Skrenta H, Anandasabapathy N, Lovelace P, Chung CD, Engleman E, Fathman CG", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "14661020", "url": "https://glygen.org/publication/PubMed/14661020" } ] }, { "title": "Structural determinants of P-glycoprotein-mediated transport of glucocorticoids.", "journal": "Pharmaceutical research", "date": "2003", "authors": "Yates CR, Chang C, Kearbey JD, Yasuda K, Schuetz EG, Miller DD, Dalton JT, Swaan PW", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "14661924", "url": "https://glygen.org/publication/PubMed/14661924" } ] }, { "title": "The regulated association of Cdt1 with minichromosome maintenance proteins and Cdc6 in mammalian cells.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Cook JG, Chasse DA, Nevins JR", "evidence": [ { "database": "Reactome", "id": "R-HSA-68867", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-68867" } ], "reference": [ { "type": "PubMed", "id": "14672932", "url": "https://glygen.org/publication/PubMed/14672932" } ] }, { "title": "Mechanism of processing of the NF-kappa B2 p100 precursor: identification of the specific polyubiquitin chain-anchoring lysine residue and analysis of the role of NEDD8-modification on the SCF(beta-TrCP) ubiquitin ligase.", "journal": "Oncogene", "date": "2004", "authors": "Amir RE, Haecker H, Karin M, Ciechanover A", "evidence": [ { "database": "Reactome", "id": "R-HSA-5607761", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5607761" } ], "reference": [ { "type": "PubMed", "id": "14676825", "url": "https://glygen.org/publication/PubMed/14676825" } ] }, { "title": "NEDL1, a novel ubiquitin-protein isopeptide ligase for dishevelled-1, targets mutant superoxide dismutase-1.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Miyazaki K, Fujita T, Ozaki T, Kato C, Kurose Y, Sakamoto M, Kato S, Goto T, Itoyama Y, Aoki M, Nakagawara A", "evidence": [ { "database": "Reactome", "id": "R-HSA-4641258", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4641258" } ], "reference": [ { "type": "PubMed", "id": "14684739", "url": "https://glygen.org/publication/PubMed/14684739" } ] }, { "title": "Regulation of heme oxygenase-1 expression through the phosphatidylinositol 3-kinase/Akt pathway and the Nrf2 transcription factor in response to the antioxidant phytochemical carnosol.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Martin D, Rojo AI, Salinas M, Diaz R, Gallardo G, Alam J, De Galarreta CM, Cuadrado A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9755511", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9755511" } ], "reference": [ { "type": "PubMed", "id": "14688281", "url": "https://glygen.org/publication/PubMed/14688281" } ] }, { "title": "The structure of the APPBP1-UBA3-NEDD8-ATP complex reveals the basis for selective ubiquitin-like protein activation by an E1.", "journal": "Molecular cell", "date": "2003", "authors": "Walden H, Podgorski MS, Huang DT, Miller DW, Howard RJ, Minor DL Jr, Holton JM, Schulman BA", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "14690597", "url": "https://glygen.org/publication/PubMed/14690597" } ] }, { "title": "Bcl10 activates the NF-kappaB pathway through ubiquitination of NEMO.", "journal": "Nature", "date": "2004", "authors": "Zhou H, Wertz I, O'Rourke K, Ultsch M, Seshagiri S, Eby M, Xiao W, Dixit VM", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169091", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169091" } ], "reference": [ { "type": "PubMed", "id": "14695475", "url": "https://glygen.org/publication/PubMed/14695475" } ] }, { "title": "hGTSE-1 expression stimulates cytoplasmic localization of p53.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Monte M, Benetti R, Collavin L, Marchionni L, Del Sal G, Schneider C", "evidence": [ { "database": "Reactome", "id": "R-HSA-69481", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69481" } ], "reference": [ { "type": "PubMed", "id": "14707141", "url": "https://glygen.org/publication/PubMed/14707141" } ] }, { "title": "Proteasome and peptidase function in MHC-class-I-mediated antigen presentation.", "journal": "Current opinion in immunology", "date": "2004", "authors": "Kloetzel PM, Ossendorp F", "evidence": [ { "database": "Reactome", "id": "R-HSA-983168", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983168" } ], "reference": [ { "type": "PubMed", "id": "14734113", "url": "https://glygen.org/publication/PubMed/14734113" } ] }, { "title": "NEDD8 ultimate buster-1L interacts with the ubiquitin-like protein FAT10 and accelerates its degradation.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Hipp MS, Raasi S, Groettrup M, Schmidtke G", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "14757770", "url": "https://glygen.org/publication/PubMed/14757770" } ] }, { "title": "Protection against electrophile and oxidant stress by induction of the phase 2 response: fate of cysteines of the Keap1 sensor modified by inducers.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2004", "authors": "Wakabayashi N, Dinkova-Kostova AT, Holtzclaw WD, Kang MI, Kobayashi A, Yamamoto M, Kensler TW, Talalay P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9755511", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9755511" } ], "reference": [ { "type": "PubMed", "id": "14764894", "url": "https://glygen.org/publication/PubMed/14764894" } ] }, { "title": "Degradation of the SCF component Skp2 in cell-cycle phase G1 by the anaphase-promoting complex.", "journal": "Nature", "date": "2004", "authors": "Wei W, Ayad NG, Wan Y, Zhang GJ, Kirschner MW, Kaelin WG Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-174178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-174178" } ], "reference": [ { "type": "PubMed", "id": "15014503", "url": "https://glygen.org/publication/PubMed/15014503" } ] }, { "title": "Mammalian Cdh1/Fzr mediates its own degradation.", "journal": "The EMBO journal", "date": "2004", "authors": "Listovsky T, Oren YS, Yudkovsky Y, Mahbubani HM, Weiss AM, Lebendiker M, Brandeis M", "evidence": [ { "database": "Reactome", "id": "R-HSA-174084", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-174084" } ], "reference": [ { "type": "PubMed", "id": "15029244", "url": "https://glygen.org/publication/PubMed/15029244" } ] }, { "title": "A dynamic role of HAUSP in the p53-Mdm2 pathway.", "journal": "Molecular cell", "date": "2004", "authors": "Li M, Brooks CL, Kon N, Gu W", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "15053880", "url": "https://glygen.org/publication/PubMed/15053880" } ] }, { "title": "Palmitoylation is required for the production of a soluble multimeric Hedgehog protein complex and long-range signaling in vertebrates.", "journal": "Genes & development", "date": "2004", "authors": "Chen MH, Li YJ, Kawakami T, Xu SM, Chuang PT", "evidence": [ { "database": "Reactome", "id": "R-HSA-5358346", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5358346" } ], "reference": [ { "type": "PubMed", "id": "15075292", "url": "https://glygen.org/publication/PubMed/15075292" } ] }, { "title": "Regulation of the NF-kappaB-inducing kinase by tumor necrosis factor receptor-associated factor 3-induced degradation.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Liao G, Zhang M, Harhaj EW, Sun SC", "evidence": [ { "database": "Reactome", "id": "R-HSA-5668541", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5668541" } ], "reference": [ { "type": "PubMed", "id": "15084608", "url": "https://glygen.org/publication/PubMed/15084608" } ] }, { "title": "Mechanism of diacylglycerol-induced membrane targeting and activation of protein kinase Cdelta.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Stahelin RV, Digman MA, Medkova M, Ananthanarayanan B, Rafter JD, Melowic HR, Cho W", "evidence": [ { "database": "Reactome", "id": "R-HSA-5607764", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5607764" } ], "reference": [ { "type": "PubMed", "id": "15105418", "url": "https://glygen.org/publication/PubMed/15105418" } ] }, { "title": "The zebrafish iguana locus encodes Dzip1, a novel zinc-finger protein required for proper regulation of Hedgehog signaling.", "journal": "Development (Cambridge, England)", "date": "2004", "authors": "Sekimizu K, Nishioka N, Sasaki H, Takeda H, Karlstrom RO, Kawakami A", "evidence": [ { "database": "Reactome", "id": "R-HSA-5632684", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5632684" } ], "reference": [ { "type": "PubMed", "id": "15115751", "url": "https://glygen.org/publication/PubMed/15115751" } ] }, { "title": "CARMA1, BCL-10 and MALT1 in lymphocyte development and activation.", "journal": "Nature reviews. Immunology", "date": "2004", "authors": "Thome M", "evidence": [ { "database": "Reactome", "id": "R-HSA-202424", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202424" } ], "reference": [ { "type": "PubMed", "id": "15122200", "url": "https://glygen.org/publication/PubMed/15122200" } ] }, { "title": "The TRAF6 ubiquitin ligase and TAK1 kinase mediate IKK activation by BCL10 and MALT1 in T lymphocytes.", "journal": "Molecular cell", "date": "2004", "authors": "Sun L, Deng L, Ea CK, Xia ZP, Chen ZJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-202424", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202424" } ], "reference": [ { "type": "PubMed", "id": "15125833", "url": "https://glygen.org/publication/PubMed/15125833" } ] }, { "title": "Transforming growth factor-beta stimulates p300-dependent RUNX3 acetylation, which inhibits ubiquitination-mediated degradation.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Jin YH, Jeon EJ, Li QL, Lee YH, Choi JK, Kim WJ, Lee KY, Bae SC", "evidence": [ { "database": "Reactome", "id": "R-HSA-8941858", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8941858" } ], "reference": [ { "type": "PubMed", "id": "15138260", "url": "https://glygen.org/publication/PubMed/15138260" } ] }, { "title": "Induction of p100 processing by NF-kappaB-inducing kinase involves docking IkappaB kinase alpha (IKKalpha) to p100 and IKKalpha-mediated phosphorylation.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Xiao G, Fong A, Sun SC", "evidence": [ { "database": "Reactome", "id": "R-HSA-5607761", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5607761" } ], "reference": [ { "type": "PubMed", "id": "15140882", "url": "https://glygen.org/publication/PubMed/15140882" } ] }, { "title": "The two NF-kappaB activation pathways and their role in innate and adaptive immunity.", "journal": "Trends in immunology", "date": "2004", "authors": "Bonizzi G, Karin M", "evidence": [ { "database": "Reactome", "id": "R-HSA-202424", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202424" } ], "reference": [ { "type": "PubMed", "id": "15145317", "url": "https://glygen.org/publication/PubMed/15145317" } ] }, { "title": "The cholesterol membrane anchor of the Hedgehog protein confers stable membrane association to lipid-modified proteins.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2004", "authors": "Peters C, Wolf A, Wagner M, Kuhlmann J, Waldmann H", "evidence": [ { "database": "Reactome", "id": "R-HSA-5358346", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5358346" } ], "reference": [ { "type": "PubMed", "id": "15163793", "url": "https://glygen.org/publication/PubMed/15163793" } ] }, { "title": "Pharmacokinetics of erythromycin in rabbit corneas after single-dose infusion: role of P-glycoprotein as a barrier to in vivo ocular drug absorption.", "journal": "The Journal of pharmacology and experimental therapeutics", "date": "2004", "authors": "Dey S, Gunda S, Mitra AK", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "15175422", "url": "https://glygen.org/publication/PubMed/15175422" } ] }, { "title": "iguana encodes a novel zinc-finger protein with coiled-coil domains essential for Hedgehog signal transduction in the zebrafish embryo.", "journal": "Genes & development", "date": "2004", "authors": "Wolff C, Roy S, Lewis KE, Schauerte H, Joerg-Rauch G, Kirn A, Weiler C, Geisler R, Haffter P, Ingham PW", "evidence": [ { "database": "Reactome", "id": "R-HSA-5632684", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5632684" } ], "reference": [ { "type": "PubMed", "id": "15198976", "url": "https://glygen.org/publication/PubMed/15198976" } ] }, { "title": "Noncatalytic requirement for cyclin A-cdk2 in p27 turnover.", "journal": "Molecular and cellular biology", "date": "2004", "authors": "Zhu XH, Nguyen H, Halicka HD, Traganos F, Koff A", "evidence": [ { "database": "Reactome", "id": "R-HSA-187577", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-187577" } ], "reference": [ { "type": "PubMed", "id": "15199159", "url": "https://glygen.org/publication/PubMed/15199159" } ] }, { "title": "Generation of major histocompatibility complex class I antigens: functional interplay between proteasomes and TPPII.", "journal": "Nature immunology", "date": "2004", "authors": "Kloetzel PM", "evidence": [ { "database": "Reactome", "id": "R-HSA-983168", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983168" } ], "reference": [ { "type": "PubMed", "id": "15224091", "url": "https://glygen.org/publication/PubMed/15224091" } ] }, { "title": "Post-proteasomal antigen processing for major histocompatibility complex class I presentation.", "journal": "Nature immunology", "date": "2004", "authors": "Rock KL, York IA, Goldberg AL", "evidence": [ { "database": "Reactome", "id": "R-HSA-983168", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983168" } ], "reference": [ { "type": "PubMed", "id": "15224092", "url": "https://glygen.org/publication/PubMed/15224092" } ] }, { "title": "N-Terminal ubiquitination of extracellular signal-regulated kinase 3 and p21 directs their degradation by the proteasome.", "journal": "Molecular and cellular biology", "date": "2004", "authors": "Coulombe P, Rodier G, Bonneil E, Thibault P, Meloche S", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "15226418", "url": "https://glygen.org/publication/PubMed/15226418" } ] }, { "title": "Differential function of the prolyl hydroxylases PHD1, PHD2, and PHD3 in the regulation of hypoxia-inducible factor.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Appelhoff RJ, Tian YM, Raval RR, Turley H, Harris AL, Pugh CW, Ratcliffe PJ, Gleadle JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-1234176", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1234176" } ], "reference": [ { "type": "PubMed", "id": "15247232", "url": "https://glygen.org/publication/PubMed/15247232" } ] }, { "title": "Concurrent versus individual binding of HuR and AUF1 to common labile target mRNAs.", "journal": "The EMBO journal", "date": "2004", "authors": "Lal A, Mazan-Mamczarz K, Kawai T, Yang X, Martindale JL, Gorospe M", "evidence": [ { "database": "Reactome", "id": "R-HSA-450408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-450408" } ], "reference": [ { "type": "PubMed", "id": "15257295", "url": "https://glygen.org/publication/PubMed/15257295" } ] }, { "title": "Oxidative stress sensor Keap1 functions as an adaptor for Cul3-based E3 ligase to regulate proteasomal degradation of Nrf2.", "journal": "Molecular and cellular biology", "date": "2004", "authors": "Kobayashi A, Kang MI, Okawa H, Ohtsuji M, Zenke Y, Chiba T, Igarashi K, Yamamoto M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "15282312", "url": "https://glygen.org/publication/PubMed/15282312" } ] }, { "title": "Functional characterization of sonic hedgehog mutations associated with holoprosencephaly.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Traiffort E, Dubourg C, Faure H, Rognan D, Odent S, Durou MR, David V, Ruat M", "evidence": [ { "database": "Reactome", "id": "R-HSA-5358346", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5358346" } ], "reference": [ { "type": "PubMed", "id": "15292211", "url": "https://glygen.org/publication/PubMed/15292211" } ] }, { "title": "Reading the Hedgehog morphogen gradient by measuring the ratio of bound to unbound Patched protein.", "journal": "Nature", "date": "2004", "authors": "Casali A, Struhl G", "evidence": [ { "database": "Reactome", "id": "R-HSA-5632684", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5632684" } ], "reference": [ { "type": "PubMed", "id": "15300262", "url": "https://glygen.org/publication/PubMed/15300262" } ] }, { "title": "Crystal structure of a beta-catenin/APC complex reveals a critical role for APC phosphorylation in APC function.", "journal": "Molecular cell", "date": "2004", "authors": "Xing Y, Clements WK, Le Trong I, Hinds TR, Stenkamp R, Kimelman D, Xu W", "evidence": [ { "database": "Reactome", "id": "R-HSA-195253", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-195253" } ], "reference": [ { "type": "PubMed", "id": "15327769", "url": "https://glygen.org/publication/PubMed/15327769" } ] }, { "title": "TAB2 and TAB3 activate the NF-kappaB pathway through binding to polyubiquitin chains.", "journal": "Molecular cell", "date": "2004", "authors": "Kanayama A, Seth RB, Sun L, Ea CK, Hong M, Shaito A, Chiu YH, Deng L, Chen ZJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871837" } ], "reference": [ { "type": "PubMed", "id": "15327770", "url": "https://glygen.org/publication/PubMed/15327770" } ] }, { "title": "The SCF ubiquitin ligase: insights into a molecular machine.", "journal": "Nature reviews. Molecular cell biology", "date": "2004", "authors": "Cardozo T, Pagano M", "evidence": [ { "database": "Reactome", "id": "R-HSA-5607761", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5607761" } ], "reference": [ { "type": "PubMed", "id": "15340381", "url": "https://glygen.org/publication/PubMed/15340381" } ] }, { "title": "A unique E1-E2 interaction required for optimal conjugation of the ubiquitin-like protein NEDD8.", "journal": "Nature structural & molecular biology", "date": "2004", "authors": "Huang DT, Miller DW, Mathew R, Cassell R, Holton JM, Roussel MF, Schulman BA", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "15361859", "url": "https://glygen.org/publication/PubMed/15361859" } ] }, { "title": "The Keap1-BTB protein is an adaptor that bridges Nrf2 to a Cul3-based E3 ligase: oxidative stress sensing by a Cul3-Keap1 ligase.", "journal": "Molecular and cellular biology", "date": "2004", "authors": "Cullinan SB, Gordan JD, Jin J, Harper JW, Diehl JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "15367669", "url": "https://glygen.org/publication/PubMed/15367669" } ] }, { "title": "Signaling to NF-kappaB.", "journal": "Genes & development", "date": "2004", "authors": "Hayden MS, Ghosh S", "evidence": [ { "database": "Reactome", "id": "R-HSA-202424", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202424" } ], "reference": [ { "type": "PubMed", "id": "15371334", "url": "https://glygen.org/publication/PubMed/15371334" } ] }, { "title": "An Rb-Skp2-p27 pathway mediates acute cell cycle inhibition by Rb and is retained in a partial-penetrance Rb mutant.", "journal": "Molecular cell", "date": "2004", "authors": "Ji P, Jiang H, Rekhtman K, Bloom J, Ichetovkin M, Pagano M, Zhu L", "evidence": [ { "database": "Reactome", "id": "R-HSA-174178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-174178" } ], "reference": [ { "type": "PubMed", "id": "15469821", "url": "https://glygen.org/publication/PubMed/15469821" } ] }, { "title": "Plk1 regulates activation of the anaphase promoting complex by phosphorylating and triggering SCFbetaTrCP-dependent destruction of the APC Inhibitor Emi1.", "journal": "Molecular biology of the cell", "date": "2004", "authors": "Hansen DV, Loktev AV, Ban KH, Jackson PK", "evidence": [ { "database": "Reactome", "id": "R-HSA-174113", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-174113" } ], "reference": [ { "type": "PubMed", "id": "15469984", "url": "https://glygen.org/publication/PubMed/15469984" } ] }, { "title": "Identification of budesonide and prednisone as substrates of the intestinal drug efflux pump P-glycoprotein.", "journal": "Inflammatory bowel diseases", "date": "2004", "authors": "Dilger K, Schwab M, Fromm MF", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "15472518", "url": "https://glygen.org/publication/PubMed/15472518" } ] }, { "title": "Determination and comparison of specific activity of the HIF-prolyl hydroxylases.", "journal": "FEBS letters", "date": "2004", "authors": "Tuckerman JR, Zhao Y, Hewitson KS, Tian YM, Pugh CW, Ratcliffe PJ, Mole DR", "evidence": [ { "database": "Reactome", "id": "R-HSA-1234176", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1234176" } ], "reference": [ { "type": "PubMed", "id": "15474027", "url": "https://glygen.org/publication/PubMed/15474027" } ] }, { "title": "Degradation of antizyme inhibitor, an ornithine decarboxylase homologous protein, is ubiquitin-dependent and is inhibited by antizyme.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Bercovich Z, Kahana C", "evidence": [ { "database": "Reactome", "id": "R-HSA-350562", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-350562" } ], "reference": [ { "type": "PubMed", "id": "15491992", "url": "https://glygen.org/publication/PubMed/15491992" } ] }, { "title": "Structure of the Cand1-Cul1-Roc1 complex reveals regulatory mechanisms for the assembly of the multisubunit cullin-dependent ubiquitin ligases.", "journal": "Cell", "date": "2004", "authors": "Goldenberg SJ, Cascio TC, Shumway SD, Garbutt KC, Liu J, Xiong Y, Zheng N", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "15537541", "url": "https://glygen.org/publication/PubMed/15537541" } ] }, { "title": "Scaffolding by ERK3 regulates MK5 in development.", "journal": "The EMBO journal", "date": "2004", "authors": "Schumacher S, Laass K, Kant S, Shi Y, Visel A, Gruber AD, Kotlyarov A, Gaestel M", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "15538386", "url": "https://glygen.org/publication/PubMed/15538386" } ] }, { "title": "The roles of CARMA1, Bcl10, and MALT1 in antigen receptor signaling.", "journal": "Seminars in immunology", "date": "2004", "authors": "Lin X, Wang D", "evidence": [ { "database": "Reactome", "id": "R-HSA-202424", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202424" } ], "reference": [ { "type": "PubMed", "id": "15541657", "url": "https://glygen.org/publication/PubMed/15541657" } ] }, { "title": "The proteasome and MHC class I antigen processing.", "journal": "Biochimica et biophysica acta", "date": "2004", "authors": "Kloetzel PM", "evidence": [ { "database": "Reactome", "id": "R-HSA-983168", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983168" } ], "reference": [ { "type": "PubMed", "id": "15571818", "url": "https://glygen.org/publication/PubMed/15571818" } ] }, { "title": "Keap1 is a redox-regulated substrate adaptor protein for a Cul3-dependent ubiquitin ligase complex.", "journal": "Molecular and cellular biology", "date": "2004", "authors": "Zhang DD, Lo SC, Cross JV, Templeton DJ, Hannink M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "15572695", "url": "https://glygen.org/publication/PubMed/15572695" } ] }, { "title": "Phosphorylation of a novel SOCS-box regulates assembly of the HIV-1 Vif-Cul5 complex that promotes APOBEC3G degradation.", "journal": "Genes & development", "date": "2004", "authors": "Mehle A, Goncalves J, Santa-Marta M, McPike M, Gabuzda D", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "15574592", "url": "https://glygen.org/publication/PubMed/15574592" } ] }, { "title": "Activation of MK5/PRAK by the atypical MAP kinase ERK3 defines a novel signal transduction pathway.", "journal": "The EMBO journal", "date": "2004", "authors": "Seternes OM, Mikalsen T, Johansen B, Michaelsen E, Armstrong CG, Morrice NA, Turgeon B, Meloche S, Moens U, Keyse SM", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "15577943", "url": "https://glygen.org/publication/PubMed/15577943" } ] }, { "title": "Access of soluble antigens to the endoplasmic reticulum can explain cross-presentation by dendritic cells.", "journal": "Nature immunology", "date": "2005", "authors": "Ackerman AL, Kyritsis C, Tampe R, Cresswell P", "evidence": [ { "database": "Reactome", "id": "R-HSA-1236978", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1236978" } ], "reference": [ { "type": "PubMed", "id": "15592474", "url": "https://glygen.org/publication/PubMed/15592474" } ] }, { "title": "BTB protein Keap1 targets antioxidant transcription factor Nrf2 for ubiquitination by the Cullin 3-Roc1 ligase.", "journal": "Molecular and cellular biology", "date": "2005", "authors": "Furukawa M, Xiong Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "15601839", "url": "https://glygen.org/publication/PubMed/15601839" } ] }, { "title": "A foldable CFTR{Delta}F508 biogenic intermediate accumulates upon inhibition of the Hsc70-CHIP E3 ubiquitin ligase.", "journal": "The Journal of cell biology", "date": "2004", "authors": "Younger JM, Ren HY, Chen L, Fan CY, Fields A, Patterson C, Cyr DM", "evidence": [ { "database": "Reactome", "id": "R-HSA-5678895", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5678895" } ], "reference": [ { "type": "PubMed", "id": "15611333", "url": "https://glygen.org/publication/PubMed/15611333" } ] }, { "title": "A series of ubiquitin binding factors connects CDC48/p97 to substrate multiubiquitylation and proteasomal targeting.", "journal": "Cell", "date": "2005", "authors": "Richly H, Rape M, Braun S, Rumpf S, Hoege C, Jentsch S", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "15652483", "url": "https://glygen.org/publication/PubMed/15652483" } ] }, { "title": "Succinate links TCA cycle dysfunction to oncogenesis by inhibiting HIF-alpha prolyl hydroxylase.", "journal": "Cancer cell", "date": "2005", "authors": "Selak MA, Armour SM, MacKenzie ED, Boulahbel H, Watson DG, Mansfield KD, Pan Y, Simon MC, Thompson CB, Gottlieb E", "evidence": [ { "database": "Reactome", "id": "R-HSA-1234176", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1234176" } ], "reference": [ { "type": "PubMed", "id": "15652751", "url": "https://glygen.org/publication/PubMed/15652751" } ] }, { "title": "Regulation of p21(WAF1/CIP1) stability by WISp39, a Hsp90 binding TPR protein.", "journal": "Molecular cell", "date": "2005", "authors": "Jascur T, Brickner H, Salles-Passador I, Barbier V, El Khissiin A, Smith B, Fotedar R, Fotedar A", "evidence": [ { "database": "Reactome", "id": "R-HSA-8852276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8852276" } ], "reference": [ { "type": "PubMed", "id": "15664193", "url": "https://glygen.org/publication/PubMed/15664193" } ] }, { "title": "The ubiquitin-protein ligase Itch regulates p73 stability.", "journal": "The EMBO journal", "date": "2005", "authors": "Rossi M, De Laurenzi V, Munarriz E, Green DR, Liu YC, Vousden KH, Cesareni G, Melino G", "evidence": [ { "database": "Reactome", "id": "R-HSA-8939236", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8939236" } ], "reference": [ { "type": "PubMed", "id": "15678106", "url": "https://glygen.org/publication/PubMed/15678106" } ] }, { "title": "The anaphase-promoting complex: a key factor in the regulation of cell cycle.", "journal": "Oncogene", "date": "2005", "authors": "Castro A, Bernis C, Vigneron S, Labbe JC, Lorca T", "evidence": [ { "database": "Reactome", "id": "R-HSA-174178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-174178" } ], "reference": [ { "type": "PubMed", "id": "15678131", "url": "https://glygen.org/publication/PubMed/15678131" } ] }, { "title": "Distinct requirements for the Sprouty domain for functional activity of Spred proteins.", "journal": "The Biochemical journal", "date": "2005", "authors": "King JA, Straffon AF, D'Abaco GM, Poon CL, I ST, Smith CM, Buchert M, Corcoran NM, Hall NE, Callus BA, Sarcevic B, Martin D, Lock P, Hovens CM", "evidence": [ { "database": "Reactome", "id": "R-HSA-5658442", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5658442" } ], "reference": [ { "type": "PubMed", "id": "15683364", "url": "https://glygen.org/publication/PubMed/15683364" } ] }, { "title": "Function and regulation of cullin-RING ubiquitin ligases.", "journal": "Nature reviews. Molecular cell biology", "date": "2005", "authors": "Petroski MD, Deshaies RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "15688063", "url": "https://glygen.org/publication/PubMed/15688063" } ] }, { "title": "Structural basis for recruitment of Ubc12 by an E2 binding domain in NEDD8's E1.", "journal": "Molecular cell", "date": "2005", "authors": "Huang DT, Paydar A, Zhuang M, Waddell MB, Holton JM, Schulman BA", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "15694336", "url": "https://glygen.org/publication/PubMed/15694336" } ] }, { "title": "Ras regulation. NF is enough of GAP.", "journal": "Nature", "date": "1992", "authors": "Bollag G, McCormick F", "evidence": [ { "database": "Reactome", "id": "R-HSA-5658442", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5658442" } ], "reference": [ { "type": "PubMed", "id": "1570011", "url": "https://glygen.org/publication/PubMed/1570011" } ] }, { "title": "Nkx3.2-mediated repression of Runx2 promotes chondrogenic differentiation.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Lengner CJ, Hassan MQ, Serra RW, Lepper C, van Wijnen AJ, Stein JL, Lian JB, Stein GS", "evidence": [ { "database": "Reactome", "id": "R-HSA-8939902", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8939902" } ], "reference": [ { "type": "PubMed", "id": "15703179", "url": "https://glygen.org/publication/PubMed/15703179" } ] }, { "title": "The links between axin and carcinogenesis.", "journal": "Journal of clinical pathology", "date": "2005", "authors": "Salahshor S, Woodgett JR", "evidence": [ { "database": "Reactome", "id": "R-HSA-195253", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-195253" } ], "reference": [ { "type": "PubMed", "id": "15735151", "url": "https://glygen.org/publication/PubMed/15735151" } ] }, { "title": "Phosphorylation of cyclin D1 at Thr 286 during S phase leads to its proteasomal degradation and allows efficient DNA synthesis.", "journal": "Oncogene", "date": "2005", "authors": "Guo Y, Yang K, Harwalkar J, Nye JM, Mason DR, Garrett MD, Hitomi M, Stacey DW", "evidence": [ { "database": "Reactome", "id": "R-HSA-75815", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75815" } ], "reference": [ { "type": "PubMed", "id": "15735756", "url": "https://glygen.org/publication/PubMed/15735756" } ] }, { "title": "Dissociation of cohesin from chromosome arms and loss of arm cohesion during early mitosis depends on phosphorylation of SA2.", "journal": "PLoS biology", "date": "2005", "authors": "Hauf S, Roitinger E, Koch B, Dittrich CM, Mechtler K, Peters JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-2467813", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2467813" } ], "reference": [ { "type": "PubMed", "id": "15737063", "url": "https://glygen.org/publication/PubMed/15737063" } ] }, { "title": "20S proteasomal degradation of ornithine decarboxylase is regulated by NQO1.", "journal": "Molecular cell", "date": "2005", "authors": "Asher G, Bercovich Z, Tsvetkov P, Shaul Y, Kahana C", "evidence": [ { "database": "Reactome", "id": "R-HSA-350562", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-350562" } ], "reference": [ { "type": "PubMed", "id": "15749015", "url": "https://glygen.org/publication/PubMed/15749015" } ] }, { "title": "Ubiquitination of APOBEC3G by an HIV-1 Vif-Cullin5-Elongin B-Elongin C complex is essential for Vif function.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Kobayashi M, Takaori-Kondo A, Miyauchi Y, Iwai K, Uchiyama T", "evidence": [ { "database": "Reactome", "id": "R-HSA-180585", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-180585" } ], "reference": [ { "type": "PubMed", "id": "15781449", "url": "https://glygen.org/publication/PubMed/15781449" } ] }, { "title": "COMMD proteins, a novel family of structural and functional homologs of MURR1.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Burstein E, Hoberg JE, Wilkinson AS, Rumble JM, Csomos RA, Komarck CM, Maine GN, Wilkinson JC, Mayo MW, Duckett CS", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "15799966", "url": "https://glygen.org/publication/PubMed/15799966" } ] }, { "title": "Syk-dependent cytokine induction by Dectin-1 reveals a novel pattern recognition pathway for C type lectins.", "journal": "Immunity", "date": "2005", "authors": "Rogers NC, Slack EC, Edwards AD, Nolte MA, Schulz O, Schweighoffer E, Williams DL, Gordon S, Tybulewicz VL, Brown GD, Reis e Sousa C", "evidence": [ { "database": "Reactome", "id": "R-HSA-5607764", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5607764" } ], "reference": [ { "type": "PubMed", "id": "15845454", "url": "https://glygen.org/publication/PubMed/15845454" } ] }, { "title": "Selective and ATP-dependent translocation of peptides by the homodimeric ATP binding cassette transporter TAP-like (ABCB9).", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Wolters JC, Abele R, Tampe R", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "15863492", "url": "https://glygen.org/publication/PubMed/15863492" } ] }, { "title": "ABCB5-mediated doxorubicin transport and chemoresistance in human malignant melanoma.", "journal": "Cancer research", "date": "2005", "authors": "Frank NY, Margaryan A, Huang Y, Schatton T, Waaga-Gasser AM, Gasser M, Sayegh MH, Sadee W, Frank MH", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "15899824", "url": "https://glygen.org/publication/PubMed/15899824" } ] }, { "title": "Loss of HAUSP-mediated deubiquitination contributes to DNA damage-induced destabilization of Hdmx and Hdm2.", "journal": "Molecular cell", "date": "2005", "authors": "Meulmeester E, Maurice MM, Boutell C, Teunisse AF, Ovaa H, Abraham TE, Dirks RW, Jochemsen AG", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "15916963", "url": "https://glygen.org/publication/PubMed/15916963" } ] }, { "title": "Pellino3 is a novel upstream regulator of p38 MAPK and activates CREB in a p38-dependent manner.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Butler MP, Hanly JA, Moynagh PN", "evidence": [ { "database": "Reactome", "id": "R-HSA-9020702", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9020702" } ], "reference": [ { "type": "PubMed", "id": "15917247", "url": "https://glygen.org/publication/PubMed/15917247" } ] }, { "title": "Diego and Prickle regulate Frizzled planar cell polarity signalling by competing for Dishevelled binding.", "journal": "Nature cell biology", "date": "2005", "authors": "Jenny A, Reynolds-Kenneally J, Das G, Burnett M, Mlodzik M", "evidence": [ { "database": "Reactome", "id": "R-HSA-4608870", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4608870" } ], "reference": [ { "type": "PubMed", "id": "15937478", "url": "https://glygen.org/publication/PubMed/15937478" } ] }, { "title": "Ubiquitination of Keap1, a BTB-Kelch substrate adaptor protein for Cul3, targets Keap1 for degradation by a proteasome-independent pathway.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Zhang DD, Lo SC, Sun Z, Habib GM, Lieberman MW, Hannink M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9755511", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9755511" } ], "reference": [ { "type": "PubMed", "id": "15983046", "url": "https://glygen.org/publication/PubMed/15983046" } ] }, { "title": "Accumulation of Krebs cycle intermediates and over-expression of HIF1alpha in tumours which result from germline FH and SDH mutations.", "journal": "Human molecular genetics", "date": "2005", "authors": "Pollard PJ, Briere JJ, Alam NA, Barwell J, Barclay E, Wortham NC, Hunt T, Mitchell M, Olpin S, Moat SJ, Hargreaves IP, Heales SJ, Chung YL, Griffiths JR, Dalgleish A, McGrath JA, Gleeson MJ, Hodgson SV, Poulsom R, Rustin P, Tomlinson IP", "evidence": [ { "database": "Reactome", "id": "R-HSA-1234176", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1234176" } ], "reference": [ { "type": "PubMed", "id": "15987702", "url": "https://glygen.org/publication/PubMed/15987702" } ] }, { "title": "Ubiquitin signalling in the NF-kappaB pathway.", "journal": "Nature cell biology", "date": "2005", "authors": "Chen ZJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-202424", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202424" } ], "reference": [ { "type": "PubMed", "id": "16056267", "url": "https://glygen.org/publication/PubMed/16056267" } ] }, { "title": "Cilia and Hedgehog responsiveness in the mouse.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2005", "authors": "Huangfu D, Anderson KV", "evidence": [ { "database": "Reactome", "id": "R-HSA-5632684", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5632684" } ], "reference": [ { "type": "PubMed", "id": "16061793", "url": "https://glygen.org/publication/PubMed/16061793" } ] }, { "title": "Dlx5 specifically regulates Runx2 type II expression by binding to homeodomain-response elements in the Runx2 distal promoter.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Lee MH, Kim YJ, Yoon WJ, Kim JI, Kim BG, Hwang YS, Wozney JM, Chi XZ, Bae SC, Choi KY, Cho JY, Choi JY, Ryoo HM", "evidence": [ { "database": "Reactome", "id": "R-HSA-8939902", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8939902" } ], "reference": [ { "type": "PubMed", "id": "16115867", "url": "https://glygen.org/publication/PubMed/16115867" } ] }, { "title": "Vertebrate Smoothened functions at the primary cilium.", "journal": "Nature", "date": "2005", "authors": "Corbit KC, Aanstad P, Singla V, Norman AR, Stainier DY, Reiter JF", "evidence": [ { "database": "Reactome", "id": "R-HSA-5632684", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5632684" } ], "reference": [ { "type": "PubMed", "id": "16136078", "url": "https://glygen.org/publication/PubMed/16136078" } ] }, { "title": "RUNX3, a novel tumor suppressor, is frequently inactivated in gastric cancer by protein mislocalization.", "journal": "Cancer research", "date": "2005", "authors": "Ito K, Liu Q, Salto-Tellez M, Yano T, Tada K, Ida H, Huang C, Shah N, Inoue M, Rajnakova A, Hiong KC, Peh BK, Han HC, Ito T, Teh M, Yeoh KG, Ito Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-8941858", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8941858" } ], "reference": [ { "type": "PubMed", "id": "16140942", "url": "https://glygen.org/publication/PubMed/16140942" } ] }, { "title": "Cardiac and CNS defects in a mouse with targeted disruption of suppressor of fused.", "journal": "Development (Cambridge, England)", "date": "2005", "authors": "Cooper AF, Yu KP, Brueckner M, Brailey LL, Johnson L, McGrath JM, Bale AE", "evidence": [ { "database": "Reactome", "id": "R-HSA-5632684", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5632684" } ], "reference": [ { "type": "PubMed", "id": "16155214", "url": "https://glygen.org/publication/PubMed/16155214" } ] }, { "title": "Interaction of NUB1 with the proteasome subunit S5a.", "journal": "Biochemical and biophysical research communications", "date": "2005", "authors": "Tanji K, Tanaka T, Kamitani T", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "16171779", "url": "https://glygen.org/publication/PubMed/16171779" } ] }, { "title": "Essential function for the kinase TAK1 in innate and adaptive immune responses.", "journal": "Nature immunology", "date": "2005", "authors": "Sato S, Sanjo H, Takeda K, Ninomiya-Tsuji J, Yamamoto M, Kawai T, Matsumoto K, Takeuchi O, Akira S", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871837" } ], "reference": [ { "type": "PubMed", "id": "16186825", "url": "https://glygen.org/publication/PubMed/16186825" } ] }, { "title": "Mechanisms of protein degradation: an odyssey with ODC.", "journal": "Cell cycle (Georgetown, Tex.)", "date": "2005", "authors": "Kahana C, Asher G, Shaul Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-350562", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-350562" } ], "reference": [ { "type": "PubMed", "id": "16205122", "url": "https://glygen.org/publication/PubMed/16205122" } ] }, { "title": "Structural basis of the Cks1-dependent recognition of p27(Kip1) by the SCF(Skp2) ubiquitin ligase.", "journal": "Molecular cell", "date": "2005", "authors": "Hao B, Zheng N, Schulman BA, Wu G, Miller JJ, Pagano M, Pavletich NP", "evidence": [ { "database": "Reactome", "id": "R-HSA-187577", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-187577" } ], "reference": [ { "type": "PubMed", "id": "16209941", "url": "https://glygen.org/publication/PubMed/16209941" } ] }, { "title": "Human ubiquitin specific protease 31 is a deubiquitinating enzyme implicated in activation of nuclear factor-kappaB.", "journal": "Cellular signalling", "date": "2006", "authors": "Tzimas C, Michailidou G, Arsenakis M, Kieff E, Mosialos G, Hatzivassiliou EG", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "16214042", "url": "https://glygen.org/publication/PubMed/16214042" } ] }, { "title": "Critical role of novel Thr-219 autophosphorylation for the cellular function of PKCtheta in T lymphocytes.", "journal": "The EMBO journal", "date": "2005", "authors": "Thuille N, Heit I, Fresser F, Krumbock N, Bauer B, Leuthaeusser S, Dammeier S, Graham C, Copeland TD, Shaw S, Baier G", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871837" } ], "reference": [ { "type": "PubMed", "id": "16252004", "url": "https://glygen.org/publication/PubMed/16252004" } ] }, { "title": "Molecular mechanisms of Sonic hedgehog mutant effects in holoprosencephaly.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2005", "authors": "Maity T, Fuse N, Beachy PA", "evidence": [ { "database": "Reactome", "id": "R-HSA-5358346", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5358346" } ], "reference": [ { "type": "PubMed", "id": "16282375", "url": "https://glygen.org/publication/PubMed/16282375" } ] }, { "title": "p62/SQSTM1 forms protein aggregates degraded by autophagy and has a protective effect on huntingtin-induced cell death.", "journal": "The Journal of cell biology", "date": "2005", "authors": "Bjorkoy G, Lamark T, Brech A, Outzen H, Perander M, Overvatn A, Stenmark H, Johansen T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9755511", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9755511" } ], "reference": [ { "type": "PubMed", "id": "16286508", "url": "https://glygen.org/publication/PubMed/16286508" } ] }, { "title": "PKC beta regulates BCR-mediated IKK activation by facilitating the interaction between TAK1 and CARMA1.", "journal": "The Journal of experimental medicine", "date": "2005", "authors": "Shinohara H, Yasuda T, Aiba Y, Sanjo H, Hamadate M, Watarai H, Sakurai H, Kurosaki T", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169091", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169091" } ], "reference": [ { "type": "PubMed", "id": "16301747", "url": "https://glygen.org/publication/PubMed/16301747" } ] }, { "title": "beta-TrCP binding and processing of NF-kappaB2/p100 involve its phosphorylation at serines 866 and 870.", "journal": "Cellular signalling", "date": "2006", "authors": "Liang C, Zhang M, Sun SC", "evidence": [ { "database": "Reactome", "id": "R-HSA-5607761", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5607761" } ], "reference": [ { "type": "PubMed", "id": "16303288", "url": "https://glygen.org/publication/PubMed/16303288" } ] }, { "title": "Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.", "journal": "Journal of proteome research", "date": "2005", "authors": "Liu T, Qian WJ, Gritsenko MA, Camp DG 2nd, Monroe ME, Moore RJ, Smith RD", "evidence": [ { "database": "Reactome", "id": "R-HSA-5358346", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5358346" } ], "reference": [ { "type": "PubMed", "id": "16335952", "url": "https://glygen.org/publication/PubMed/16335952" } ] }, { "title": "Dectin-1: a signalling non-TLR pattern-recognition receptor.", "journal": "Nature reviews. Immunology", "date": "2006", "authors": "Brown GD", "evidence": [ { "database": "Reactome", "id": "R-HSA-5607764", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5607764" } ], "reference": [ { "type": "PubMed", "id": "16341139", "url": "https://glygen.org/publication/PubMed/16341139" } ] }, { "title": "Phosphorylation of CARMA1: the link(er) to NF-kappaB activation.", "journal": "Immunity", "date": "2005", "authors": "Rueda D, Thome M", "evidence": [ { "database": "Reactome", "id": "R-HSA-202424", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202424" } ], "reference": [ { "type": "PubMed", "id": "16356853", "url": "https://glygen.org/publication/PubMed/16356853" } ] }, { "title": "Phosphorylation of the CARMA1 linker controls NF-kappaB activation.", "journal": "Immunity", "date": "2005", "authors": "Sommer K, Guo B, Pomerantz JL, Bandaranayake AD, Moreno-Garcia ME, Ovechkina YL, Rawlings DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169091", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169091" } ], "reference": [ { "type": "PubMed", "id": "16356855", "url": "https://glygen.org/publication/PubMed/16356855" } ] }, { "title": "Phosphorylation of CARMA1 plays a critical role in T Cell receptor-mediated NF-kappaB activation.", "journal": "Immunity", "date": "2005", "authors": "Matsumoto R, Wang D, Blonska M, Li H, Kobayashi M, Pappu B, Chen Y, Wang D, Lin X", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871837" } ], "reference": [ { "type": "PubMed", "id": "16356856", "url": "https://glygen.org/publication/PubMed/16356856" } ] }, { "title": "Identification of sensor cysteines in human Keap1 modified by the cancer chemopreventive agent sulforaphane.", "journal": "Chemical research in toxicology", "date": "2005", "authors": "Hong F, Freeman ML, Liebler DC", "evidence": [ { "database": "Reactome", "id": "R-HSA-9755511", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9755511" } ], "reference": [ { "type": "PubMed", "id": "16359182", "url": "https://glygen.org/publication/PubMed/16359182" } ] }, { "title": "Identification of extracellular signal-regulated kinase 3 as a new interaction partner of cyclin D3.", "journal": "Biochemical and biophysical research communications", "date": "2006", "authors": "Sun M, Wei Y, Yao L, Xie J, Chen X, Wang H, Jiang J, Gu J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "16360641", "url": "https://glygen.org/publication/PubMed/16360641" } ] }, { "title": "Evidence for the direct involvement of {beta}TrCP in Gli3 protein processing.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2006", "authors": "Wang B, Li Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-5610785", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5610785" } ], "reference": [ { "type": "PubMed", "id": "16371461", "url": "https://glygen.org/publication/PubMed/16371461" } ] }, { "title": "Here come the septins: novel polymers that coordinate intracellular functions and organization.", "journal": "Journal of cell science", "date": "2006", "authors": "Spiliotis ET, Nelson WJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "16371649", "url": "https://glygen.org/publication/PubMed/16371649" } ] }, { "title": "Targeted silencing of Jab1/Csn5 in human cells downregulates SCF activity through reduction of F-box protein levels.", "journal": "BMC biochemistry", "date": "2006", "authors": "Cope GA, Deshaies RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "16401342", "url": "https://glygen.org/publication/PubMed/16401342" } ] }, { "title": "The processivity of multiubiquitination by the APC determines the order of substrate degradation.", "journal": "Cell", "date": "2006", "authors": "Rape M, Reddy SK, Kirschner MW", "evidence": [ { "database": "Reactome", "id": "R-HSA-174178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-174178" } ], "reference": [ { "type": "PubMed", "id": "16413484", "url": "https://glygen.org/publication/PubMed/16413484" } ] }, { "title": "Nkx3.2/Bapx1 acts as a negative regulator of chondrocyte maturation.", "journal": "Development (Cambridge, England)", "date": "2006", "authors": "Provot S, Kempf H, Murtaugh LC, Chung UI, Kim DW, Chyung J, Kronenberg HM, Lassar AB", "evidence": [ { "database": "Reactome", "id": "R-HSA-8939902", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8939902" } ], "reference": [ { "type": "PubMed", "id": "16421188", "url": "https://glygen.org/publication/PubMed/16421188" } ] }, { "title": "Dual degradation signals control Gli protein stability and tumor formation.", "journal": "Genes & development", "date": "2006", "authors": "Huntzicker EG, Estay IS, Zhen H, Lokteva LA, Jackson PK, Oro AE", "evidence": [ { "database": "Reactome", "id": "R-HSA-5610780", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5610780" } ], "reference": [ { "type": "PubMed", "id": "16421275", "url": "https://glygen.org/publication/PubMed/16421275" } ] }, { "title": "Dapper 1 antagonizes Wnt signaling by promoting dishevelled degradation.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Zhang L, Gao X, Wen J, Ning Y, Chen YG", "evidence": [ { "database": "Reactome", "id": "R-HSA-4641258", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4641258" } ], "reference": [ { "type": "PubMed", "id": "16446366", "url": "https://glygen.org/publication/PubMed/16446366" } ] }, { "title": "Divergence of hedgehog signal transduction mechanism between Drosophila and mammals.", "journal": "Developmental cell", "date": "2006", "authors": "Varjosalo M, Li SP, Taipale J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5632684", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5632684" } ], "reference": [ { "type": "PubMed", "id": "16459297", "url": "https://glygen.org/publication/PubMed/16459297" } ] }, { "title": "Genetic elimination of Suppressor of fused reveals an essential repressor function in the mammalian Hedgehog signaling pathway.", "journal": "Developmental cell", "date": "2006", "authors": "Svard J, Heby-Henricson K, Persson-Lek M, Rozell B, Lauth M, Bergstrom A, Ericson J, Toftgard R, Teglund S", "evidence": [ { "database": "Reactome", "id": "R-HSA-5632684", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5632684" } ], "reference": [ { "type": "PubMed", "id": "16459298", "url": "https://glygen.org/publication/PubMed/16459298" } ] }, { "title": "Eve-3: a liver enriched suppressor of Ras/MAPK signaling.", "journal": "Journal of hepatology", "date": "2006", "authors": "King JA, Corcoran NM, D'Abaco GM, Straffon AF, Smith CT, Poon CL, Buchert M, I S, Hall NE, Lock P, Hovens CM", "evidence": [ { "database": "Reactome", "id": "R-HSA-5658442", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5658442" } ], "reference": [ { "type": "PubMed", "id": "16478641", "url": "https://glygen.org/publication/PubMed/16478641" } ] }, { "title": "Cytoplasmic localized ubiquitin ligase cullin 7 binds to p53 and promotes cell growth by antagonizing p53 function.", "journal": "Oncogene", "date": "2006", "authors": "Andrews P, He YJ, Xiong Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "16547496", "url": "https://glygen.org/publication/PubMed/16547496" } ] }, { "title": "The KLHL12-Cullin-3 ubiquitin ligase negatively regulates the Wnt-beta-catenin pathway by targeting Dishevelled for degradation.", "journal": "Nature cell biology", "date": "2006", "authors": "Angers S, Thorpe CJ, Biechele TL, Goldenberg SJ, Zheng N, MacCoss MJ, Moon RT", "evidence": [ { "database": "Reactome", "id": "R-HSA-4641258", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4641258" } ], "reference": [ { "type": "PubMed", "id": "16547521", "url": "https://glygen.org/publication/PubMed/16547521" } ] }, { "title": "Glycogen synthase kinase-3beta inhibits the xenobiotic and antioxidant cell response by direct phosphorylation and nuclear exclusion of the transcription factor Nrf2.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Salazar M, Rojo AI, Velasco D, de Sagarra RM, Cuadrado A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9762114", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9762114" } ], "reference": [ { "type": "PubMed", "id": "16551619", "url": "https://glygen.org/publication/PubMed/16551619" } ] }, { "title": "Assembly of AUF1 with eIF4G-poly(A) binding protein complex suggests a translation function in AU-rich mRNA decay.", "journal": "RNA (New York, N.Y.)", "date": "2006", "authors": "Lu JY, Bergman N, Sadri N, Schneider RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-450408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-450408" } ], "reference": [ { "type": "PubMed", "id": "16556936", "url": "https://glygen.org/publication/PubMed/16556936" } ] }, { "title": "Pleiotropic effects of ATP.Mg2+ binding in the catalytic cycle of ubiquitin-activating enzyme.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Tokgoz Z, Bohnsack RN, Haas AL", "evidence": [ { "database": "Reactome", "id": "R-HSA-983168", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983168" } ], "reference": [ { "type": "PubMed", "id": "16595681", "url": "https://glygen.org/publication/PubMed/16595681" } ] }, { "title": "Cholesterol modification restricts the spread of Shh gradient in the limb bud.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2006", "authors": "Li Y, Zhang H, Litingtung Y, Chiang C", "evidence": [ { "database": "Reactome", "id": "R-HSA-5358346", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5358346" } ], "reference": [ { "type": "PubMed", "id": "16611729", "url": "https://glygen.org/publication/PubMed/16611729" } ] }, { "title": "Sonic hedgehog signaling regulates Gli2 transcriptional activity by suppressing its processing and degradation.", "journal": "Molecular and cellular biology", "date": "2006", "authors": "Pan Y, Bai CB, Joyner AL, Wang B", "evidence": [ { "database": "Reactome", "id": "R-HSA-5610783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5610783" } ], "reference": [ { "type": "PubMed", "id": "16611981", "url": "https://glygen.org/publication/PubMed/16611981" } ] }, { "title": "Normal T-cell development and immune functions in TRIM-deficient mice.", "journal": "Molecular and cellular biology", "date": "2006", "authors": "Kolsch U, Arndt B, Reinhold D, Lindquist JA, Juling N, Kliche S, Pfeffer K, Bruyns E, Schraven B, Simeoni L", "evidence": [ { "database": "Reactome", "id": "R-HSA-202424", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202424" } ], "reference": [ { "type": "PubMed", "id": "16612002", "url": "https://glygen.org/publication/PubMed/16612002" } ] }, { "title": "Ubiquitin and SUMO systems in the regulation of mitotic checkpoints.", "journal": "Trends in biochemical sciences", "date": "2006", "authors": "Gutierrez GJ, Ronai Z", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "16647857", "url": "https://glygen.org/publication/PubMed/16647857" } ] }, { "title": "Roadkill attenuates Hedgehog responses through degradation of Cubitus interruptus.", "journal": "Development (Cambridge, England)", "date": "2006", "authors": "Kent D, Bush EW, Hooper JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-5632684", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5632684" } ], "reference": [ { "type": "PubMed", "id": "16651542", "url": "https://glygen.org/publication/PubMed/16651542" } ] }, { "title": "Asymmetric localization of Vangl2 and Fz3 indicate novel mechanisms for planar cell polarity in mammals.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "date": "2006", "authors": "Montcouquiol M, Sans N, Huss D, Kach J, Dickman JD, Forge A, Rachel RA, Copeland NG, Jenkins NA, Bogani D, Murdoch J, Warchol ME, Wenthold RJ, Kelley MW", "evidence": [ { "database": "Reactome", "id": "R-HSA-4608870", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4608870" } ], "reference": [ { "type": "PubMed", "id": "16687519", "url": "https://glygen.org/publication/PubMed/16687519" } ] }, { "title": "Multisite protein kinase A and glycogen synthase kinase 3beta phosphorylation leads to Gli3 ubiquitination by SCFbetaTrCP.", "journal": "Molecular and cellular biology", "date": "2006", "authors": "Tempe D, Casas M, Karaz S, Blanchet-Tournier MF, Concordet JP", "evidence": [ { "database": "Reactome", "id": "R-HSA-5610785", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5610785" } ], "reference": [ { "type": "PubMed", "id": "16705181", "url": "https://glygen.org/publication/PubMed/16705181" } ] }, { "title": "The UBA domains of NUB1L are required for binding but not for accelerated degradation of the ubiquitin-like modifier FAT10.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Schmidtke G, Kalveram B, Weber E, Bochtler P, Lukasiak S, Hipp MS, Groettrup M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "16707496", "url": "https://glygen.org/publication/PubMed/16707496" } ] }, { "title": "Regulation of adult bone mass by the zinc finger adapter protein Schnurri-3.", "journal": "Science (New York, N.Y.)", "date": "2006", "authors": "Jones DC, Wein MN, Oukka M, Hofstaetter JG, Glimcher MJ, Glimcher LH", "evidence": [ { "database": "Reactome", "id": "R-HSA-8939902", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8939902" } ], "reference": [ { "type": "PubMed", "id": "16728642", "url": "https://glygen.org/publication/PubMed/16728642" } ] }, { "title": "Identification of mutations that disrupt phosphorylation-dependent nuclear export of cyclin D1.", "journal": "Oncogene", "date": "2006", "authors": "Benzeno S, Lu F, Guo M, Barbash O, Zhang F, Herman JG, Klein PS, Rustgi A, Diehl JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-75815", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75815" } ], "reference": [ { "type": "PubMed", "id": "16732330", "url": "https://glygen.org/publication/PubMed/16732330" } ] }, { "title": "Cell-type-specific regulation of degradation of hypoxia-inducible factor 1 alpha: role of subcellular compartmentalization.", "journal": "Molecular and cellular biology", "date": "2006", "authors": "Zheng X, Ruas JL, Cao R, Salomons FA, Cao Y, Poellinger L, Pereira T", "evidence": [ { "database": "Reactome", "id": "R-HSA-1234176", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1234176" } ], "reference": [ { "type": "PubMed", "id": "16738327", "url": "https://glygen.org/publication/PubMed/16738327" } ] }, { "title": "A hedgehog-induced BTB protein modulates hedgehog signaling by degrading Ci/Gli transcription factor.", "journal": "Developmental cell", "date": "2006", "authors": "Zhang Q, Zhang L, Wang B, Ou CY, Chien CT, Jiang J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5632684", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5632684" } ], "reference": [ { "type": "PubMed", "id": "16740475", "url": "https://glygen.org/publication/PubMed/16740475" } ] }, { "title": "The third 20 amino acid repeat is the tightest binding site of APC for beta-catenin.", "journal": "Journal of molecular biology", "date": "2006", "authors": "Liu J, Xing Y, Hinds TR, Zheng J, Xu W", "evidence": [ { "database": "Reactome", "id": "R-HSA-195253", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-195253" } ], "reference": [ { "type": "PubMed", "id": "16753179", "url": "https://glygen.org/publication/PubMed/16753179" } ] }, { "title": "Dimerization of substrate adaptors can facilitate cullin-mediated ubiquitylation of proteins by a `tethering` mechanism: a two-site interaction model for the Nrf2-Keap1 complex.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "McMahon M, Thomas N, Itoh K, Yamamoto M, Hayes JD", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "16790436", "url": "https://glygen.org/publication/PubMed/16790436" } ] }, { "title": "Transmembrane transport of endo- and xenobiotics by mammalian ATP-binding cassette multidrug resistance proteins.", "journal": "Physiological reviews", "date": "2006", "authors": "Deeley RG, Westlake C, Cole SP", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "16816140", "url": "https://glygen.org/publication/PubMed/16816140" } ] }, { "title": "Role of immunoproteasomes in cross-presentation.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2006", "authors": "Palmowski MJ, Gileadi U, Salio M, Gallimore A, Millrain M, James E, Addey C, Scott D, Dyson J, Simpson E, Cerundolo V", "evidence": [ { "database": "Reactome", "id": "R-HSA-1236978", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1236978" } ], "reference": [ { "type": "PubMed", "id": "16818754", "url": "https://glygen.org/publication/PubMed/16818754" } ] }, { "title": "Reconstitution of Saccharomyces cerevisiae prereplicative complex assembly in vitro.", "journal": "Genes to cells : devoted to molecular & cellular mechanisms", "date": "2006", "authors": "Kawasaki Y, Kim HD, Kojima A, Seki T, Sugino A", "evidence": [ { "database": "Reactome", "id": "R-HSA-68867", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-68867" } ], "reference": [ { "type": "PubMed", "id": "16824194", "url": "https://glygen.org/publication/PubMed/16824194" } ] }, { "title": "The IRAK-1-BCL10-MALT1-TRAF6-TAK1 cascade mediates signaling to NF-kappaB from Toll-like receptor 4.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Dong W, Liu Y, Peng J, Chen L, Zou T, Xiao H, Liu Z, Li W, Bu Y, Qi Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871837" } ], "reference": [ { "type": "PubMed", "id": "16831874", "url": "https://glygen.org/publication/PubMed/16831874" } ] }, { "title": "Tripeptidyl peptidase II is the major peptidase needed to trim long antigenic precursors, but is not required for most MHC class I antigen presentation.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2006", "authors": "York IA, Bhutani N, Zendzian S, Goldberg AL, Rock KL", "evidence": [ { "database": "Reactome", "id": "R-HSA-983168", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983168" } ], "reference": [ { "type": "PubMed", "id": "16849449", "url": "https://glygen.org/publication/PubMed/16849449" } ] }, { "title": "Tankyrase recruitment to the lateral membrane in polarized epithelial cells: regulation by cell-cell contact and protein poly(ADP-ribosyl)ation.", "journal": "The Biochemical journal", "date": "2006", "authors": "Yeh TY, Meyer TN, Schwesinger C, Tsun ZY, Lee RM, Chi NW", "evidence": [ { "database": "Reactome", "id": "R-HSA-4641257", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4641257" } ], "reference": [ { "type": "PubMed", "id": "16884355", "url": "https://glygen.org/publication/PubMed/16884355" } ] }, { "title": "A role for the deubiquitinating enzyme USP28 in control of the DNA-damage response.", "journal": "Cell", "date": "2006", "authors": "Zhang D, Zaugg K, Mak TW, Elledge SJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "16901786", "url": "https://glygen.org/publication/PubMed/16901786" } ] }, { "title": "Sequential quality-control checkpoints triage misfolded cystic fibrosis transmembrane conductance regulator.", "journal": "Cell", "date": "2006", "authors": "Younger JM, Chen L, Ren HY, Rosser MF, Turnbull EL, Fan CY, Patterson C, Cyr DM", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "16901789", "url": "https://glygen.org/publication/PubMed/16901789" } ] }, { "title": "Proteasome recruitment and activation of the Uch37 deubiquitinating enzyme by Adrm1.", "journal": "Nature cell biology", "date": "2006", "authors": "Yao T, Song L, Xu W, DeMartino GN, Florens L, Swanson SK, Washburn MP, Conaway RC, Conaway JW, Cohen RE", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689603", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689603" } ], "reference": [ { "type": "PubMed", "id": "16906146", "url": "https://glygen.org/publication/PubMed/16906146" } ] }, { "title": "ATM engages autodegradation of the E3 ubiquitin ligase COP1 after DNA damage.", "journal": "Science (New York, N.Y.)", "date": "2006", "authors": "Dornan D, Shimizu H, Mah A, Dudhela T, Eby M, O'rourke K, Seshagiri S, Dixit VM", "evidence": [ { "database": "Reactome", "id": "R-HSA-349425", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-349425" } ], "reference": [ { "type": "PubMed", "id": "16931761", "url": "https://glygen.org/publication/PubMed/16931761" } ] }, { "title": "The COP9 signalosome regulates Skp2 levels and proliferation of human cells.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Denti S, Fernandez-Sanchez ME, Rogge L, Bianchi E", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "16943200", "url": "https://glygen.org/publication/PubMed/16943200" } ] }, { "title": "A novel family of membrane-bound E3 ubiquitin ligases.", "journal": "Journal of biochemistry", "date": "2006", "authors": "Ohmura-Hoshino M, Goto E, Matsuki Y, Aoki M, Mito M, Uematsu M, Hotta H, Ishido S", "evidence": [ { "database": "Reactome", "id": "R-HSA-983168", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983168" } ], "reference": [ { "type": "PubMed", "id": "16954532", "url": "https://glygen.org/publication/PubMed/16954532" } ] }, { "title": "A cluster of cystic fibrosis mutations in the first nucleotide-binding fold of the cystic fibrosis conductance regulator protein.", "journal": "Nature", "date": "1990", "authors": "Cutting GR, Kasch LM, Rosenstein BJ, Zielenski J, Tsui LC, Antonarakis SE, Kazazian HH Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-5678895", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5678895" } ], "reference": [ { "type": "PubMed", "id": "1695717", "url": "https://glygen.org/publication/PubMed/1695717" } ] }, { "title": "Peroxynitrite induces HO-1 expression via PI3K/Akt-dependent activation of NF-E2-related factor 2 in PC12 cells.", "journal": "Free radical biology & medicine", "date": "2006", "authors": "Li MH, Cha YN, Surh YJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9755511", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9755511" } ], "reference": [ { "type": "PubMed", "id": "16962933", "url": "https://glygen.org/publication/PubMed/16962933" } ] }, { "title": "FOXO4 transcriptional activity is regulated by monoubiquitination and USP7/HAUSP.", "journal": "Nature cell biology", "date": "2006", "authors": "van der Horst A, de Vries-Smits AM, Brenkman AB, van Triest MH, van den Broek N, Colland F, Maurice MM, Burgering BM", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "16964248", "url": "https://glygen.org/publication/PubMed/16964248" } ] }, { "title": "Regulation of MAPK-activated protein kinase 5 activity and subcellular localization by the atypical MAPK ERK4/MAPK4.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Aberg E, Perander M, Johansen B, Julien C, Meloche S, Keyse SM, Seternes OM", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "16971392", "url": "https://glygen.org/publication/PubMed/16971392" } ] }, { "title": "Characterization of the atypical MAPK ERK4 and its activation of the MAPK-activated protein kinase MK5.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Kant S, Schumacher S, Singh MK, Kispert A, Kotlyarov A, Gaestel M", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "16973613", "url": "https://glygen.org/publication/PubMed/16973613" } ] }, { "title": "Selective function of PKC-theta in T cells.", "journal": "Cellular & molecular immunology", "date": "2006", "authors": "Manicassamy S, Gupta S, Sun Z", "evidence": [ { "database": "Reactome", "id": "R-HSA-202424", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202424" } ], "reference": [ { "type": "PubMed", "id": "16978534", "url": "https://glygen.org/publication/PubMed/16978534" } ] }, { "title": "The C-terminal tail of the Hedgehog receptor Patched regulates both localization and turnover.", "journal": "Genes & development", "date": "2006", "authors": "Lu X, Liu S, Kornberg TB", "evidence": [ { "database": "Reactome", "id": "R-HSA-5632684", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5632684" } ], "reference": [ { "type": "PubMed", "id": "16980583", "url": "https://glygen.org/publication/PubMed/16980583" } ] }, { "title": "Regulation and function of IKK and IKK-related kinases.", "journal": "Science's STKE : signal transduction knowledge environment", "date": "2006", "authors": "Hacker H, Karin M", "evidence": [ { "database": "Reactome", "id": "R-HSA-202424", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202424" } ], "reference": [ { "type": "PubMed", "id": "17047224", "url": "https://glygen.org/publication/PubMed/17047224" } ] }, { "title": "Introduction to NF-kappaB: players, pathways, perspectives.", "journal": "Oncogene", "date": "2006", "authors": "Gilmore TD", "evidence": [ { "database": "Reactome", "id": "R-HSA-202424", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202424" } ], "reference": [ { "type": "PubMed", "id": "17072321", "url": "https://glygen.org/publication/PubMed/17072321" } ] }, { "title": "Two-site substrate recognition model for the Keap1-Nrf2 system: a hinge and latch mechanism.", "journal": "Biological chemistry", "date": "2006", "authors": "Tong KI, Kobayashi A, Katsuoka F, Yamamoto M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "17081101", "url": "https://glygen.org/publication/PubMed/17081101" } ] }, { "title": "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.", "journal": "Cell", "date": "2006", "authors": "Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M", "evidence": [ { "database": "iPTMnet", "id": "O00231-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O00231-1" } ], "reference": [ { "type": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" } ] }, { "title": "Numb is a suppressor of Hedgehog signalling and targets Gli1 for Itch-dependent ubiquitination.", "journal": "Nature cell biology", "date": "2006", "authors": "Di Marcotullio L, Ferretti E, Greco A, De Smaele E, Po A, Sico MA, Alimandi M, Giannini G, Maroder M, Screpanti I, Gulino A", "evidence": [ { "database": "Reactome", "id": "R-HSA-5610780", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5610780" } ], "reference": [ { "type": "PubMed", "id": "17115028", "url": "https://glygen.org/publication/PubMed/17115028" } ] }, { "title": "A conserved mechanism of Hedgehog gradient formation by lipid modifications.", "journal": "Trends in cell biology", "date": "2007", "authors": "Guerrero I, Chiang C", "evidence": [ { "database": "Reactome", "id": "R-HSA-5358346", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5358346" } ], "reference": [ { "type": "PubMed", "id": "17126548", "url": "https://glygen.org/publication/PubMed/17126548" } ] }, { "title": "Role of the NEDD8 modification of Cul2 in the sequential activation of ECV complex.", "journal": "Neoplasia (New York, N.Y.)", "date": "2006", "authors": "Sufan RI, Ohh M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "17132228", "url": "https://glygen.org/publication/PubMed/17132228" } ] }, { "title": "Site-specific Lys-63-linked tumor necrosis factor receptor-associated factor 6 auto-ubiquitination is a critical determinant of I kappa B kinase activation.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Lamothe B, Besse A, Campos AD, Webster WK, Wu H, Darnay BG", "evidence": [ { "database": "Reactome", "id": "R-HSA-202424", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202424" } ], "reference": [ { "type": "PubMed", "id": "17135271", "url": "https://glygen.org/publication/PubMed/17135271" } ] }, { "title": "hRpn13/ADRM1/GP110 is a novel proteasome subunit that binds the deubiquitinating enzyme, UCH37.", "journal": "The EMBO journal", "date": "2006", "authors": "Qiu XB, Ouyang SY, Li CJ, Miao S, Wang L, Goldberg AL", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689603", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689603" } ], "reference": [ { "type": "PubMed", "id": "17139257", "url": "https://glygen.org/publication/PubMed/17139257" } ] }, { "title": "Regulation of IRAK-4 kinase activity via autophosphorylation within its activation loop.", "journal": "Biochemical and biophysical research communications", "date": "2007", "authors": "Cheng H, Addona T, Keshishian H, Dahlstrand E, Lu C, Dorsch M, Li Z, Wang A, Ocain TD, Li P, Parsons TF, Jaffee B, Xu Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-9020702", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9020702" } ], "reference": [ { "type": "PubMed", "id": "17141195", "url": "https://glygen.org/publication/PubMed/17141195" } ] }, { "title": "TAK1-dependent signaling requires functional interaction with TAB2/TAB3.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Besse A, Lamothe B, Campos AD, Webster WK, Maddineni U, Lin SC, Wu H, Darnay BG", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871837" } ], "reference": [ { "type": "PubMed", "id": "17158449", "url": "https://glygen.org/publication/PubMed/17158449" } ] }, { "title": "Atypical mitogen-activated protein kinases: structure, regulation and functions.", "journal": "Biochimica et biophysica acta", "date": "2007", "authors": "Coulombe P, Meloche S", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "17161475", "url": "https://glygen.org/publication/PubMed/17161475" } ] }, { "title": "Inhibition of hypoxia-inducible factor (HIF) hydroxylases by citric acid cycle intermediates: possible links between cell metabolism and stabilization of HIF.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Koivunen P, Hirsila M, Remes AM, Hassinen IE, Kivirikko KI, Myllyharju J", "evidence": [ { "database": "Reactome", "id": "R-HSA-1234176", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1234176" } ], "reference": [ { "type": "PubMed", "id": "17182618", "url": "https://glygen.org/publication/PubMed/17182618" } ] }, { "title": "Docosahexaenoic acid induces proteasome-dependent degradation of beta-catenin, down-regulation of survivin and apoptosis in human colorectal cancer cells not expressing COX-2.", "journal": "Carcinogenesis", "date": "2007", "authors": "Calviello G, Resci F, Serini S, Piccioni E, Toesca A, Boninsegna A, Monego G, Ranelletti FO, Palozza P", "evidence": [ { "database": "Reactome", "id": "R-HSA-195253", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-195253" } ], "reference": [ { "type": "PubMed", "id": "17183061", "url": "https://glygen.org/publication/PubMed/17183061" } ] }, { "title": "COMMD1 promotes the ubiquitination of NF-kappaB subunits through a cullin-containing ubiquitin ligase.", "journal": "The EMBO journal", "date": "2007", "authors": "Maine GN, Mao X, Komarck CM, Burstein E", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "17183367", "url": "https://glygen.org/publication/PubMed/17183367" } ] }, { "title": "Retinoblastoma protein and anaphase-promoting complex physically interact and functionally cooperate during cell-cycle exit.", "journal": "Nature cell biology", "date": "2007", "authors": "Binne UK, Classon MK, Dick FA, Wei W, Rape M, Kaelin WG Jr, Naar AM, Dyson NJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-174178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-174178" } ], "reference": [ { "type": "PubMed", "id": "17187060", "url": "https://glygen.org/publication/PubMed/17187060" } ] }, { "title": "An X chromosome gene, WTX, is commonly inactivated in Wilms tumor.", "journal": "Science (New York, N.Y.)", "date": "2007", "authors": "Rivera MN, Kim WJ, Wells J, Driscoll DR, Brannigan BW, Han M, Kim JC, Feinberg AP, Gerald WL, Vargas SO, Chin L, Iafrate AJ, Bell DW, Haber DA", "evidence": [ { "database": "Reactome", "id": "R-HSA-195253", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-195253" } ], "reference": [ { "type": "PubMed", "id": "17204608", "url": "https://glygen.org/publication/PubMed/17204608" } ] }, { "title": "NEDD4-1 is a proto-oncogenic ubiquitin ligase for PTEN.", "journal": "Cell", "date": "2007", "authors": "Wang X, Trotman LC, Koppie T, Alimonti A, Chen Z, Gao Z, Wang J, Erdjument-Bromage H, Tempst P, Cordon-Cardo C, Pandolfi PP, Jiang X", "evidence": [ { "database": "Reactome", "id": "R-HSA-8948751", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8948751" } ], "reference": [ { "type": "PubMed", "id": "17218260", "url": "https://glygen.org/publication/PubMed/17218260" } ] }, { "title": "Basis for a ubiquitin-like protein thioester switch toggling E1-E2 affinity.", "journal": "Nature", "date": "2007", "authors": "Huang DT, Hunt HW, Zhuang M, Ohi MD, Holton JM, Schulman BA", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "17220875", "url": "https://glygen.org/publication/PubMed/17220875" } ] }, { "title": "The APC/C inhibitor, Emi1, is essential for prevention of rereplication.", "journal": "Genes & development", "date": "2007", "authors": "Machida YJ, Dutta A", "evidence": [ { "database": "Reactome", "id": "R-HSA-68867", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-68867" } ], "reference": [ { "type": "PubMed", "id": "17234884", "url": "https://glygen.org/publication/PubMed/17234884" } ] }, { "title": "PRAK is essential for ras-induced senescence and tumor suppression.", "journal": "Cell", "date": "2007", "authors": "Sun P, Yoshizuka N, New L, Moser BA, Li Y, Liao R, Xie C, Chen J, Deng Q, Yamout M, Dong MQ, Frangou CG, Yates JR 3rd, Wright PE, Han J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "17254968", "url": "https://glygen.org/publication/PubMed/17254968" } ] }, { "title": "A novel protein-processing domain in Gli2 and Gli3 differentially blocks complete protein degradation by the proteasome.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Pan Y, Wang B", "evidence": [ { "database": "Reactome", "id": "R-HSA-5610783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5610783" } ], "reference": [ { "type": "PubMed", "id": "17283082", "url": "https://glygen.org/publication/PubMed/17283082" } ] }, { "title": "The deubiquitinating enzyme USP2a regulates the p53 pathway by targeting Mdm2.", "journal": "The EMBO journal", "date": "2007", "authors": "Stevenson LF, Sparks A, Allende-Vega N, Xirodimas DP, Lane DP, Saville MK", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "17290220", "url": "https://glygen.org/publication/PubMed/17290220" } ] }, { "title": "Protein phosphatase 1 regulates assembly and function of the beta-catenin degradation complex.", "journal": "The EMBO journal", "date": "2007", "authors": "Luo W, Peterson A, Garcia BA, Coombs G, Kofahl B, Heinrich R, Shabanowitz J, Hunt DF, Yost HJ, Virshup DM", "evidence": [ { "database": "Reactome", "id": "R-HSA-195253", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-195253" } ], "reference": [ { "type": "PubMed", "id": "17318175", "url": "https://glygen.org/publication/PubMed/17318175" } ] }, { "title": "Mass spectrometric characterization of the affinity-purified human 26S proteasome complex.", "journal": "Biochemistry", "date": "2007", "authors": "Wang X, Chen CF, Baker PR, Chen PL, Kaiser P, Huang L", "evidence": [ { "database": "UniProtKB", "id": "O00231", "url": "https://www.uniprot.org/uniprot/O00231" }, { "database": "iPTMnet", "id": "O00231", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O00231" } ], "reference": [ { "type": "PubMed", "id": "17323924", "url": "https://glygen.org/publication/PubMed/17323924" } ] }, { "title": "PARC and CUL7 form atypical cullin RING ligase complexes.", "journal": "Cancer research", "date": "2007", "authors": "Skaar JR, Florens L, Tsutsumi T, Arai T, Tron A, Swanson SK, Washburn MP, DeCaprio JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "17332328", "url": "https://glygen.org/publication/PubMed/17332328" } ] }, { "title": "Phosphorylation and ubiquitination of the IkappaB kinase complex by two distinct signaling pathways.", "journal": "The EMBO journal", "date": "2007", "authors": "Shambharkar PB, Blonska M, Pappu BP, Li H, You Y, Sakurai H, Darnay BG, Hara H, Penninger J, Lin X", "evidence": [ { "database": "Reactome", "id": "R-HSA-202424", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202424" } ], "reference": [ { "type": "PubMed", "id": "17363905", "url": "https://glygen.org/publication/PubMed/17363905" } ] }, { "title": "Endothelial cell migration during angiogenesis.", "journal": "Circulation research", "date": "2007", "authors": "Lamalice L, Le Boeuf F, Huot J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "17395884", "url": "https://glygen.org/publication/PubMed/17395884" } ] }, { "title": "CARMA1 coiled-coil domain is involved in the oligomerization and subcellular localization of CARMA1 and is required for T cell receptor-induced NF-kappaB activation.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Tanner MJ, Hanel W, Gaffen SL, Lin X", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169091", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169091" } ], "reference": [ { "type": "PubMed", "id": "17428801", "url": "https://glygen.org/publication/PubMed/17428801" } ] }, { "title": "Expression and purification of catalytically active human PHD3 in Escherichia coli.", "journal": "Protein expression and purification", "date": "2007", "authors": "Fedulova N, Hanrieder J, Bergquist J, Emren LO", "evidence": [ { "database": "Reactome", "id": "R-HSA-1234176", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1234176" } ], "reference": [ { "type": "PubMed", "id": "17434750", "url": "https://glygen.org/publication/PubMed/17434750" } ] }, { "title": "Genomic characterization of Gli-activator targets in sonic hedgehog-mediated neural patterning.", "journal": "Development (Cambridge, England)", "date": "2007", "authors": "Vokes SA, Ji H, McCuine S, Tenzen T, Giles S, Zhong S, Longabaugh WJ, Davidson EH, Wong WH, McMahon AP", "evidence": [ { "database": "Reactome", "id": "R-HSA-5632684", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5632684" } ], "reference": [ { "type": "PubMed", "id": "17442700", "url": "https://glygen.org/publication/PubMed/17442700" } ] }, { "title": "Anaphase initiation is regulated by antagonistic ubiquitination and deubiquitination activities.", "journal": "Nature", "date": "2007", "authors": "Stegmeier F, Rape M, Draviam VM, Nalepa G, Sowa ME, Ang XL, McDonald ER 3rd, Li MZ, Hannon GJ, Sorger PK, Kirschner MW, Harper JW, Elledge SJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "17443180", "url": "https://glygen.org/publication/PubMed/17443180" } ] }, { "title": "Post-translational modifications regulate distinct functions of CARMA1 and BCL10.", "journal": "Trends in immunology", "date": "2007", "authors": "Thome M, Weil R", "evidence": [ { "database": "Reactome", "id": "R-HSA-202424", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202424" } ], "reference": [ { "type": "PubMed", "id": "17468049", "url": "https://glygen.org/publication/PubMed/17468049" } ] }, { "title": "Emi1 is needed to couple DNA replication with mitosis but does not regulate activation of the mitotic APC/C.", "journal": "The Journal of cell biology", "date": "2007", "authors": "Di Fiore B, Pines J", "evidence": [ { "database": "Reactome", "id": "R-HSA-68867", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-68867" } ], "reference": [ { "type": "PubMed", "id": "17485488", "url": "https://glygen.org/publication/PubMed/17485488" } ] }, { "title": "Ubiquitin-mediated activation of TAK1 and IKK.", "journal": "Oncogene", "date": "2007", "authors": "Adhikari A, Xu M, Chen ZJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-202424", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202424" } ], "reference": [ { "type": "PubMed", "id": "17496917", "url": "https://glygen.org/publication/PubMed/17496917" } ] }, { "title": "COMMD proteins: COMMing to the scene.", "journal": "Cellular and molecular life sciences : CMLS", "date": "2007", "authors": "Maine GN, Burstein E", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "17497243", "url": "https://glygen.org/publication/PubMed/17497243" } ] }, { "title": "Mass spectrometric analysis of the endogenous type I interleukin-1 (IL-1) receptor signaling complex formed after IL-1 binding identifies IL-1RAcP, MyD88, and IRAK-4 as the stable components.", "journal": "Molecular & cellular proteomics : MCP", "date": "2007", "authors": "Brikos C, Wait R, Begum S, O'Neill LA, Saklatvala J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9020702", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9020702" } ], "reference": [ { "type": "PubMed", "id": "17507369", "url": "https://glygen.org/publication/PubMed/17507369" } ] }, { "title": "Region-specific requirement for cholesterol modification of sonic hedgehog in patterning the telencephalon and spinal cord.", "journal": "Development (Cambridge, England)", "date": "2007", "authors": "Huang X, Litingtung Y, Chiang C", "evidence": [ { "database": "Reactome", "id": "R-HSA-5358346", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5358346" } ], "reference": [ { "type": "PubMed", "id": "17507410", "url": "https://glygen.org/publication/PubMed/17507410" } ] }, { "title": "Wilms tumor suppressor WTX negatively regulates WNT/beta-catenin signaling.", "journal": "Science (New York, N.Y.)", "date": "2007", "authors": "Major MB, Camp ND, Berndt JD, Yi X, Goldenberg SJ, Hubbert C, Biechele TL, Gingras AC, Zheng N, Maccoss MJ, Angers S, Moon RT", "evidence": [ { "database": "Reactome", "id": "R-HSA-195253", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-195253" } ], "reference": [ { "type": "PubMed", "id": "17510365", "url": "https://glygen.org/publication/PubMed/17510365" } ] }, { "title": "Molecular mechanism of human Nrf2 activation and degradation: role of sequential phosphorylation by protein kinase CK2.", "journal": "Free radical biology & medicine", "date": "2007", "authors": "Pi J, Bai Y, Reece JM, Williams J, Liu D, Freeman ML, Fahl WE, Shugar D, Liu J, Qu W, Collins S, Waalkes MP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9755511", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9755511" } ], "reference": [ { "type": "PubMed", "id": "17512459", "url": "https://glygen.org/publication/PubMed/17512459" } ] }, { "title": "Bile salt-dependent efflux of cellular phospholipids mediated by ATP binding cassette protein B4.", "journal": "Hepatology (Baltimore, Md.)", "date": "2007", "authors": "Morita SY, Kobayashi A, Takanezawa Y, Kioka N, Handa T, Arai H, Matsuo M, Ueda K", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "17523162", "url": "https://glygen.org/publication/PubMed/17523162" } ] }, { "title": "Mechanism of diacylglycerol-induced membrane targeting and activation of protein kinase Ctheta.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Melowic HR, Stahelin RV, Blatner NR, Tian W, Hayashi K, Altman A, Cho W", "evidence": [ { "database": "Reactome", "id": "R-HSA-202424", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202424" } ], "reference": [ { "type": "PubMed", "id": "17548359", "url": "https://glygen.org/publication/PubMed/17548359" } ] }, { "title": "Cytoplasmic retention, DNA binding and processing of the NF-kappa B p50 precursor are controlled by a small region in its C-terminus.", "journal": "The EMBO journal", "date": "1991", "authors": "Blank V, Kourilsky P, Israel A", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169091", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169091" } ], "reference": [ { "type": "PubMed", "id": "1756723", "url": "https://glygen.org/publication/PubMed/1756723" } ] }, { "title": "Mechanism of action of certolizumab pegol (CDP870): in vitro comparison with other anti-tumor necrosis factor alpha agents.", "journal": "Inflammatory bowel diseases", "date": "2007", "authors": "Nesbitt A, Fossati G, Bergin M, Stephens P, Stephens S, Foulkes R, Brown D, Robinson M, Bourne T", "evidence": [ { "database": "Reactome", "id": "R-HSA-5668541", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5668541" } ], "reference": [ { "type": "PubMed", "id": "17636564", "url": "https://glygen.org/publication/PubMed/17636564" } ] }, { "title": "Patched1 regulates hedgehog signaling at the primary cilium.", "journal": "Science (New York, N.Y.)", "date": "2007", "authors": "Rohatgi R, Milenkovic L, Scott MP", "evidence": [ { "database": "Reactome", "id": "R-HSA-5632684", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5632684" } ], "reference": [ { "type": "PubMed", "id": "17641202", "url": "https://glygen.org/publication/PubMed/17641202" } ] }, { "title": "Kinase-active interleukin-1 receptor-associated kinases promote polyubiquitination and degradation of the Pellino family: direct evidence for PELLINO proteins being ubiquitin-protein isopeptide ligases.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Butler MP, Hanly JA, Moynagh PN", "evidence": [ { "database": "Reactome", "id": "R-HSA-9020702", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9020702" } ], "reference": [ { "type": "PubMed", "id": "17675297", "url": "https://glygen.org/publication/PubMed/17675297" } ] }, { "title": "14-3-3epsilon inhibits MK5-mediated cell migration by disrupting F-actin polymerization.", "journal": "Cellular signalling", "date": "2007", "authors": "Tak H, Jang E, Kim SB, Park J, Suk J, Yoon YS, Ahn JK, Lee JH, Joe CO", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "17728103", "url": "https://glygen.org/publication/PubMed/17728103" } ] }, { "title": "Identification of TRAF6-dependent NEMO polyubiquitination sites through analysis of a new NEMO mutation causing incontinentia pigmenti.", "journal": "Human molecular genetics", "date": "2007", "authors": "Sebban-Benin H, Pescatore A, Fusco F, Pascuale V, Gautheron J, Yamaoka S, Moncla A, Ursini MV, Courtois G", "evidence": [ { "database": "Reactome", "id": "R-HSA-202424", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202424" } ], "reference": [ { "type": "PubMed", "id": "17728323", "url": "https://glygen.org/publication/PubMed/17728323" } ] }, { "title": "Different electrostatic potentials define ETGE and DLG motifs as hinge and latch in oxidative stress response.", "journal": "Molecular and cellular biology", "date": "2007", "authors": "Tong KI, Padmanabhan B, Kobayashi A, Shang C, Hirotsu Y, Yokoyama S, Yamamoto M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "17785452", "url": "https://glygen.org/publication/PubMed/17785452" } ] }, { "title": "GSK-3beta controls osteogenesis through regulating Runx2 activity.", "journal": "PloS one", "date": "2007", "authors": "Kugimiya F, Kawaguchi H, Ohba S, Kawamura N, Hirata M, Chikuda H, Azuma Y, Woodgett JR, Nakamura K, Chung UI", "evidence": [ { "database": "Reactome", "id": "R-HSA-8939902", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8939902" } ], "reference": [ { "type": "PubMed", "id": "17786208", "url": "https://glygen.org/publication/PubMed/17786208" } ] }, { "title": "A mutation in the ATP-binding site of the Kir6.2 subunit of the KATP channel alters coupling with the SUR2A subunit.", "journal": "The Journal of physiology", "date": "2007", "authors": "Tammaro P, Ashcroft FM", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "17855752", "url": "https://glygen.org/publication/PubMed/17855752" } ] }, { "title": "Fbw7 and Usp28 regulate myc protein stability in response to DNA damage.", "journal": "Cell cycle (Georgetown, Tex.)", "date": "2007", "authors": "Popov N, Herold S, Llamazares M, Schulein C, Eilers M", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "17873522", "url": "https://glygen.org/publication/PubMed/17873522" } ] }, { "title": "IRAK1: a critical signaling mediator of innate immunity.", "journal": "Cellular signalling", "date": "2008", "authors": "Gottipati S, Rao NL, Fung-Leung WP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9020702", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9020702" } ], "reference": [ { "type": "PubMed", "id": "17890055", "url": "https://glygen.org/publication/PubMed/17890055" } ] }, { "title": "The N-terminal region of ABC50 interacts with eukaryotic initiation factor eIF2 and is a target for regulatory phosphorylation by CK2.", "journal": "The Biochemical journal", "date": "2008", "authors": "Paytubi S, Morrice NA, Boudeau J, Proud CG", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "17894550", "url": "https://glygen.org/publication/PubMed/17894550" } ] }, { "title": "Human ornithine decarboxylase paralogue (ODCp) is an antizyme inhibitor but not an arginine decarboxylase.", "journal": "The Biochemical journal", "date": "2008", "authors": "Kanerva K, Makitie LT, Pelander A, Heiskala M, Andersson LC", "evidence": [ { "database": "Reactome", "id": "R-HSA-350562", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-350562" } ], "reference": [ { "type": "PubMed", "id": "17900240", "url": "https://glygen.org/publication/PubMed/17900240" } ] }, { "title": "Modulation of F-actin rearrangement by the cyclic AMP/cAMP-dependent protein kinase (PKA) pathway is mediated by MAPK-activated protein kinase 5 and requires PKA-induced nuclear export of MK5.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Gerits N, Mikalsen T, Kostenko S, Shiryaev A, Johannessen M, Moens U", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "17947239", "url": "https://glygen.org/publication/PubMed/17947239" } ] }, { "title": "Malt1 ubiquitination triggers NF-kappaB signaling upon T-cell activation.", "journal": "The EMBO journal", "date": "2007", "authors": "Oeckinghaus A, Wegener E, Welteke V, Ferch U, Arslan SC, Ruland J, Scheidereit C, Krappmann D", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871837" } ], "reference": [ { "type": "PubMed", "id": "17948050", "url": "https://glygen.org/publication/PubMed/17948050" } ] }, { "title": "Identification of a lysosomal peptide transport system induced during dendritic cell development.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Demirel O, Waibler Z, Kalinke U, Grunebach F, Appel S, Brossart P, Hasilik A, Tampe R, Abele R", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "17977821", "url": "https://glygen.org/publication/PubMed/17977821" } ] }, { "title": "Capsaicin induces heme oxygenase-1 expression in HepG2 cells via activation of PI3K-Nrf2 signaling: NAD(P)H:quinone oxidoreductase as a potential target.", "journal": "Antioxidants & redox signaling", "date": "2007", "authors": "Joung EJ, Li MH, Lee HG, Somparn N, Jung YS, Na HK, Kim SH, Cha YN, Surh YJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9755511", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9755511" } ], "reference": [ { "type": "PubMed", "id": "17979524", "url": "https://glygen.org/publication/PubMed/17979524" } ] }, { "title": "Human USP3 is a chromatin modifier required for S phase progression and genome stability.", "journal": "Current biology : CB", "date": "2007", "authors": "Nicassio F, Corrado N, Vissers JH, Areces LB, Bergink S, Marteijn JA, Geverts B, Houtsmuller AB, Vermeulen W, Di Fiore PP, Citterio E", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "17980597", "url": "https://glygen.org/publication/PubMed/17980597" } ] }, { "title": "Regulation of early wave of germ cell apoptosis and spermatogenesis by deubiquitinating enzyme CYLD.", "journal": "Developmental cell", "date": "2007", "authors": "Wright A, Reiley WW, Chang M, Jin W, Lee AJ, Zhang M, Sun SC", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "17981138", "url": "https://glygen.org/publication/PubMed/17981138" } ] }, { "title": "The IRAK-catalysed activation of the E3 ligase function of Pellino isoforms induces the Lys63-linked polyubiquitination of IRAK1.", "journal": "The Biochemical journal", "date": "2008", "authors": "Ordureau A, Smith H, Windheim M, Peggie M, Carrick E, Morrice N, Cohen P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9020702", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9020702" } ], "reference": [ { "type": "PubMed", "id": "17997719", "url": "https://glygen.org/publication/PubMed/17997719" } ] }, { "title": "Kalirin-7 controls activity-dependent structural and functional plasticity of dendritic spines.", "journal": "Neuron", "date": "2007", "authors": "Xie Z, Srivastava DP, Photowala H, Kai L, Cahill ME, Woolfrey KM, Shum CY, Surmeier DJ, Penzes P", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "18031682", "url": "https://glygen.org/publication/PubMed/18031682" } ] }, { "title": "TRAF6 distinctively mediates MyD88- and IRAK-1-induced activation of NF-kappaB.", "journal": "Journal of leukocyte biology", "date": "2008", "authors": "Muroi M, Tanamoto K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9020702", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9020702" } ], "reference": [ { "type": "PubMed", "id": "18070982", "url": "https://glygen.org/publication/PubMed/18070982" } ] }, { "title": "Downregulation of COP9 signalosome subunits differentially affects the CSN complex and target protein stability.", "journal": "BMC biochemistry", "date": "2007", "authors": "Peth A, Berndt C, Henke W, Dubiel W", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "18093314", "url": "https://glygen.org/publication/PubMed/18093314" } ] }, { "title": "Proto-oncogene ACTR/AIB1 promotes cancer cell invasion by up-regulating specific matrix metalloproteinase expression.", "journal": "Cancer letters", "date": "2008", "authors": "Li LB, Louie MC, Chen HW, Zou JX", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "18162290", "url": "https://glygen.org/publication/PubMed/18162290" } ] }, { "title": "Deubiquitylation of histone H2A activates transcriptional initiation via trans-histone cross-talk with H3K4 di- and trimethylation.", "journal": "Genes & development", "date": "2008", "authors": "Nakagawa T, Kajitani T, Togo S, Masuko N, Ohdan H, Hishikawa Y, Koji T, Matsuyama T, Ikura T, Muramatsu M, Ito T", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "18172164", "url": "https://glygen.org/publication/PubMed/18172164" } ] }, { "title": "Interleukin-1 (IL-1) induces the Lys63-linked polyubiquitination of IL-1 receptor-associated kinase 1 to facilitate NEMO binding and the activation of IkappaBalpha kinase.", "journal": "Molecular and cellular biology", "date": "2008", "authors": "Windheim M, Stafford M, Peggie M, Cohen P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9020702", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9020702" } ], "reference": [ { "type": "PubMed", "id": "18180283", "url": "https://glygen.org/publication/PubMed/18180283" } ] }, { "title": "A gain-of-function mutation in the HIF2A gene in familial erythrocytosis.", "journal": "The New England journal of medicine", "date": "2008", "authors": "Percy MJ, Furlow PW, Lucas GS, Li X, Lappin TR, McMullin MF, Lee FS", "evidence": [ { "database": "Reactome", "id": "R-HSA-1234176", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1234176" } ], "reference": [ { "type": "PubMed", "id": "18184961", "url": "https://glygen.org/publication/PubMed/18184961" } ] }, { "title": "Dcn1 functions as a scaffold-type E3 ligase for cullin neddylation.", "journal": "Molecular cell", "date": "2008", "authors": "Kurz T, Chou YC, Willems AR, Meyer-Schaller N, Hecht ML, Tyers M, Peter M, Sicheri F", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "18206966", "url": "https://glygen.org/publication/PubMed/18206966" } ] }, { "title": "A functional link between the human cell cycle-regulatory phosphatase Cdc14A and the atypical mitogen-activated kinase Erk3.", "journal": "Cell cycle (Georgetown, Tex.)", "date": "2008", "authors": "Hansen CA, Bartek J, Jensen S", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "18235225", "url": "https://glygen.org/publication/PubMed/18235225" } ] }, { "title": "Multiple nuclear localization signals function in the nuclear import of the transcription factor Nrf2.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Theodore M, Kawai Y, Yang J, Kleshchenko Y, Reddy SP, Villalta F, Arinze IJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9755511", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9755511" } ], "reference": [ { "type": "PubMed", "id": "18238777", "url": "https://glygen.org/publication/PubMed/18238777" } ] }, { "title": "The Ser(186) phospho-acceptor site within ERK4 is essential for its ability to interact with and activate PRAK/MK5.", "journal": "The Biochemical journal", "date": "2008", "authors": "Perander M, Aberg E, Johansen B, Dreyer B, Guldvik IJ, Outzen H, Keyse SM, Seternes OM", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "18248330", "url": "https://glygen.org/publication/PubMed/18248330" } ] }, { "title": "Endocytosis mechanisms and the cell biology of antigen presentation.", "journal": "Current opinion in immunology", "date": "2008", "authors": "Burgdorf S, Kurts C", "evidence": [ { "database": "Reactome", "id": "R-HSA-1236978", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1236978" } ], "reference": [ { "type": "PubMed", "id": "18249105", "url": "https://glygen.org/publication/PubMed/18249105" } ] }, { "title": "OS-9 and GRP94 deliver mutant alpha1-antitrypsin to the Hrd1-SEL1L ubiquitin ligase complex for ERAD.", "journal": "Nature cell biology", "date": "2008", "authors": "Christianson JC, Shaler TA, Tyler RE, Kopito RR", "evidence": [ { "database": "Reactome", "id": "R-HSA-5358346", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5358346" } ], "reference": [ { "type": "PubMed", "id": "18264092", "url": "https://glygen.org/publication/PubMed/18264092" } ] }, { "title": "Phosphorylation of Nrf2 in the transcription activation domain by casein kinase 2 (CK2) is critical for the nuclear translocation and transcription activation function of Nrf2 in IMR-32 neuroblastoma cells.", "journal": "Journal of biochemical and molecular toxicology", "date": "2008", "authors": "Apopa PL, He X, Ma Q", "evidence": [ { "database": "Reactome", "id": "R-HSA-9755511", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9755511" } ], "reference": [ { "type": "PubMed", "id": "18273910", "url": "https://glygen.org/publication/PubMed/18273910" } ] }, { "title": "Yap1 phosphorylation by c-Abl is a critical step in selective activation of proapoptotic genes in response to DNA damage.", "journal": "Molecular cell", "date": "2008", "authors": "Levy D, Adamovich Y, Reuven N, Shaul Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-8939236", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8939236" } ], "reference": [ { "type": "PubMed", "id": "18280240", "url": "https://glygen.org/publication/PubMed/18280240" } ] }, { "title": "Interleukin-1 (IL-1) receptor antagonist binds to the 80-kDa IL-1 receptor but does not initiate IL-1 signal transduction.", "journal": "The Journal of biological chemistry", "date": "1991", "authors": "Dripps DJ, Brandhuber BJ, Thompson RC, Eisenberg SP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9020702", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9020702" } ], "reference": [ { "type": "PubMed", "id": "1828071", "url": "https://glygen.org/publication/PubMed/1828071" } ] }, { "title": "Trabid, a new positive regulator of Wnt-induced transcription with preference for binding and cleaving K63-linked ubiquitin chains.", "journal": "Genes & development", "date": "2008", "authors": "Tran H, Hamada F, Schwarz-Romond T, Bienz M", "evidence": [ { "database": "Reactome", "id": "R-HSA-195253", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-195253" } ], "reference": [ { "type": "PubMed", "id": "18281465", "url": "https://glygen.org/publication/PubMed/18281465" } ] }, { "title": "Inhibition of MDR1 expression by retinol treatment increases sensitivity to etoposide (VP16) in human neoplasic cell line.", "journal": "Toxicology in vitro : an international journal published in association with BIBRA", "date": "2008", "authors": "Klamt F, Passos DT, Castro MA, Gelain DP, Grivicich I, Moreira JC", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "18282684", "url": "https://glygen.org/publication/PubMed/18282684" } ] }, { "title": "A novel IL-1 receptor, cloned from B cells by mammalian expression, is expressed in many cell types.", "journal": "The EMBO journal", "date": "1991", "authors": "McMahan CJ, Slack JL, Mosley B, Cosman D, Lupton SD, Brunton LL, Grubin CE, Wignall JM, Jenkins NA, Brannan CI, et al.", "evidence": [ { "database": "Reactome", "id": "R-HSA-9020702", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9020702" } ], "reference": [ { "type": "PubMed", "id": "1833184", "url": "https://glygen.org/publication/PubMed/1833184" } ] }, { "title": "Prolyl hydroxylase PHD3 activates oxygen-dependent protein aggregation.", "journal": "Molecular biology of the cell", "date": "2008", "authors": "Rantanen K, Pursiheimo J, Hogel H, Himanen V, Metzen E, Jaakkola PM", "evidence": [ { "database": "Reactome", "id": "R-HSA-1234176", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1234176" } ], "reference": [ { "type": "PubMed", "id": "18337469", "url": "https://glygen.org/publication/PubMed/18337469" } ] }, { "title": "Peptide specificity and lipid activation of the lysosomal transport complex ABCB9 (TAPL).", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Zhao C, Haase W, Tampe R, Abele R", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "18434309", "url": "https://glygen.org/publication/PubMed/18434309" } ] }, { "title": "Sequential control of Toll-like receptor-dependent responses by IRAK1 and IRAK2.", "journal": "Nature immunology", "date": "2008", "authors": "Kawagoe T, Sato S, Matsushita K, Kato H, Matsui K, Kumagai Y, Saitoh T, Kawai T, Takeuchi O, Akira S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9020702", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9020702" } ], "reference": [ { "type": "PubMed", "id": "18438411", "url": "https://glygen.org/publication/PubMed/18438411" } ] }, { "title": "Application of active and kinase-deficient kinome collection for identification of kinases regulating hedgehog signaling.", "journal": "Cell", "date": "2008", "authors": "Varjosalo M, Bjorklund M, Cheng F, Syvanen H, Kivioja T, Kilpinen S, Sun Z, Kallioniemi O, Stunnenberg HG, He WW, Ojala P, Taipale J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5632684", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5632684" } ], "reference": [ { "type": "PubMed", "id": "18455992", "url": "https://glygen.org/publication/PubMed/18455992" } ] }, { "title": "NF-kappaB p52, RelB and c-Rel are transported into the nucleus via a subset of importin alpha molecules.", "journal": "Cellular signalling", "date": "2008", "authors": "Fagerlund R, Melen K, Cao X, Julkunen I", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169091", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169091" } ], "reference": [ { "type": "PubMed", "id": "18462924", "url": "https://glygen.org/publication/PubMed/18462924" } ] }, { "title": "Regulation of IkappaB kinase-related kinases and antiviral responses by tumor suppressor CYLD.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Zhang M, Wu X, Lee AJ, Jin W, Chang M, Wright A, Imaizumi T, Sun SC", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "18467330", "url": "https://glygen.org/publication/PubMed/18467330" } ] }, { "title": "Mechanism of ubiquitin-chain formation by the human anaphase-promoting complex.", "journal": "Cell", "date": "2008", "authors": "Jin L, Williamson A, Banerjee S, Philipp I, Rape M", "evidence": [ { "database": "Reactome", "id": "R-HSA-174154", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-174154" } ], "reference": [ { "type": "PubMed", "id": "18485873", "url": "https://glygen.org/publication/PubMed/18485873" } ] }, { "title": "Beta-arrestin-mediated localization of smoothened to the primary cilium.", "journal": "Science (New York, N.Y.)", "date": "2008", "authors": "Kovacs JJ, Whalen EJ, Liu R, Xiao K, Kim J, Chen M, Wang J, Chen W, Lefkowitz RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5632684", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5632684" } ], "reference": [ { "type": "PubMed", "id": "18497258", "url": "https://glygen.org/publication/PubMed/18497258" } ] }, { "title": "Ubiquitin docking at the proteasome through a novel pleckstrin-homology domain interaction.", "journal": "Nature", "date": "2008", "authors": "Schreiner P, Chen X, Husnjak K, Randles L, Zhang N, Elsasser S, Finley D, Dikic I, Walters KJ, Groll M", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689603", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689603" } ], "reference": [ { "type": "PubMed", "id": "18497827", "url": "https://glygen.org/publication/PubMed/18497827" } ] }, { "title": "Human XTP3-B forms an endoplasmic reticulum quality control scaffold with the HRD1-SEL1L ubiquitin ligase complex and BiP.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Hosokawa N, Wada I, Nagasawa K, Moriyama T, Okawa K, Nagata K", "evidence": [ { "database": "Reactome", "id": "R-HSA-5358346", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5358346" } ], "reference": [ { "type": "PubMed", "id": "18502753", "url": "https://glygen.org/publication/PubMed/18502753" } ] }, { "title": "Hhat is a palmitoylacyltransferase with specificity for N-palmitoylation of Sonic Hedgehog.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Buglino JA, Resh MD", "evidence": [ { "database": "Reactome", "id": "R-HSA-5358346", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5358346" } ], "reference": [ { "type": "PubMed", "id": "18534984", "url": "https://glygen.org/publication/PubMed/18534984" } ] }, { "title": "CHIP promotes Runx2 degradation and negatively regulates osteoblast differentiation.", "journal": "The Journal of cell biology", "date": "2008", "authors": "Li X, Huang M, Zheng H, Wang Y, Ren F, Shang Y, Zhai Y, Irwin DM, Shi Y, Chen D, Chang Z", "evidence": [ { "database": "Reactome", "id": "R-HSA-8939902", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8939902" } ], "reference": [ { "type": "PubMed", "id": "18541707", "url": "https://glygen.org/publication/PubMed/18541707" } ] }, { "title": "Chaperone Hsp27, a novel subunit of AUF1 protein complexes, functions in AU-rich element-mediated mRNA decay.", "journal": "Molecular and cellular biology", "date": "2008", "authors": "Sinsimer KS, Gratacos FM, Knapinska AM, Lu J, Krause CD, Wierzbowski AV, Maher LR, Scrudato S, Rivera YM, Gupta S, Turrin DK, De La Cruz MP, Pestka S, Brewer G", "evidence": [ { "database": "Reactome", "id": "R-HSA-450408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-450408" } ], "reference": [ { "type": "PubMed", "id": "18573886", "url": "https://glygen.org/publication/PubMed/18573886" } ] }, { "title": "Steroid receptor coactivator-3/AIB1 promotes cell migration and invasiveness through focal adhesion turnover and matrix metalloproteinase expression.", "journal": "Cancer research", "date": "2008", "authors": "Yan J, Erdem H, Li R, Cai Y, Ayala G, Ittmann M, Yu-Lee LY, Tsai SY, Tsai MJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "18593949", "url": "https://glygen.org/publication/PubMed/18593949" } ] }, { "title": "Vasopressin-inducible ubiquitin-specific protease 10 increases ENaC cell surface expression by deubiquitylating and stabilizing sorting nexin 3.", "journal": "American journal of physiology. Renal physiology", "date": "2008", "authors": "Boulkroun S, Ruffieux-Daidie D, Vitagliano JJ, Poirot O, Charles RP, Lagnaz D, Firsov D, Kellenberger S, Staub O", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "18632802", "url": "https://glygen.org/publication/PubMed/18632802" } ] }, { "title": "SUMOylation target sites at the C terminus protect Axin from ubiquitination and confer protein stability.", "journal": "FASEB journal : official publication of the Federation of American Societies for Experimental Biology", "date": "2008", "authors": "Kim MJ, Chia IV, Costantini F", "evidence": [ { "database": "Reactome", "id": "R-HSA-195253", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-195253" } ], "reference": [ { "type": "PubMed", "id": "18632848", "url": "https://glygen.org/publication/PubMed/18632848" } ] }, { "title": "Essential cytoplasmic translocation of a cytokine receptor-assembled signaling complex.", "journal": "Science (New York, N.Y.)", "date": "2008", "authors": "Matsuzawa A, Tseng PH, Vallabhapurapu S, Luo JL, Zhang W, Wang H, Vignali DA, Gallagher E, Karin M", "evidence": [ { "database": "Reactome", "id": "R-HSA-5668541", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5668541" } ], "reference": [ { "type": "PubMed", "id": "18635759", "url": "https://glygen.org/publication/PubMed/18635759" } ] }, { "title": "The tumour suppressor CYLD is a negative regulator of RIG-I-mediated antiviral response.", "journal": "EMBO reports", "date": "2008", "authors": "Friedman CS, O'Donnell MA, Legarda-Addison D, Ng A, Cardenas WB, Yount JS, Moran TM, Basler CF, Komuro A, Horvath CM, Xavier R, Ting AT", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "18636086", "url": "https://glygen.org/publication/PubMed/18636086" } ] }, { "title": "The AIB1 oncogene promotes breast cancer metastasis by activation of PEA3-mediated matrix metalloproteinase 2 (MMP2) and MMP9 expression.", "journal": "Molecular and cellular biology", "date": "2008", "authors": "Qin L, Liao L, Redmond A, Young L, Yuan Y, Chen H, O'Malley BW, Xu J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "18644862", "url": "https://glygen.org/publication/PubMed/18644862" } ] }, { "title": "Structural insights into E1-catalyzed ubiquitin activation and transfer to conjugating enzymes.", "journal": "Cell", "date": "2008", "authors": "Lee I, Schindelin H", "evidence": [ { "database": "Reactome", "id": "R-HSA-983168", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983168" } ], "reference": [ { "type": "PubMed", "id": "18662542", "url": "https://glygen.org/publication/PubMed/18662542" } ] }, { "title": "A quantitative atlas of mitotic phosphorylation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2008", "authors": "Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP", "evidence": [ { "database": "UniProtKB", "id": "O00231", "url": "https://www.uniprot.org/uniprot/O00231" }, { "database": "iPTMnet", "id": "O00231-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O00231-1" } ], "reference": [ { "type": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" } ] }, { "title": "Phosphorylation of SNAP-23 by IkappaB kinase 2 regulates mast cell degranulation.", "journal": "Cell", "date": "2008", "authors": "Suzuki K, Verma IM", "evidence": [ { "database": "Reactome", "id": "R-HSA-1236974", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1236974" } ], "reference": [ { "type": "PubMed", "id": "18692471", "url": "https://glygen.org/publication/PubMed/18692471" } ] }, { "title": "A regulatory circuit controlling Itch-mediated p73 degradation by Runx.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Levy D, Reuven N, Shaul Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-8939236", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8939236" } ], "reference": [ { "type": "PubMed", "id": "18701449", "url": "https://glygen.org/publication/PubMed/18701449" } ] }, { "title": "SEL1L nucleates a protein complex required for dislocation of misfolded glycoproteins.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2008", "authors": "Mueller B, Klemm EJ, Spooner E, Claessen JH, Ploegh HL", "evidence": [ { "database": "Reactome", "id": "R-HSA-5358346", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5358346" } ], "reference": [ { "type": "PubMed", "id": "18711132", "url": "https://glygen.org/publication/PubMed/18711132" } ] }, { "title": "Assembly and misassembly of cystic fibrosis transmembrane conductance regulator: folding defects caused by deletion of F508 occur before and after the calnexin-dependent association of membrane spanning domain (MSD) 1 and MSD2.", "journal": "Molecular biology of the cell", "date": "2008", "authors": "Rosser MF, Grove DE, Chen L, Cyr DM", "evidence": [ { "database": "Reactome", "id": "R-HSA-5678895", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5678895" } ], "reference": [ { "type": "PubMed", "id": "18716059", "url": "https://glygen.org/publication/PubMed/18716059" } ] }, { "title": "Brk is coamplified with ErbB2 to promote proliferation in breast cancer.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2008", "authors": "Xiang B, Chatti K, Qiu H, Lakshmi B, Krasnitz A, Hicks J, Yu M, Miller WT, Muthuswamy SK", "evidence": [ { "database": "Reactome", "id": "R-HSA-187577", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-187577" } ], "reference": [ { "type": "PubMed", "id": "18719096", "url": "https://glygen.org/publication/PubMed/18719096" } ] }, { "title": "Activation loop phosphorylation of the atypical MAP kinases ERK3 and ERK4 is required for binding, activation and cytoplasmic relocalization of MK5.", "journal": "Journal of cellular physiology", "date": "2008", "authors": "Deleris P, Rousseau J, Coulombe P, Rodier G, Tanguay PL, Meloche S", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "18720373", "url": "https://glygen.org/publication/PubMed/18720373" } ] }, { "title": "TRAF6 specifically contributes to FcepsilonRI-mediated cytokine production but not mast cell degranulation.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Yang YJ, Chen W, Carrigan SO, Chen WM, Roth K, Akiyama T, Inoue J, Marshall JS, Berman JN, Lin TJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871837" } ], "reference": [ { "type": "PubMed", "id": "18772140", "url": "https://glygen.org/publication/PubMed/18772140" } ] }, { "title": "UBXD7 binds multiple ubiquitin ligases and implicates p97 in HIF1alpha turnover.", "journal": "Cell", "date": "2008", "authors": "Alexandru G, Graumann J, Smith GT, Kolawa NJ, Fang R, Deshaies RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "18775313", "url": "https://glygen.org/publication/PubMed/18775313" } ] }, { "title": "Comparative analysis of mRNA targets for human PUF-family proteins suggests extensive interaction with the miRNA regulatory system.", "journal": "PloS one", "date": "2008", "authors": "Galgano A, Forrer M, Jaskiewicz L, Kanitz A, Zavolan M, Gerber AP", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "18776931", "url": "https://glygen.org/publication/PubMed/18776931" } ] }, { "title": "Structural insights into NEDD8 activation of cullin-RING ligases: conformational control of conjugation.", "journal": "Cell", "date": "2008", "authors": "Duda DM, Borg LA, Scott DC, Hunt HW, Hammel M, Schulman BA", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "18805092", "url": "https://glygen.org/publication/PubMed/18805092" } ] }, { "title": "SCCRO (DCUN1D1) is an essential component of the E3 complex for neddylation.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Kim AY, Bommelje CC, Lee BE, Yonekawa Y, Choi L, Morris LG, Huang G, Kaufman A, Ryan RJ, Hao B, Ramanathan Y, Singh B", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "18826954", "url": "https://glygen.org/publication/PubMed/18826954" } ] }, { "title": "Kinome siRNA screen identifies regulators of ciliogenesis and hedgehog signal transduction.", "journal": "Science signaling", "date": "2008", "authors": "Evangelista M, Lim TY, Lee J, Parker L, Ashique A, Peterson AS, Ye W, Davis DP, de Sauvage FJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5632684", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5632684" } ], "reference": [ { "type": "PubMed", "id": "18827223", "url": "https://glygen.org/publication/PubMed/18827223" } ] }, { "title": "A genome-scale analysis of the cis-regulatory circuitry underlying sonic hedgehog-mediated patterning of the mammalian limb.", "journal": "Genes & development", "date": "2008", "authors": "Vokes SA, Ji H, Wong WH, McMahon AP", "evidence": [ { "database": "Reactome", "id": "R-HSA-5632684", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5632684" } ], "reference": [ { "type": "PubMed", "id": "18832070", "url": "https://glygen.org/publication/PubMed/18832070" } ] }, { "title": "Multimodal activation of the ubiquitin ligase SCF by Nedd8 conjugation.", "journal": "Molecular cell", "date": "2008", "authors": "Saha A, Deshaies RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "18851830", "url": "https://glygen.org/publication/PubMed/18851830" } ] }, { "title": "The COP9 signalosome: more than a protease.", "journal": "Trends in biochemical sciences", "date": "2008", "authors": "Wei N, Serino G, Deng XW", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "18926707", "url": "https://glygen.org/publication/PubMed/18926707" } ] }, { "title": "Nonredundant and complementary functions of TRAF2 and TRAF3 in a ubiquitination cascade that activates NIK-dependent alternative NF-kappaB signaling.", "journal": "Nature immunology", "date": "2008", "authors": "Vallabhapurapu S, Matsuzawa A, Zhang W, Tseng PH, Keats JJ, Wang H, Vignali DA, Bergsagel PL, Karin M", "evidence": [ { "database": "Reactome", "id": "R-HSA-5668541", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5668541" } ], "reference": [ { "type": "PubMed", "id": "18997792", "url": "https://glygen.org/publication/PubMed/18997792" } ] }, { "title": "Noncanonical NF-kappaB activation requires coordinated assembly of a regulatory complex of the adaptors cIAP1, cIAP2, TRAF2 and TRAF3 and the kinase NIK.", "journal": "Nature immunology", "date": "2008", "authors": "Zarnegar BJ, Wang Y, Mahoney DJ, Dempsey PW, Cheung HH, He J, Shiba T, Yang X, Yeh WC, Mak TW, Korneluk RG, Cheng G", "evidence": [ { "database": "Reactome", "id": "R-HSA-5668541", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5668541" } ], "reference": [ { "type": "PubMed", "id": "18997794", "url": "https://glygen.org/publication/PubMed/18997794" } ] }, { "title": "One step at a time: endoplasmic reticulum-associated degradation.", "journal": "Nature reviews. Molecular cell biology", "date": "2008", "authors": "Vembar SS, Brodsky JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-5358346", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5358346" } ], "reference": [ { "type": "PubMed", "id": "19002207", "url": "https://glygen.org/publication/PubMed/19002207" } ] }, { "title": "USP19 deubiquitinating enzyme supports cell proliferation by stabilizing KPC1, a ubiquitin ligase for p27Kip1.", "journal": "Molecular and cellular biology", "date": "2009", "authors": "Lu Y, Adegoke OA, Nepveu A, Nakayama KI, Bedard N, Cheng D, Peng J, Wing SS", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "19015242", "url": "https://glygen.org/publication/PubMed/19015242" } ] }, { "title": "Maturation of human dendritic cells is accompanied by functional remodelling of the ubiquitin-proteasome system.", "journal": "The international journal of biochemistry & cell biology", "date": "2009", "authors": "Ebstein F, Lange N, Urban S, Seifert U, Kruger E, Kloetzel PM", "evidence": [ { "database": "Reactome", "id": "R-HSA-983168", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983168" } ], "reference": [ { "type": "PubMed", "id": "19028597", "url": "https://glygen.org/publication/PubMed/19028597" } ] }, { "title": "Phosphorylation of Gli2 by protein kinase A is required for Gli2 processing and degradation and the Sonic Hedgehog-regulated mouse development.", "journal": "Developmental biology", "date": "2009", "authors": "Pan Y, Wang C, Wang B", "evidence": [ { "database": "Reactome", "id": "R-HSA-5610783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5610783" } ], "reference": [ { "type": "PubMed", "id": "19056373", "url": "https://glygen.org/publication/PubMed/19056373" } ] }, { "title": "APC is essential for targeting phosphorylated beta-catenin to the SCFbeta-TrCP ubiquitin ligase.", "journal": "Molecular cell", "date": "2008", "authors": "Su Y, Fu C, Ishikawa S, Stella A, Kojima M, Shitoh K, Schreiber EM, Day BW, Liu B", "evidence": [ { "database": "Reactome", "id": "R-HSA-195253", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-195253" } ], "reference": [ { "type": "PubMed", "id": "19061640", "url": "https://glygen.org/publication/PubMed/19061640" } ] }, { "title": "Analysis of nucleocytoplasmic shuttling of NF kappa B proteins in human leukocytes.", "journal": "Methods in molecular biology (Clifton, N.J.)", "date": "2008", "authors": "Ghosh CC, Vu HY, Mujo T, Vancurova I", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169091", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169091" } ], "reference": [ { "type": "PubMed", "id": "19066035", "url": "https://glygen.org/publication/PubMed/19066035" } ] }, { "title": "Hedgehog signaling in development and cancer.", "journal": "Developmental cell", "date": "2008", "authors": "Jiang J, Hui CC", "evidence": [ { "database": "Reactome", "id": "R-HSA-5358346", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5358346" } ], "reference": [ { "type": "PubMed", "id": "19081070", "url": "https://glygen.org/publication/PubMed/19081070" } ] }, { "title": "Dectin-1 directs T helper cell differentiation by controlling noncanonical NF-kappaB activation through Raf-1 and Syk.", "journal": "Nature immunology", "date": "2009", "authors": "Gringhuis SI, den Dunnen J, Litjens M, van der Vlist M, Wevers B, Bruijns SC, Geijtenbeek TB", "evidence": [ { "database": "Reactome", "id": "R-HSA-5607761", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5607761" } ], "reference": [ { "type": "PubMed", "id": "19122653", "url": "https://glygen.org/publication/PubMed/19122653" } ] }, { "title": "Small molecule-mediated disruption of Wnt-dependent signaling in tissue regeneration and cancer.", "journal": "Nature chemical biology", "date": "2009", "authors": "Chen B, Dodge ME, Tang W, Lu J, Ma Z, Fan CW, Wei S, Hao W, Kilgore J, Williams NS, Roth MG, Amatruda JF, Chen C, Lum L", "evidence": [ { "database": "Reactome", "id": "R-HSA-4641257", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4641257" } ], "reference": [ { "type": "PubMed", "id": "19125156", "url": "https://glygen.org/publication/PubMed/19125156" } ] }, { "title": "FAM/USP9x, a deubiquitinating enzyme essential for TGFbeta signaling, controls Smad4 monoubiquitination.", "journal": "Cell", "date": "2009", "authors": "Dupont S, Mamidi A, Cordenonsi M, Montagner M, Zacchigna L, Adorno M, Martello G, Stinchfield MJ, Soligo S, Morsut L, Inui M, Moro S, Modena N, Argenton F, Newfeld SJ, Piccolo S", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "19135894", "url": "https://glygen.org/publication/PubMed/19135894" } ] }, { "title": "PKA-induced F-actin rearrangement requires phosphorylation of Hsp27 by the MAPKAP kinase MK5.", "journal": "Cellular signalling", "date": "2009", "authors": "Kostenko S, Johannessen M, Moens U", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "19166925", "url": "https://glygen.org/publication/PubMed/19166925" } ] }, { "title": "USP17 regulates Ras activation and cell proliferation by blocking RCE1 activity.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Burrows JF, Kelvin AA, McFarlane C, Burden RE, McGrattan MJ, De la Vega M, Govender U, Quinn DJ, Dib K, Gadina M, Scott CJ, Johnston JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "19188362", "url": "https://glygen.org/publication/PubMed/19188362" } ] }, { "title": "Association of C-terminal ubiquitin hydrolase BRCA1-associated protein 1 with cell cycle regulator host cell factor 1.", "journal": "Molecular and cellular biology", "date": "2009", "authors": "Misaghi S, Ottosen S, Izrael-Tomasevic A, Arnott D, Lamkanfi M, Lee J, Liu J, O'Rourke K, Dixit VM, Wilson AC", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689603", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689603" } ], "reference": [ { "type": "PubMed", "id": "19188440", "url": "https://glygen.org/publication/PubMed/19188440" } ] }, { "title": "Erythrocytosis-associated HIF-2alpha mutations demonstrate a critical role for residues C-terminal to the hydroxylacceptor proline.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Furlow PW, Percy MJ, Sutherland S, Bierl C, McMullin MF, Master SR, Lappin TR, Lee FS", "evidence": [ { "database": "Reactome", "id": "R-HSA-1234176", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1234176" } ], "reference": [ { "type": "PubMed", "id": "19208626", "url": "https://glygen.org/publication/PubMed/19208626" } ] }, { "title": "MHC molecules and microbial antigen processing in phagosomes.", "journal": "Current opinion in immunology", "date": "2009", "authors": "Ramachandra L, Simmons D, Harding CV", "evidence": [ { "database": "Reactome", "id": "R-HSA-1236974", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1236974" } ], "reference": [ { "type": "PubMed", "id": "19217269", "url": "https://glygen.org/publication/PubMed/19217269" } ] }, { "title": "E2-RING expansion of the NEDD8 cascade confers specificity to cullin modification.", "journal": "Molecular cell", "date": "2009", "authors": "Huang DT, Ayrault O, Hunt HW, Taherbhoy AM, Duda DM, Scott DC, Borg LA, Neale G, Murray PJ, Roussel MF, Schulman BA", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "19250909", "url": "https://glygen.org/publication/PubMed/19250909" } ] }, { "title": "Identification of the phosphorylation sites on the E3 ubiquitin ligase Pellino that are critical for activation by IRAK1 and IRAK4.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2009", "authors": "Smith H, Peggie M, Campbell DG, Vandermoere F, Carrick E, Cohen P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9020702", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9020702" } ], "reference": [ { "type": "PubMed", "id": "19264966", "url": "https://glygen.org/publication/PubMed/19264966" } ] }, { "title": "Fused has evolved divergent roles in vertebrate Hedgehog signalling and motile ciliogenesis.", "journal": "Nature", "date": "2009", "authors": "Wilson CW, Nguyen CT, Chen MH, Yang JH, Gacayan R, Huang J, Chen JN, Chuang PT", "evidence": [ { "database": "Reactome", "id": "R-HSA-5632684", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5632684" } ], "reference": [ { "type": "PubMed", "id": "19305393", "url": "https://glygen.org/publication/PubMed/19305393" } ] }, { "title": "Mechanisms of endocytosis.", "journal": "Annual review of biochemistry", "date": "2009", "authors": "Doherty GJ, McMahon HT", "evidence": [ { "database": "Reactome", "id": "R-HSA-1236978", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1236978" } ], "reference": [ { "type": "PubMed", "id": "19317650", "url": "https://glygen.org/publication/PubMed/19317650" } ] }, { "title": "NRF2 and KEAP1 mutations: permanent activation of an adaptive response in cancer.", "journal": "Trends in biochemical sciences", "date": "2009", "authors": "Hayes JD, McMahon M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "19321346", "url": "https://glygen.org/publication/PubMed/19321346" } ] }, { "title": "Rak functions as a tumor suppressor by regulating PTEN protein stability and function.", "journal": "Cancer cell", "date": "2009", "authors": "Yim EK, Peng G, Dai H, Hu R, Li K, Lu Y, Mills GB, Meric-Bernstam F, Hennessy BT, Craven RJ, Lin SY", "evidence": [ { "database": "Reactome", "id": "R-HSA-8948751", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8948751" } ], "reference": [ { "type": "PubMed", "id": "19345329", "url": "https://glygen.org/publication/PubMed/19345329" } ] }, { "title": "Human OS-9, a lectin required for glycoprotein endoplasmic reticulum-associated degradation, recognizes mannose-trimmed N-glycans.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Hosokawa N, Kamiya Y, Kamiya D, Kato K, Nagata K", "evidence": [ { "database": "Reactome", "id": "R-HSA-5358346", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5358346" } ], "reference": [ { "type": "PubMed", "id": "19346256", "url": "https://glygen.org/publication/PubMed/19346256" } ] }, { "title": "Ubiquitin-like protein activation by E1 enzymes: the apex for downstream signalling pathways.", "journal": "Nature reviews. Molecular cell biology", "date": "2009", "authors": "Schulman BA, Harper JW", "evidence": [ { "database": "Reactome", "id": "R-HSA-983168", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983168" } ], "reference": [ { "type": "PubMed", "id": "19352404", "url": "https://glygen.org/publication/PubMed/19352404" } ] }, { "title": "CARD9 versus CARMA1 in innate and adaptive immunity.", "journal": "Trends in immunology", "date": "2009", "authors": "Hara H, Saito T", "evidence": [ { "database": "Reactome", "id": "R-HSA-5607764", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5607764" } ], "reference": [ { "type": "PubMed", "id": "19359218", "url": "https://glygen.org/publication/PubMed/19359218" } ] }, { "title": "Beta-arrestin-dependent signaling and trafficking of 7-transmembrane receptors is reciprocally regulated by the deubiquitinase USP33 and the E3 ligase Mdm2.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2009", "authors": "Shenoy SK, Modi AS, Shukla AK, Xiao K, Berthouze M, Ahn S, Wilkinson KD, Miller WE, Lefkowitz RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "19363159", "url": "https://glygen.org/publication/PubMed/19363159" } ] }, { "title": "The role of Parafibromin/Hyrax as a nuclear Gli/Ci-interacting protein in Hedgehog target gene control.", "journal": "Mechanisms of development", "date": "2009", "authors": "Mosimann C, Hausmann G, Basler K", "evidence": [ { "database": "Reactome", "id": "R-HSA-5632684", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5632684" } ], "reference": [ { "type": "PubMed", "id": "19368795", "url": "https://glygen.org/publication/PubMed/19368795" } ] }, { "title": "Suppressor of Fused inhibits mammalian Hedgehog signaling in the absence of cilia.", "journal": "Developmental biology", "date": "2009", "authors": "Jia J, Kolterud A, Zeng H, Hoover A, Teglund S, Toftgard R, Liu A", "evidence": [ { "database": "Reactome", "id": "R-HSA-5632684", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5632684" } ], "reference": [ { "type": "PubMed", "id": "19371734", "url": "https://glygen.org/publication/PubMed/19371734" } ] }, { "title": "Regulation of planar cell polarity by Smurf ubiquitin ligases.", "journal": "Cell", "date": "2009", "authors": "Narimatsu M, Bose R, Pye M, Zhang L, Miller B, Ching P, Sakuma R, Luga V, Roncari L, Attisano L, Wrana JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-4608870", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4608870" } ], "reference": [ { "type": "PubMed", "id": "19379695", "url": "https://glygen.org/publication/PubMed/19379695" } ] }, { "title": "The deubiquitinating enzyme USP10 regulates the post-endocytic sorting of cystic fibrosis transmembrane conductance regulator in airway epithelial cells.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Bomberger JM, Barnaby RL, Stanton BA", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "19398555", "url": "https://glygen.org/publication/PubMed/19398555" } ] }, { "title": "The deubiquitinases USP33 and USP20 coordinate beta2 adrenergic receptor recycling and resensitization.", "journal": "The EMBO journal", "date": "2009", "authors": "Berthouze M, Venkataramanan V, Li Y, Shenoy SK", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "19424180", "url": "https://glygen.org/publication/PubMed/19424180" } ] }, { "title": "Influx and efflux transport as determinants of melphalan cytotoxicity: Resistance to melphalan in MDR1 overexpressing tumor cell lines.", "journal": "Biochemical pharmacology", "date": "2009", "authors": "Kuhne A, Tzvetkov MV, Hagos Y, Lage H, Burckhardt G, Brockmoller J", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "19447222", "url": "https://glygen.org/publication/PubMed/19447222" } ] }, { "title": "What was the set of ubiquitin and ubiquitin-like conjugating enzymes in the eukaryote common ancestor?", "journal": "Journal of molecular evolution", "date": "2009", "authors": "Michelle C, Vourc'h P, Mignon L, Andres CR", "evidence": [ { "database": "Reactome", "id": "R-HSA-983168", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983168" } ], "reference": [ { "type": "PubMed", "id": "19452197", "url": "https://glygen.org/publication/PubMed/19452197" } ] }, { "title": "Docking of PRAK/MK5 to the atypical MAPKs ERK3 and ERK4 defines a novel MAPK interaction motif.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Aberg E, Torgersen KM, Johansen B, Keyse SM, Perander M, Seternes OM", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "19473979", "url": "https://glygen.org/publication/PubMed/19473979" } ] }, { "title": "X-linked inhibitor of apoptosis protein (XIAP) regulates PTEN ubiquitination, content, and compartmentalization.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Van Themsche C, Leblanc V, Parent S, Asselin E", "evidence": [ { "database": "Reactome", "id": "R-HSA-8948751", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8948751" } ], "reference": [ { "type": "PubMed", "id": "19473982", "url": "https://glygen.org/publication/PubMed/19473982" } ] }, { "title": "RING domain E3 ubiquitin ligases.", "journal": "Annual review of biochemistry", "date": "2009", "authors": "Deshaies RJ, Joazeiro CA", "evidence": [ { "database": "Reactome", "id": "R-HSA-983168", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983168" } ], "reference": [ { "type": "PubMed", "id": "19489725", "url": "https://glygen.org/publication/PubMed/19489725" } ] }, { "title": "Involvement of Rac/Cdc42/PAK pathway in cytoskeletal rearrangements.", "journal": "Acta biochimica Polonica", "date": "2009", "authors": "Szczepanowska J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "19513348", "url": "https://glygen.org/publication/PubMed/19513348" } ] }, { "title": "Identification of a SUFU germline mutation in a family with Gorlin syndrome.", "journal": "American journal of medical genetics. Part A", "date": "2009", "authors": "Pastorino L, Ghiorzo P, Nasti S, Battistuzzi L, Cusano R, Marzocchi C, Garre ML, Clementi M, Scarra GB", "evidence": [ { "database": "Reactome", "id": "R-HSA-5632684", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5632684" } ], "reference": [ { "type": "PubMed", "id": "19533801", "url": "https://glygen.org/publication/PubMed/19533801" } ] }, { "title": "The kinesin protein Kif7 is a critical regulator of Gli transcription factors in mammalian hedgehog signaling.", "journal": "Science signaling", "date": "2009", "authors": "Cheung HO, Zhang X, Ribeiro A, Mo R, Makino S, Puviindran V, Law KK, Briscoe J, Hui CC", "evidence": [ { "database": "Reactome", "id": "R-HSA-5632684", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5632684" } ], "reference": [ { "type": "PubMed", "id": "19549984", "url": "https://glygen.org/publication/PubMed/19549984" } ] }, { "title": "ABC50 promotes translation initiation in mammalian cells.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Paytubi S, Wang X, Lam YW, Izquierdo L, Hunter MJ, Jan E, Hundal HS, Proud CG", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "19570978", "url": "https://glygen.org/publication/PubMed/19570978" } ] }, { "title": "Proteasomal and genetic inactivation of the NF1 tumor suppressor in gliomagenesis.", "journal": "Cancer cell", "date": "2009", "authors": "McGillicuddy LT, Fromm JA, Hollstein PE, Kubek S, Beroukhim R, De Raedt T, Johnson BW, Williams SM, Nghiemphu P, Liau LM, Cloughesy TF, Mischel PS, Parret A, Seiler J, Moldenhauer G, Scheffzek K, Stemmer-Rachamimov AO, Sawyers CL, Brennan C, Messiaen L, Mellinghoff IK, Cichowski K", "evidence": [ { "database": "Reactome", "id": "R-HSA-5658442", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5658442" } ], "reference": [ { "type": "PubMed", "id": "19573811", "url": "https://glygen.org/publication/PubMed/19573811" } ] }, { "title": "The mammalian Cos2 homolog Kif7 plays an essential role in modulating Hh signal transduction during development.", "journal": "Current biology : CB", "date": "2009", "authors": "Endoh-Yamagami S, Evangelista M, Wilson D, Wen X, Theunissen JW, Phamluong K, Davis M, Scales SJ, Solloway MJ, de Sauvage FJ, Peterson AS", "evidence": [ { "database": "Reactome", "id": "R-HSA-5632684", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5632684" } ], "reference": [ { "type": "PubMed", "id": "19592253", "url": "https://glygen.org/publication/PubMed/19592253" } ] }, { "title": "Heat shock protein 27 phosphorylation: kinases, phosphatases, functions and pathology.", "journal": "Cellular and molecular life sciences : CMLS", "date": "2009", "authors": "Kostenko S, Moens U", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "19593530", "url": "https://glygen.org/publication/PubMed/19593530" } ] }, { "title": "The mutational spectrum of holoprosencephaly-associated changes within the SHH gene in humans predicts loss-of-function through either key structural alterations of the ligand or its altered synthesis.", "journal": "Human mutation", "date": "2009", "authors": "Roessler E, El-Jaick KB, Dubourg C, Velez JI, Solomon BD, Pineda-Alvarez DE, Lacbawan F, Zhou N, Ouspenskaia M, Paulussen A, Smeets HJ, Hehr U, Bendavid C, Bale S, Odent S, David V, Muenke M", "evidence": [ { "database": "Reactome", "id": "R-HSA-5358346", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5358346" } ], "reference": [ { "type": "PubMed", "id": "19603532", "url": "https://glygen.org/publication/PubMed/19603532" } ] }, { "title": "Two-hybrid analysis identifies PSMD11, a non-ATPase subunit of the proteasome, as a novel interaction partner of AMP-activated protein kinase.", "journal": "The international journal of biochemistry & cell biology", "date": "2009", "authors": "Moreno D, Viana R, Sanz P", "evidence": [ { "database": "UniProtKB", "id": "O00231", "url": "https://www.uniprot.org/uniprot/O00231" } ], "reference": [ { "type": "PubMed", "id": "19616115", "url": "https://glygen.org/publication/PubMed/19616115" } ] }, { "title": "The human Dcn1-like protein DCNL3 promotes Cul3 neddylation at membranes.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2009", "authors": "Meyer-Schaller N, Chou YC, Sumara I, Martin DD, Kurz T, Katheder N, Hofmann K, Berthiaume LG, Sicheri F, Peter M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "19617556", "url": "https://glygen.org/publication/PubMed/19617556" } ] }, { "title": "Sufu recruits GSK3beta for efficient processing of Gli3.", "journal": "Biochemical and biophysical research communications", "date": "2009", "authors": "Kise Y, Morinaka A, Teglund S, Miki H", "evidence": [ { "database": "Reactome", "id": "R-HSA-5632684", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5632684" } ], "reference": [ { "type": "PubMed", "id": "19622347", "url": "https://glygen.org/publication/PubMed/19622347" } ] }, { "title": "Mouse Kif7/Costal2 is a cilia-associated protein that regulates Sonic hedgehog signaling.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2009", "authors": "Liem KF Jr, He M, Ocbina PJ, Anderson KV", "evidence": [ { "database": "Reactome", "id": "R-HSA-5632684", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5632684" } ], "reference": [ { "type": "PubMed", "id": "19666503", "url": "https://glygen.org/publication/PubMed/19666503" } ] }, { "title": "Multidrug resistance phenotype of human BRO melanoma cells transfected with a wild-type human mdr1 complementary DNA.", "journal": "Cancer research", "date": "1990", "authors": "Lincke CR, van der Bliek AM, Schuurhuis GJ, van der Velde-Koerts T, Smit JJ, Borst P", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "1968359", "url": "https://glygen.org/publication/PubMed/1968359" } ] }, { "title": "Cilium-independent regulation of Gli protein function by Sufu in Hedgehog signaling is evolutionarily conserved.", "journal": "Genes & development", "date": "2009", "authors": "Chen MH, Wilson CW, Li YJ, Law KK, Lu CS, Gacayan R, Zhang X, Hui CC, Chuang PT", "evidence": [ { "database": "Reactome", "id": "R-HSA-5632684", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5632684" } ], "reference": [ { "type": "PubMed", "id": "19684112", "url": "https://glygen.org/publication/PubMed/19684112" } ] }, { "title": "Deubiquitinating enzyme USP33/VDU1 is required for Slit signaling in inhibiting breast cancer cell migration.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2009", "authors": "Yuasa-Kawada J, Kinoshita-Kawada M, Rao Y, Wu JY", "evidence": [ { "database": "Reactome", "id": "R-HSA-9010553", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9010553" } ], "reference": [ { "type": "PubMed", "id": "19706539", "url": "https://glygen.org/publication/PubMed/19706539" } ] }, { "title": "Activation of the PI3K pathway in cancer through inhibition of PTEN by exchange factor P-REX2a.", "journal": "Science (New York, N.Y.)", "date": "2009", "authors": "Fine B, Hodakoski C, Koujak S, Su T, Saal LH, Maurer M, Hopkins B, Keniry M, Sulis ML, Mense S, Hibshoosh H, Parsons R", "evidence": [ { "database": "Reactome", "id": "R-HSA-8948751", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8948751" } ], "reference": [ { "type": "PubMed", "id": "19729658", "url": "https://glygen.org/publication/PubMed/19729658" } ] }, { "title": "F-box-directed CRL complex assembly and regulation by the CSN and CAND1.", "journal": "Molecular cell", "date": "2009", "authors": "Schmidt MW, McQuary PR, Wee S, Hofmann K, Wolf DA", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "19748355", "url": "https://glygen.org/publication/PubMed/19748355" } ] }, { "title": "Tankyrase inhibition stabilizes axin and antagonizes Wnt signalling.", "journal": "Nature", "date": "2009", "authors": "Huang SM, Mishina YM, Liu S, Cheung A, Stegmeier F, Michaud GA, Charlat O, Wiellette E, Zhang Y, Wiessner S, Hild M, Shi X, Wilson CJ, Mickanin C, Myer V, Fazal A, Tomlinson R, Serluca F, Shao W, Cheng H, Shultz M, Rau C, Schirle M, Schlegl J, Ghidelli S, Fawell S, Lu C, Curtis D, Kirschner MW, Lengauer C, Finan PM, Tallarico JA, Bouwmeester T, Porter JA, Bauer A, Cong F", "evidence": [ { "database": "Reactome", "id": "R-HSA-4641257", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4641257" } ], "reference": [ { "type": "PubMed", "id": "19759537", "url": "https://glygen.org/publication/PubMed/19759537" } ] }, { "title": "Runt-related transcription factor RUNX3 is a target of MDM2-mediated ubiquitination.", "journal": "Cancer research", "date": "2009", "authors": "Chi XZ, Kim J, Lee YH, Lee JW, Lee KS, Wee H, Kim WJ, Park WY, Oh BC, Stein GS, Ito Y, van Wijnen AJ, Bae SC", "evidence": [ { "database": "Reactome", "id": "R-HSA-8941858", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8941858" } ], "reference": [ { "type": "PubMed", "id": "19808967", "url": "https://glygen.org/publication/PubMed/19808967" } ] }, { "title": "TRAF2 must bind to cellular inhibitors of apoptosis for tumor necrosis factor (tnf) to efficiently activate nf-{kappa}b and to prevent tnf-induced apoptosis.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Vince JE, Pantaki D, Feltham R, Mace PD, Cordier SM, Schmukle AC, Davidson AJ, Callus BA, Wong WW, Gentle IE, Carter H, Lee EF, Walczak H, Day CL, Vaux DL, Silke J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5668541", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5668541" } ], "reference": [ { "type": "PubMed", "id": "19815541", "url": "https://glygen.org/publication/PubMed/19815541" } ] }, { "title": "The deubiquitinating enzyme BAP1 regulates cell growth via interaction with HCF-1.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Machida YJ, Machida Y, Vashisht AA, Wohlschlegel JA, Dutta A", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689603", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689603" } ], "reference": [ { "type": "PubMed", "id": "19815555", "url": "https://glygen.org/publication/PubMed/19815555" } ] }, { "title": "Structures of SPOP-substrate complexes: insights into molecular architectures of BTB-Cul3 ubiquitin ligases.", "journal": "Molecular cell", "date": "2009", "authors": "Zhuang M, Calabrese MF, Liu J, Waddell MB, Nourse A, Hammel M, Miller DJ, Walden H, Duda DM, Seyedin SN, Hoggard T, Harper JW, White KP, Schulman BA", "evidence": [ { "database": "Reactome", "id": "R-HSA-5632684", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5632684" } ], "reference": [ { "type": "PubMed", "id": "19818708", "url": "https://glygen.org/publication/PubMed/19818708" } ] }, { "title": "MdmX is a substrate for the deubiquitinating enzyme USP2a.", "journal": "Oncogene", "date": "2010", "authors": "Allende-Vega N, Sparks A, Lane DP, Saville MK", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "19838211", "url": "https://glygen.org/publication/PubMed/19838211" } ] }, { "title": "Building ubiquitin chains: E2 enzymes at work.", "journal": "Nature reviews. Molecular cell biology", "date": "2009", "authors": "Ye Y, Rape M", "evidence": [ { "database": "Reactome", "id": "R-HSA-983168", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983168" } ], "reference": [ { "type": "PubMed", "id": "19851334", "url": "https://glygen.org/publication/PubMed/19851334" } ] }, { "title": "The Zn finger protein Iguana impacts Hedgehog signaling by promoting ciliogenesis.", "journal": "Developmental biology", "date": "2010", "authors": "Glazer AM, Wilkinson AW, Backer CB, Lapan SW, Gutzman JH, Cheeseman IM, Reddien PW", "evidence": [ { "database": "Reactome", "id": "R-HSA-5632684", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5632684" } ], "reference": [ { "type": "PubMed", "id": "19852954", "url": "https://glygen.org/publication/PubMed/19852954" } ] }, { "title": "MDR1 polymorphism role in patients treated with cetuximab and irinotecan in irinotecan refractory colorectal cancer.", "journal": "Medical oncology (Northwood, London, England)", "date": "2010", "authors": "Paule B, Castagne V, Picard V, Saffroy R, Adam R, Guettier C, Farinotti R, Bonhomme-Faivre L", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "19862647", "url": "https://glygen.org/publication/PubMed/19862647" } ] }, { "title": "Mechanisms of ubiquitin transfer by the anaphase-promoting complex.", "journal": "Journal of biology", "date": "2009", "authors": "Matyskiela ME, Rodrigo-Brenni MC, Morgan DO", "evidence": [ { "database": "Reactome", "id": "R-HSA-983168", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983168" } ], "reference": [ { "type": "PubMed", "id": "19874575", "url": "https://glygen.org/publication/PubMed/19874575" } ] }, { "title": "USP11 negatively regulates TNFalpha-induced NF-kappaB activation by targeting on IkappaBalpha.", "journal": "Cellular signalling", "date": "2010", "authors": "Sun W, Tan X, Shi Y, Xu G, Mao R, Gu X, Fan Y, Yu Y, Burlingame S, Zhang H, Rednam SP, Lu X, Zhang T, Fu S, Cao G, Qin J, Yang J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "19874889", "url": "https://glygen.org/publication/PubMed/19874889" } ] }, { "title": "Identification of a novel serine/threonine kinase ULK3 as a positive regulator of Hedgehog pathway.", "journal": "Experimental cell research", "date": "2010", "authors": "Maloverjan A, Piirsoo M, Michelson P, Kogerman P, Osterlund T", "evidence": [ { "database": "Reactome", "id": "R-HSA-5632684", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5632684" } ], "reference": [ { "type": "PubMed", "id": "19878745", "url": "https://glygen.org/publication/PubMed/19878745" } ] }, { "title": "Concerted loading of Mcm2-7 double hexamers around DNA during DNA replication origin licensing.", "journal": "Cell", "date": "2009", "authors": "Remus D, Beuron F, Tolun G, Griffith JD, Morris EP, Diffley JF", "evidence": [ { "database": "Reactome", "id": "R-HSA-68867", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-68867" } ], "reference": [ { "type": "PubMed", "id": "19896182", "url": "https://glygen.org/publication/PubMed/19896182" } ] }, { "title": "PB1 domain interaction of p62/sequestosome 1 and MEKK3 regulates NF-kappaB activation.", "journal": "The Journal of biological chemistry", "date": "2010", "authors": "Nakamura K, Kimple AJ, Siderovski DP, Johnson GL", "evidence": [ { "database": "Reactome", "id": "R-HSA-9020702", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9020702" } ], "reference": [ { "type": "PubMed", "id": "19903815", "url": "https://glygen.org/publication/PubMed/19903815" } ] }, { "title": "Comprehending the complex connection between PKCbeta, TAK1, and IKK in BCR signaling.", "journal": "Immunological reviews", "date": "2009", "authors": "Shinohara H, Kurosaki T", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169091", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169091" } ], "reference": [ { "type": "PubMed", "id": "19909372", "url": "https://glygen.org/publication/PubMed/19909372" } ] }, { "title": "Ubiquitin-specific peptidase 21 inhibits tumor necrosis factor alpha-induced nuclear factor kappaB activation via binding to and deubiquitinating receptor-interacting protein 1.", "journal": "The Journal of biological chemistry", "date": "2010", "authors": "Xu G, Tan X, Wang H, Sun W, Shi Y, Burlingame S, Gu X, Cao G, Zhang T, Qin J, Yang J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "19910467", "url": "https://glygen.org/publication/PubMed/19910467" } ] }, { "title": "Protein kinase C: poised to signal.", "journal": "American journal of physiology. Endocrinology and metabolism", "date": "2010", "authors": "Newton AC", "evidence": [ { "database": "Reactome", "id": "R-HSA-5607764", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5607764" } ], "reference": [ { "type": "PubMed", "id": "19934406", "url": "https://glygen.org/publication/PubMed/19934406" } ] }, { "title": "The family of ubiquitin-conjugating enzymes (E2s): deciding between life and death of proteins.", "journal": "FASEB journal : official publication of the Federation of American Societies for Experimental Biology", "date": "2010", "authors": "van Wijk SJ, Timmers HT", "evidence": [ { "database": "Reactome", "id": "R-HSA-983168", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983168" } ], "reference": [ { "type": "PubMed", "id": "19940261", "url": "https://glygen.org/publication/PubMed/19940261" } ] }, { "title": "Multiple Ser/Thr-rich degrons mediate the degradation of Ci/Gli by the Cul3-HIB/SPOP E3 ubiquitin ligase.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2009", "authors": "Zhang Q, Shi Q, Chen Y, Yue T, Li S, Wang B, Jiang J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5632684", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5632684" } ], "reference": [ { "type": "PubMed", "id": "19955409", "url": "https://glygen.org/publication/PubMed/19955409" } ] }, { "title": "A mutation in the second nucleotide binding fold of the cystic fibrosis gene.", "journal": "American journal of human genetics", "date": "1991", "authors": "Osborne L, Knight R, Santis G, Hodson M", "evidence": [ { "database": "Reactome", "id": "R-HSA-5678895", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5678895" } ], "reference": [ { "type": "PubMed", "id": "1998343", "url": "https://glygen.org/publication/PubMed/1998343" } ] }, { "title": "Gli2 trafficking links Hedgehog-dependent activation of Smoothened in the primary cilium to transcriptional activation in the nucleus.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2009", "authors": "Kim J, Kato M, Beachy PA", "evidence": [ { "database": "Reactome", "id": "R-HSA-5632684", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5632684" } ], "reference": [ { "type": "PubMed", "id": "19996169", "url": "https://glygen.org/publication/PubMed/19996169" } ] }, { "title": "The iguana/DZIP1 protein is a novel component of the ciliogenic pathway essential for axonemal biogenesis.", "journal": "Developmental dynamics : an official publication of the American Association of Anatomists", "date": "2010", "authors": "Tay SY, Yu X, Wong KN, Panse P, Ng CP, Roy S", "evidence": [ { "database": "Reactome", "id": "R-HSA-5632684", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5632684" } ], "reference": [ { "type": "PubMed", "id": "20014402", "url": "https://glygen.org/publication/PubMed/20014402" } ] }, { "title": "Sonic-hedgehog-mediated proliferation requires the localization of PKA to the cilium base.", "journal": "Journal of cell science", "date": "2010", "authors": "Barzi M, Berenguer J, Menendez A, Alvarez-Rodriguez R, Pons S", "evidence": [ { "database": "Reactome", "id": "R-HSA-5632684", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5632684" } ], "reference": [ { "type": "PubMed", "id": "20016067", "url": "https://glygen.org/publication/PubMed/20016067" } ] }, { "title": "Human GTSE-1 regulates p21(CIP1/WAF1) stability conferring resistance to paclitaxel treatment.", "journal": "The Journal of biological chemistry", "date": "2010", "authors": "Bublik DR, Scolz M, Triolo G, Monte M, Schneider C", "evidence": [ { "database": "Reactome", "id": "R-HSA-8852276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8852276" } ], "reference": [ { "type": "PubMed", "id": "20018861", "url": "https://glygen.org/publication/PubMed/20018861" } ] }, { "title": "Proteases in MHC class I presentation and cross-presentation.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2010", "authors": "Rock KL, Farfan-Arribas DJ, Shen L", "evidence": [ { "database": "Reactome", "id": "R-HSA-1236978", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1236978" } ], "reference": [ { "type": "PubMed", "id": "20028659", "url": "https://glygen.org/publication/PubMed/20028659" } ] }, { "title": "Lysine 63-linked polyubiquitination of TAK1 at lysine 158 is required for tumor necrosis factor alpha- and interleukin-1beta-induced IKK/NF-kappaB and JNK/AP-1 activation.", "journal": "The Journal of biological chemistry", "date": "2010", "authors": "Fan Y, Yu Y, Shi Y, Sun W, Xie M, Ge N, Mao R, Chang A, Xu G, Schneider MD, Zhang H, Fu S, Qin J, Yang J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5607764", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5607764" } ], "reference": [ { "type": "PubMed", "id": "20038579", "url": "https://glygen.org/publication/PubMed/20038579" } ] }, { "title": "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.", "journal": "Science signaling", "date": "2010", "authors": "Olsen JV, Vermeulen M, Santamaria A, Kumar C, Miller ML, Jensen LJ, Gnad F, Cox J, Jensen TS, Nigg EA, Brunak S, Mann M", "evidence": [ { "database": "iPTMnet", "id": "O00231-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O00231-1" } ], "reference": [ { "type": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ] }, { "title": "USP10 regulates p53 localization and stability by deubiquitinating p53.", "journal": "Cell", "date": "2010", "authors": "Yuan J, Luo K, Zhang L, Cheville JC, Lou Z", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "20096447", "url": "https://glygen.org/publication/PubMed/20096447" } ] }, { "title": "Src kinase phosphorylates RUNX3 at tyrosine residues and localizes the protein in the cytoplasm.", "journal": "The Journal of biological chemistry", "date": "2010", "authors": "Goh YM, Cinghu S, Hong ET, Lee YS, Kim JH, Jang JW, Li YH, Chi XZ, Lee KS, Wee H, Ito Y, Oh BC, Bae SC", "evidence": [ { "database": "Reactome", "id": "R-HSA-8941858", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8941858" } ], "reference": [ { "type": "PubMed", "id": "20100835", "url": "https://glygen.org/publication/PubMed/20100835" } ] }, { "title": "The molecular genetics of holoprosencephaly.", "journal": "American journal of medical genetics. Part C, Seminars in medical genetics", "date": "2010", "authors": "Roessler E, Muenke M", "evidence": [ { "database": "Reactome", "id": "R-HSA-5362768", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5362768" } ], "reference": [ { "type": "PubMed", "id": "20104595", "url": "https://glygen.org/publication/PubMed/20104595" } ] }, { "title": "Kinetics of hedgehog-dependent full-length Gli3 accumulation in primary cilia and subsequent degradation.", "journal": "Molecular and cellular biology", "date": "2010", "authors": "Wen X, Lai CK, Evangelista M, Hongo JA, de Sauvage FJ, Scales SJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5610785", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5610785" } ], "reference": [ { "type": "PubMed", "id": "20154143", "url": "https://glygen.org/publication/PubMed/20154143" } ] }, { "title": "Syk-coupled C-type lectin receptors that mediate cellular activation via single tyrosine based activation motifs.", "journal": "Immunological reviews", "date": "2010", "authors": "Kerrigan AM, Brown GD", "evidence": [ { "database": "Reactome", "id": "R-HSA-5607764", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5607764" } ], "reference": [ { "type": "PubMed", "id": "20193029", "url": "https://glygen.org/publication/PubMed/20193029" } ] }, { "title": "Loss of the tumor suppressor CYLD enhances Wnt/beta-catenin signaling through K63-linked ubiquitination of Dvl.", "journal": "Molecular cell", "date": "2010", "authors": "Tauriello DV, Haegebarth A, Kuper I, Edelmann MJ, Henraat M, Canninga-van Dijk MR, Kessler BM, Clevers H, Maurice MM", "evidence": [ { "database": "Reactome", "id": "R-HSA-195253", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-195253" } ], "reference": [ { "type": "PubMed", "id": "20227366", "url": "https://glygen.org/publication/PubMed/20227366" } ] }, { "title": "Ubiquitin hydrolase Dub3 promotes oncogenic transformation by stabilizing Cdc25A.", "journal": "Nature cell biology", "date": "2010", "authors": "Pereg Y, Liu BY, O'Rourke KM, Sagolla M, Dey A, Komuves L, French DM, Dixit VM", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "20228808", "url": "https://glygen.org/publication/PubMed/20228808" } ] }, { "title": "C-terminal domain phosphorylation of ERK3 controlled by Cdk1 and Cdc14 regulates its stability in mitosis.", "journal": "The Biochemical journal", "date": "2010", "authors": "Tanguay PL, Rodier G, Meloche S", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "20236090", "url": "https://glygen.org/publication/PubMed/20236090" } ] }, { "title": "The IKK complex, a central regulator of NF-kappaB activation.", "journal": "Cold Spring Harbor perspectives in biology", "date": "2010", "authors": "Israel A", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871837" } ], "reference": [ { "type": "PubMed", "id": "20300203", "url": "https://glygen.org/publication/PubMed/20300203" } ] }, { "title": "The output of Hedgehog signaling is controlled by the dynamic association between Suppressor of Fused and the Gli proteins.", "journal": "Genes & development", "date": "2010", "authors": "Humke EW, Dorn KV, Milenkovic L, Scott MP, Rohatgi R", "evidence": [ { "database": "Reactome", "id": "R-HSA-5632684", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5632684" } ], "reference": [ { "type": "PubMed", "id": "20360384", "url": "https://glygen.org/publication/PubMed/20360384" } ] }, { "title": "The ubiquitin-specific protease 17 is involved in virus-triggered type I IFN signaling.", "journal": "Cell research", "date": "2010", "authors": "Chen R, Zhang L, Zhong B, Tan B, Liu Y, Shu HB", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "20368735", "url": "https://glygen.org/publication/PubMed/20368735" } ] }, { "title": "Physical and functional interaction of sequestosome 1 with Keap1 regulates the Keap1-Nrf2 cell defense pathway.", "journal": "The Journal of biological chemistry", "date": "2010", "authors": "Copple IM, Lister A, Obeng AD, Kitteringham NR, Jenkins RE, Layfield R, Foster BJ, Goldring CE, Park BK", "evidence": [ { "database": "Reactome", "id": "R-HSA-9755511", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9755511" } ], "reference": [ { "type": "PubMed", "id": "20378532", "url": "https://glygen.org/publication/PubMed/20378532" } ] }, { "title": "Histone H2A deubiquitinase activity of the Polycomb repressive complex PR-DUB.", "journal": "Nature", "date": "2010", "authors": "Scheuermann JC, de Ayala Alonso AG, Oktaba K, Ly-Hartig N, McGinty RK, Fraterman S, Wilm M, Muir TW, Muller J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689603", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689603" } ], "reference": [ { "type": "PubMed", "id": "20436459", "url": "https://glygen.org/publication/PubMed/20436459" } ] }, { "title": "Competition between TRAF2 and TRAF6 regulates NF-kappaB activation in human B lymphocytes.", "journal": "Chinese medical sciences journal = Chung-kuo i hsueh k'o hsueh tsa chih", "date": "2010", "authors": "Zhang W, Zhang X, Wu XL, He LS, Zeng XF, Crammer AC, Lipsky PE", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169091", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169091" } ], "reference": [ { "type": "PubMed", "id": "20449947", "url": "https://glygen.org/publication/PubMed/20449947" } ] }, { "title": "p62/SQSTM1 is a target gene for transcription factor NRF2 and creates a positive feedback loop by inducing antioxidant response element-driven gene transcription.", "journal": "The Journal of biological chemistry", "date": "2010", "authors": "Jain A, Lamark T, Sjottem E, Larsen KB, Awuh JA, Overvatn A, McMahon M, Hayes JD, Johansen T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9755511", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9755511" } ], "reference": [ { "type": "PubMed", "id": "20452972", "url": "https://glygen.org/publication/PubMed/20452972" } ] }, { "title": "Hedgehog pathway-regulated gene networks in cerebellum development and tumorigenesis.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2010", "authors": "Lee EY, Ji H, Ouyang Z, Zhou B, Ma W, Vokes SA, McMahon AP, Wong WH, Scott MP", "evidence": [ { "database": "Reactome", "id": "R-HSA-5632684", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5632684" } ], "reference": [ { "type": "PubMed", "id": "20460306", "url": "https://glygen.org/publication/PubMed/20460306" } ] }, { "title": "Gli2a protein localization reveals a role for Iguana/DZIP1 in primary ciliogenesis and a dependence of Hedgehog signal transduction on primary cilia in the zebrafish.", "journal": "BMC biology", "date": "2010", "authors": "Kim HR, Richardson J, van Eeden F, Ingham PW", "evidence": [ { "database": "Reactome", "id": "R-HSA-5632684", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5632684" } ], "reference": [ { "type": "PubMed", "id": "20487519", "url": "https://glygen.org/publication/PubMed/20487519" } ] }, { "title": "Keap1 facilitates p62-mediated ubiquitin aggregate clearance via autophagy.", "journal": "Autophagy", "date": "2010", "authors": "Fan W, Tang Z, Chen D, Moughon D, Ding X, Chen S, Zhu M, Zhong Q", "evidence": [ { "database": "Reactome", "id": "R-HSA-9755511", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9755511" } ], "reference": [ { "type": "PubMed", "id": "20495340", "url": "https://glygen.org/publication/PubMed/20495340" } ] }, { "title": "The deubiquitinating enzyme USP26 is a regulator of androgen receptor signaling.", "journal": "Molecular cancer research : MCR", "date": "2010", "authors": "Dirac AM, Bernards R", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "20501646", "url": "https://glygen.org/publication/PubMed/20501646" } ] }, { "title": "Controlling the fate of NIK: a central stage in noncanonical NF-kappaB signaling.", "journal": "Science signaling", "date": "2010", "authors": "Sun SC", "evidence": [ { "database": "Reactome", "id": "R-HSA-5607761", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5607761" } ], "reference": [ { "type": "PubMed", "id": "20501935", "url": "https://glygen.org/publication/PubMed/20501935" } ] }, { "title": "DYRK1B-dependent autocrine-to-paracrine shift of Hedgehog signaling by mutant RAS.", "journal": "Nature structural & molecular biology", "date": "2010", "authors": "Lauth M, Bergstrom A, Shimokawa T, Tostar U, Jin Q, Fendrich V, Guerra C, Barbacid M, Toftgard R", "evidence": [ { "database": "Reactome", "id": "R-HSA-5632684", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5632684" } ], "reference": [ { "type": "PubMed", "id": "20512148", "url": "https://glygen.org/publication/PubMed/20512148" } ] }, { "title": "HSPB1, actin filament dynamics, and aging cells.", "journal": "Annals of the New York Academy of Sciences", "date": "2010", "authors": "Doshi BM, Hightower LE, Lee J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "20536836", "url": "https://glygen.org/publication/PubMed/20536836" } ] }, { "title": "Autoactivation of transforming growth factor beta-activated kinase 1 is a sequential bimolecular process.", "journal": "The Journal of biological chemistry", "date": "2010", "authors": "Scholz R, Sidler CL, Thali RF, Winssinger N, Cheung PC, Neumann D", "evidence": [ { "database": "Reactome", "id": "R-HSA-5607764", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5607764" } ], "reference": [ { "type": "PubMed", "id": "20538596", "url": "https://glygen.org/publication/PubMed/20538596" } ] }, { "title": "A global network of transcription factors, involving E2A, EBF1 and Foxo1, that orchestrates B cell fate.", "journal": "Nature immunology", "date": "2010", "authors": "Lin YC, Jhunjhunwala S, Benner C, Heinz S, Welinder E, Mansson R, Sigvardsson M, Hagman J, Espinoza CA, Dutkowski J, Ideker T, Glass CK, Murre C", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "20543837", "url": "https://glygen.org/publication/PubMed/20543837" } ] }, { "title": "Polo-like kinase 1 phosphorylation of G2 and S-phase-expressed 1 protein is essential for p53 inactivation during G2 checkpoint recovery.", "journal": "EMBO reports", "date": "2010", "authors": "Liu XS, Li H, Song B, Liu X", "evidence": [ { "database": "Reactome", "id": "R-HSA-8852276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8852276" } ], "reference": [ { "type": "PubMed", "id": "20577264", "url": "https://glygen.org/publication/PubMed/20577264" } ] }, { "title": "P-glycoprotein, but not multidrug resistance protein 4, plays a role in the systemic clearance of irinotecan and SN-38 in mice.", "journal": "Drug metabolism letters", "date": "2010", "authors": "Tagen M, Zhuang Y, Zhang F, Harstead KE, Shen J, Schaiquevich P, Fraga CH, Panetta JC, Waters CM, Stewart CF", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "20583968", "url": "https://glygen.org/publication/PubMed/20583968" } ] }, { "title": "Identification of conserved regions and residues within Hedgehog acyltransferase critical for palmitoylation of Sonic Hedgehog.", "journal": "PloS one", "date": "2010", "authors": "Buglino JA, Resh MD", "evidence": [ { "database": "Reactome", "id": "R-HSA-5358346", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5358346" } ], "reference": [ { "type": "PubMed", "id": "20585641", "url": "https://glygen.org/publication/PubMed/20585641" } ] }, { "title": "Differences in assessment of macrolide interaction with human MDR1 (ABCB1, P-gp) using rhodamine-123 efflux, ATPase activity and cellular accumulation assays.", "journal": "European journal of pharmaceutical sciences : official journal of the European Federation for Pharmaceutical Sciences", "date": "2010", "authors": "Munic V, Kelneric Z, Mikac L, Erakovic Haber V", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "20621639", "url": "https://glygen.org/publication/PubMed/20621639" } ] }, { "title": "Dual function of UNC-51-like kinase 3 (Ulk3) in the Sonic hedgehog signaling pathway.", "journal": "The Journal of biological chemistry", "date": "2010", "authors": "Maloverjan A, Piirsoo M, Kasak L, Peil L, Osterlund T, Kogerman P", "evidence": [ { "database": "Reactome", "id": "R-HSA-5632684", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5632684" } ], "reference": [ { "type": "PubMed", "id": "20643644", "url": "https://glygen.org/publication/PubMed/20643644" } ] }, { "title": "Antigen receptor signaling to NF-kappaB via CARMA1, BCL10, and MALT1.", "journal": "Cold Spring Harbor perspectives in biology", "date": "2010", "authors": "Thome M, Charton JE, Pelzer C, Hailfinger S", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871837" } ], "reference": [ { "type": "PubMed", "id": "20685844", "url": "https://glygen.org/publication/PubMed/20685844" } ] }, { "title": "Serine residue 115 of MAPK-activated protein kinase MK5 is crucial for its PKA-regulated nuclear export and biological function.", "journal": "Cellular and molecular life sciences : CMLS", "date": "2011", "authors": "Kostenko S, Shiryaev A, Gerits N, Dumitriu G, Klenow H, Johannessen M, Moens U", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "20734105", "url": "https://glygen.org/publication/PubMed/20734105" } ] }, { "title": "The ubiquitin carboxyl hydrolase BAP1 forms a ternary complex with YY1 and HCF-1 and is a critical regulator of gene expression.", "journal": "Molecular and cellular biology", "date": "2010", "authors": "Yu H, Mashtalir N, Daou S, Hammond-Martel I, Ross J, Sui G, Hart GW, Rauscher FJ 3rd, Drobetsky E, Milot E, Shi Y, Affar el B", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689603", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689603" } ], "reference": [ { "type": "PubMed", "id": "20805357", "url": "https://glygen.org/publication/PubMed/20805357" } ] }, { "title": "Numb activates the E3 ligase Itch to control Gli1 function through a novel degradation signal.", "journal": "Oncogene", "date": "2011", "authors": "Di Marcotullio L, Greco A, Mazza D, Canettieri G, Pietrosanti L, Infante P, Coni S, Moretti M, De Smaele E, Ferretti E, Screpanti I, Gulino A", "evidence": [ { "database": "Reactome", "id": "R-HSA-5610780", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5610780" } ], "reference": [ { "type": "PubMed", "id": "20818436", "url": "https://glygen.org/publication/PubMed/20818436" } ] }, { "title": "G protein-coupled receptor kinase 2 promotes high-level Hedgehog signaling by regulating the active state of Smo through kinase-dependent and kinase-independent mechanisms in Drosophila.", "journal": "Genes & development", "date": "2010", "authors": "Chen Y, Li S, Tong C, Zhao Y, Wang B, Liu Y, Jia J, Jiang J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5632684", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5632684" } ], "reference": [ { "type": "PubMed", "id": "20844016", "url": "https://glygen.org/publication/PubMed/20844016" } ] }, { "title": "Cross-talk between protein kinase A and the MAPK-activated protein kinases RSK1 and MK5.", "journal": "Journal of receptor and signal transduction research", "date": "2011", "authors": "Kostenko S, Shiryaev A, Dumitriu G, Gerits N, Moens U", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "20849292", "url": "https://glygen.org/publication/PubMed/20849292" } ] }, { "title": "The protein stability of Axin, a negative regulator of Wnt signaling, is regulated by Smad ubiquitination regulatory factor 2 (Smurf2).", "journal": "The Journal of biological chemistry", "date": "2010", "authors": "Kim S, Jho EH", "evidence": [ { "database": "Reactome", "id": "R-HSA-4641257", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4641257" } ], "reference": [ { "type": "PubMed", "id": "20858899", "url": "https://glygen.org/publication/PubMed/20858899" } ] }, { "title": "Combinatorial transcriptional control in blood stem/progenitor cells: genome-wide analysis of ten major transcriptional regulators.", "journal": "Cell stem cell", "date": "2010", "authors": "Wilson NK, Foster SD, Wang X, Knezevic K, Schutte J, Kaimakis P, Chilarska PM, Kinston S, Ouwehand WH, Dzierzak E, Pimanda JE, de Bruijn MF, Gottgens B", "evidence": [ { "database": "Reactome", "id": "R-HSA-8939236", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8939236" } ], "reference": [ { "type": "PubMed", "id": "20887958", "url": "https://glygen.org/publication/PubMed/20887958" } ] }, { "title": "TULP3 bridges the IFT-A complex and membrane phosphoinositides to promote trafficking of G protein-coupled receptors into primary cilia.", "journal": "Genes & development", "date": "2010", "authors": "Mukhopadhyay S, Wen X, Chih B, Nelson CD, Lane WS, Scales SJ, Jackson PK", "evidence": [ { "database": "Reactome", "id": "R-HSA-5632684", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5632684" } ], "reference": [ { "type": "PubMed", "id": "20889716", "url": "https://glygen.org/publication/PubMed/20889716" } ] }, { "title": "A mechanism for vertebrate Hedgehog signaling: recruitment to cilia and dissociation of SuFu-Gli protein complexes.", "journal": "The Journal of cell biology", "date": "2010", "authors": "Tukachinsky H, Lopez LV, Salic A", "evidence": [ { "database": "Reactome", "id": "R-HSA-5632684", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5632684" } ], "reference": [ { "type": "PubMed", "id": "20956384", "url": "https://glygen.org/publication/PubMed/20956384" } ] }, { "title": "Solution of the structure of the TNF-TNFR2 complex.", "journal": "Science signaling", "date": "2010", "authors": "Mukai Y, Nakamura T, Yoshikawa M, Yoshioka Y, Tsunoda S, Nakagawa S, Yamagata Y, Tsutsumi Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-5668541", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5668541" } ], "reference": [ { "type": "PubMed", "id": "21081755", "url": "https://glygen.org/publication/PubMed/21081755" } ] }, { "title": "Effect of VX-770 in persons with cystic fibrosis and the G551D-CFTR mutation.", "journal": "The New England journal of medicine", "date": "2010", "authors": "Accurso FJ, Rowe SM, Clancy JP, Boyle MP, Dunitz JM, Durie PR, Sagel SD, Hornick DB, Konstan MW, Donaldson SH, Moss RB, Pilewski JM, Rubenstein RC, Uluer AZ, Aitken ML, Freedman SD, Rose LM, Mayer-Hamblett N, Dong Q, Zha J, Stone AJ, Olson ER, Ordonez CL, Campbell PW, Ashlock MA, Ramsey BW", "evidence": [ { "database": "Reactome", "id": "R-HSA-5678895", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5678895" } ], "reference": [ { "type": "PubMed", "id": "21083385", "url": "https://glygen.org/publication/PubMed/21083385" } ] }, { "title": "Anti-TNF-alpha agents in the treatment of immune-mediated inflammatory diseases: mechanisms of action and pitfalls.", "journal": "Immunotherapy", "date": "2010", "authors": "Silva LC, Ortigosa LC, Benard G", "evidence": [ { "database": "Reactome", "id": "R-HSA-5668541", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5668541" } ], "reference": [ { "type": "PubMed", "id": "21091114", "url": "https://glygen.org/publication/PubMed/21091114" } ] }, { "title": "Activation loop phosphorylation of ERK3/ERK4 by group I p21-activated kinases (PAKs) defines a novel PAK-ERK3/4-MAPK-activated protein kinase 5 signaling pathway.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Deleris P, Trost M, Topisirovic I, Tanguay PL, Borden KL, Thibault P, Meloche S", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "21177870", "url": "https://glygen.org/publication/PubMed/21177870" } ] }, { "title": "The GAP-related domain of the neurofibromatosis type 1 gene product interacts with ras p21.", "journal": "Cell", "date": "1990", "authors": "Martin GA, Viskochil D, Bollag G, McCabe PC, Crosier WJ, Haubruck H, Conroy L, Clark R, O'Connell P, Cawthon RM, et al.", "evidence": [ { "database": "Reactome", "id": "R-HSA-5658442", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5658442" } ], "reference": [ { "type": "PubMed", "id": "2121370", "url": "https://glygen.org/publication/PubMed/2121370" } ] }, { "title": "p62 Targeting to the autophagosome formation site requires self-oligomerization but not LC3 binding.", "journal": "The Journal of cell biology", "date": "2011", "authors": "Itakura E, Mizushima N", "evidence": [ { "database": "Reactome", "id": "R-HSA-9755511", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9755511" } ], "reference": [ { "type": "PubMed", "id": "21220506", "url": "https://glygen.org/publication/PubMed/21220506" } ] }, { "title": "Lys-63-specific deubiquitination of SDS3 by USP17 regulates HDAC activity.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Ramakrishna S, Suresh B, Lee EJ, Lee HJ, Ahn WS, Baek KH", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "21239494", "url": "https://glygen.org/publication/PubMed/21239494" } ] }, { "title": "SCF/{beta}-TrCP promotes glycogen synthase kinase 3-dependent degradation of the Nrf2 transcription factor in a Keap1-independent manner.", "journal": "Molecular and cellular biology", "date": "2011", "authors": "Rada P, Rojo AI, Chowdhry S, McMahon M, Hayes JD, Cuadrado A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9762114", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9762114" } ], "reference": [ { "type": "PubMed", "id": "21245377", "url": "https://glygen.org/publication/PubMed/21245377" } ] }, { "title": "Hedgehog morphogen: from secretion to reception.", "journal": "Trends in cell biology", "date": "2011", "authors": "Gallet A", "evidence": [ { "database": "Reactome", "id": "R-HSA-5358346", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5358346" } ], "reference": [ { "type": "PubMed", "id": "21257310", "url": "https://glygen.org/publication/PubMed/21257310" } ] }, { "title": "Identification of the atypical MAPK Erk3 as a novel substrate for p21-activated kinase (Pak) activity.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "De la Mota-Peynado A, Chernoff J, Beeser A", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "21317288", "url": "https://glygen.org/publication/PubMed/21317288" } ] }, { "title": "More, more, more: downregulation of a MK5-FoxO3a-mir34b/c pathway further increases c-Myc levels in colorectal cancer.", "journal": "Molecular cell", "date": "2011", "authors": "Myant K, Sansom OJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "21329875", "url": "https://glygen.org/publication/PubMed/21329875" } ] }, { "title": "The MK5/PRAK kinase and Myc form a negative feedback loop that is disrupted during colorectal tumorigenesis.", "journal": "Molecular cell", "date": "2011", "authors": "Kress TR, Cannell IG, Brenkman AB, Samans B, Gaestel M, Roepman P, Burgering BM, Bushell M, Rosenwald A, Eilers M", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "21329882", "url": "https://glygen.org/publication/PubMed/21329882" } ] }, { "title": "Differential sensitivity of hypoxia inducible factor hydroxylation sites to hypoxia and hydroxylase inhibitors.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Tian YM, Yeoh KK, Lee MK, Eriksson T, Kessler BM, Kramer HB, Edelmann MJ, Willam C, Pugh CW, Schofield CJ, Ratcliffe PJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-1234176", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1234176" } ], "reference": [ { "type": "PubMed", "id": "21335549", "url": "https://glygen.org/publication/PubMed/21335549" } ] }, { "title": "A child, homozygous for a stop codon in exon 11, shows milder cystic fibrosis symptoms than her heterozygous nephew.", "journal": "Journal of medical genetics", "date": "1990", "authors": "Cuppens H, Marynen P, De Boeck C, De Baets F, Eggermont E, Van den Berghe H, Cassiman JJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5678895", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5678895" } ], "reference": [ { "type": "PubMed", "id": "2135388", "url": "https://glygen.org/publication/PubMed/2135388" } ] }, { "title": "Processing and turnover of the Hedgehog protein in the endoplasmic reticulum.", "journal": "The Journal of cell biology", "date": "2011", "authors": "Chen X, Tukachinsky H, Huang CH, Jao C, Chu YR, Tang HY, Mueller B, Schulman S, Rapoport TA, Salic A", "evidence": [ { "database": "Reactome", "id": "R-HSA-5358346", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5358346" } ], "reference": [ { "type": "PubMed", "id": "21357747", "url": "https://glygen.org/publication/PubMed/21357747" } ] }, { "title": "USP47 is a deubiquitylating enzyme that regulates base excision repair by controlling steady-state levels of DNA polymerase beta.", "journal": "Molecular cell", "date": "2011", "authors": "Parsons JL, Dianova II, Khoronenkova SV, Edelmann MJ, Kessler BM, Dianov GL", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "21362556", "url": "https://glygen.org/publication/PubMed/21362556" } ] }, { "title": "Activation and function of the MAPKs and their substrates, the MAPK-activated protein kinases.", "journal": "Microbiology and molecular biology reviews : MMBR", "date": "2011", "authors": "Cargnello M, Roux PP", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "21372320", "url": "https://glygen.org/publication/PubMed/21372320" } ] }, { "title": "Modification of keap1 cysteine residues by sulforaphane.", "journal": "Chemical research in toxicology", "date": "2011", "authors": "Hu C, Eggler AL, Mesecar AD, van Breemen RB", "evidence": [ { "database": "Reactome", "id": "R-HSA-9755511", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9755511" } ], "reference": [ { "type": "PubMed", "id": "21391649", "url": "https://glygen.org/publication/PubMed/21391649" } ] }, { "title": "Purification, cloning, expression and biological characterization of an interleukin-1 receptor antagonist protein.", "journal": "Nature", "date": "1990", "authors": "Carter DB, Deibel MR Jr, Dunn CJ, Tomich CS, Laborde AL, Slightom JL, Berger AE, Bienkowski MJ, Sun FF, McEwan RN, et al.", "evidence": [ { "database": "Reactome", "id": "R-HSA-9020702", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9020702" } ], "reference": [ { "type": "PubMed", "id": "2139180", "url": "https://glygen.org/publication/PubMed/2139180" } ] }, { "title": "Temporal and spatial regulation of targeting aurora B to the inner centromere.", "journal": "Cold Spring Harbor symposia on quantitative biology", "date": "2010", "authors": "Watanabe Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "21447816", "url": "https://glygen.org/publication/PubMed/21447816" } ] }, { "title": "Neddylation-induced conformational control regulates cullin RING ligase activity in vivo.", "journal": "Journal of molecular biology", "date": "2011", "authors": "Boh BK, Smith PG, Hagen T", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "21463634", "url": "https://glygen.org/publication/PubMed/21463634" } ] }, { "title": "RNF146 is a poly(ADP-ribose)-directed E3 ligase that regulates axin degradation and Wnt signalling.", "journal": "Nature cell biology", "date": "2011", "authors": "Zhang Y, Liu S, Mickanin C, Feng Y, Charlat O, Michaud GA, Schirle M, Shi X, Hild M, Bauer A, Myer VE, Finan PM, Porter JA, Huang SM, Cong F", "evidence": [ { "database": "Reactome", "id": "R-HSA-4641257", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4641257" } ], "reference": [ { "type": "PubMed", "id": "21478859", "url": "https://glygen.org/publication/PubMed/21478859" } ] }, { "title": "Natural and recombinant human IL-1 receptor antagonists block the effects of IL-1 on bone resorption and prostaglandin production.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1990", "authors": "Seckinger P, Klein-Nulend J, Alander C, Thompson RC, Dayer JM, Raisz LG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9020702", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9020702" } ], "reference": [ { "type": "PubMed", "id": "2147937", "url": "https://glygen.org/publication/PubMed/2147937" } ] }, { "title": "Activation of the innate immune receptor Dectin-1 upon formation of a 'phagocytic synapse'.", "journal": "Nature", "date": "2011", "authors": "Goodridge HS, Reyes CN, Becker CA, Katsumoto TR, Ma J, Wolf AJ, Bose N, Chan AS, Magee AS, Danielson ME, Weiss A, Vasilakos JP, Underhill DM", "evidence": [ { "database": "Reactome", "id": "R-HSA-5607764", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5607764" } ], "reference": [ { "type": "PubMed", "id": "21525931", "url": "https://glygen.org/publication/PubMed/21525931" } ] }, { "title": "WWP2 is an E3 ubiquitin ligase for PTEN.", "journal": "Nature cell biology", "date": "2011", "authors": "Maddika S, Kavela S, Rani N, Palicharla VR, Pokorny JL, Sarkaria JN, Chen J", "evidence": [ { "database": "Reactome", "id": "R-HSA-8948751", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8948751" } ], "reference": [ { "type": "PubMed", "id": "21532586", "url": "https://glygen.org/publication/PubMed/21532586" } ] }, { "title": "Genome-wide analysis of simultaneous GATA1/2, RUNX1, FLI1, and SCL binding in megakaryocytes identifies hematopoietic regulators.", "journal": "Developmental cell", "date": "2011", "authors": "Tijssen MR, Cvejic A, Joshi A, Hannah RL, Ferreira R, Forrai A, Bellissimo DC, Oram SH, Smethurst PA, Wilson NK, Wang X, Ottersbach K, Stemple DL, Green AR, Ouwehand WH, Gottgens B", "evidence": [ { "database": "Reactome", "id": "R-HSA-8939236", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8939236" } ], "reference": [ { "type": "PubMed", "id": "21571218", "url": "https://glygen.org/publication/PubMed/21571218" } ] }, { "title": "Ubiquitin-recognition protein Ufd1 couples the endoplasmic reticulum (ER) stress response to cell cycle control.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2011", "authors": "Chen M, Gutierrez GJ, Ronai ZA", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "21571647", "url": "https://glygen.org/publication/PubMed/21571647" } ] }, { "title": "Deubiquitinase USP37 is activated by CDK2 to antagonize APC(CDH1) and promote S phase entry.", "journal": "Molecular cell", "date": "2011", "authors": "Huang X, Summers MK, Pham V, Lill JR, Liu J, Lee G, Kirkpatrick DS, Jackson PK, Fang G, Dixit VM", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "21596315", "url": "https://glygen.org/publication/PubMed/21596315" } ] }, { "title": "Cystic fibrosis transmembrane conductance regulator intracellular processing, trafficking, and opportunities for mutation-specific treatment.", "journal": "Chest", "date": "2011", "authors": "Rogan MP, Stoltz DA, Hornick DB", "evidence": [ { "database": "Reactome", "id": "R-HSA-5678895", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5678895" } ], "reference": [ { "type": "PubMed", "id": "21652558", "url": "https://glygen.org/publication/PubMed/21652558" } ] }, { "title": "USP13 enzyme regulates Siah2 ligase stability and activity via noncatalytic ubiquitin-binding domains.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Scortegagna M, Subtil T, Qi J, Kim H, Zhao W, Gu W, Kluger H, Ronai ZA", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "21659512", "url": "https://glygen.org/publication/PubMed/21659512" } ] }, { "title": "Sonic Hedgehog dependent phosphorylation by CK1alpha and GRK2 is required for ciliary accumulation and activation of smoothened.", "journal": "PLoS biology", "date": "2011", "authors": "Chen Y, Sasai N, Ma G, Yue T, Jia J, Briscoe J, Jiang J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5632684", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5632684" } ], "reference": [ { "type": "PubMed", "id": "21695114", "url": "https://glygen.org/publication/PubMed/21695114" } ] }, { "title": "Oncogene-induced Nrf2 transcription promotes ROS detoxification and tumorigenesis.", "journal": "Nature", "date": "2011", "authors": "DeNicola GM, Karreth FA, Humpton TJ, Gopinathan A, Wei C, Frese K, Mangal D, Yu KH, Yeo CJ, Calhoun ES, Scrimieri F, Winter JM, Hruban RH, Iacobuzio-Donahue C, Kern SE, Blair IA, Tuveson DA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9755511", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9755511" } ], "reference": [ { "type": "PubMed", "id": "21734707", "url": "https://glygen.org/publication/PubMed/21734707" } ] }, { "title": "COMMD1 (copper metabolism MURR1 domain-containing protein 1) regulates Cullin RING ligases by preventing CAND1 (Cullin-associated Nedd8-dissociated protein 1) binding.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Mao X, Gluck N, Chen B, Starokadomskyy P, Li H, Maine GN, Burstein E", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "21778237", "url": "https://glygen.org/publication/PubMed/21778237" } ] }, { "title": "Ubiquitin ligase RNF146 regulates tankyrase and Axin to promote Wnt signaling.", "journal": "PloS one", "date": "2011", "authors": "Callow MG, Tran H, Phu L, Lau T, Lee J, Sandoval WN, Liu PS, Bheddah S, Tao J, Lill JR, Hongo JA, Davis D, Kirkpatrick DS, Polakis P, Costa M", "evidence": [ { "database": "Reactome", "id": "R-HSA-4641257", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4641257" } ], "reference": [ { "type": "PubMed", "id": "21799911", "url": "https://glygen.org/publication/PubMed/21799911" } ] }, { "title": "Gli proteins in development and disease.", "journal": "Annual review of cell and developmental biology", "date": "2011", "authors": "Hui CC, Angers S", "evidence": [ { "database": "Reactome", "id": "R-HSA-5632684", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5632684" } ], "reference": [ { "type": "PubMed", "id": "21801010", "url": "https://glygen.org/publication/PubMed/21801010" } ] }, { "title": "The USP19 deubiquitinase regulates the stability of c-IAP1 and c-IAP2.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Mei Y, Hahn AA, Hu S, Yang X", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "21849505", "url": "https://glygen.org/publication/PubMed/21849505" } ] }, { "title": "RINGs of good and evil: RING finger ubiquitin ligases at the crossroads of tumour suppression and oncogenesis.", "journal": "Nature reviews. Cancer", "date": "2011", "authors": "Lipkowitz S, Weissman AM", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "21863050", "url": "https://glygen.org/publication/PubMed/21863050" } ] }, { "title": "The antagonistic action of B56-containing protein phosphatase 2As and casein kinase 2 controls the phosphorylation and Gli turnover function of Daz interacting protein 1.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Jin Z, Mei W, Strack S, Jia J, Yang J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5632684", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5632684" } ], "reference": [ { "type": "PubMed", "id": "21878643", "url": "https://glygen.org/publication/PubMed/21878643" } ] }, { "title": "A three-part signal governs differential processing of Gli1 and Gli3 proteins by the proteasome.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Schrader EK, Harstad KG, Holmgren RA, Matouschek A", "evidence": [ { "database": "Reactome", "id": "R-HSA-5610785", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5610785" } ], "reference": [ { "type": "PubMed", "id": "21921029", "url": "https://glygen.org/publication/PubMed/21921029" } ] }, { "title": "Hypoxia inhibits osteogenesis in human mesenchymal stem cells through direct regulation of RUNX2 by TWIST.", "journal": "PloS one", "date": "2011", "authors": "Yang DC, Yang MH, Tsai CC, Huang TF, Chen YH, Hung SC", "evidence": [ { "database": "Reactome", "id": "R-HSA-8939902", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8939902" } ], "reference": [ { "type": "PubMed", "id": "21931630", "url": "https://glygen.org/publication/PubMed/21931630" } ] }, { "title": "N-terminal acetylation acts as an avidity enhancer within an interconnected multiprotein complex.", "journal": "Science (New York, N.Y.)", "date": "2011", "authors": "Scott DC, Monda JK, Bennett EJ, Harper JW, Schulman BA", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "21940857", "url": "https://glygen.org/publication/PubMed/21940857" } ] }, { "title": "Beclin1 controls the levels of p53 by regulating the deubiquitination activity of USP10 and USP13.", "journal": "Cell", "date": "2011", "authors": "Liu J, Xia H, Kim M, Xu L, Li Y, Zhang L, Cai Y, Norberg HV, Zhang T, Furuya T, Jin M, Zhu Z, Wang H, Yu J, Li Y, Hao Y, Choi A, Ke H, Ma D, Yuan J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "21962518", "url": "https://glygen.org/publication/PubMed/21962518" } ] }, { "title": "Oligomeric structure of the MALT1 tandem Ig-like domains.", "journal": "PloS one", "date": "2011", "authors": "Qiu L, Dhe-Paganon S", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871837" } ], "reference": [ { "type": "PubMed", "id": "21966355", "url": "https://glygen.org/publication/PubMed/21966355" } ] }, { "title": "Planar cell polarity in Drosophila.", "journal": "Organogenesis", "date": "2011", "authors": "Maung SM, Jenny A", "evidence": [ { "database": "Reactome", "id": "R-HSA-4608870", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4608870" } ], "reference": [ { "type": "PubMed", "id": "21983142", "url": "https://glygen.org/publication/PubMed/21983142" } ] }, { "title": "Protein kinase A acts at the basal body of the primary cilium to prevent Gli2 activation and ventralization of the mouse neural tube.", "journal": "Development (Cambridge, England)", "date": "2011", "authors": "Tuson M, He M, Anderson KV", "evidence": [ { "database": "Reactome", "id": "R-HSA-5632684", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5632684" } ], "reference": [ { "type": "PubMed", "id": "22007132", "url": "https://glygen.org/publication/PubMed/22007132" } ] }, { "title": "The ability of MLL to bind RUNX1 and methylate H3K4 at PU.1 regulatory regions is impaired by MDS/AML-associated RUNX1/AML1 mutations.", "journal": "Blood", "date": "2011", "authors": "Huang G, Zhao X, Wang L, Elf S, Xu H, Zhao X, Sashida G, Zhang Y, Liu Y, Lee J, Menendez S, Yang Y, Yan X, Zhang P, Tenen DG, Osato M, Hsieh JJ, Nimer SD", "evidence": [ { "database": "Reactome", "id": "R-HSA-8939236", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8939236" } ], "reference": [ { "type": "PubMed", "id": "22012064", "url": "https://glygen.org/publication/PubMed/22012064" } ] }, { "title": "Ubiquitin-specific protease 4 (USP4) targets TRAF2 and TRAF6 for deubiquitination and inhibits TNFalpha-induced cancer cell migration.", "journal": "The Biochemical journal", "date": "2012", "authors": "Xiao N, Li H, Luo J, Wang R, Chen H, Chen J, Wang P", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "22029577", "url": "https://glygen.org/publication/PubMed/22029577" } ] }, { "title": "A CFTR potentiator in patients with cystic fibrosis and the G551D mutation.", "journal": "The New England journal of medicine", "date": "2011", "authors": "Ramsey BW, Davies J, McElvaney NG, Tullis E, Bell SC, Drevinek P, Griese M, McKone EF, Wainwright CE, Konstan MW, Moss R, Ratjen F, Sermet-Gaudelus I, Rowe SM, Dong Q, Rodriguez S, Yen K, Ordonez C, Elborn JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-5678895", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5678895" } ], "reference": [ { "type": "PubMed", "id": "22047557", "url": "https://glygen.org/publication/PubMed/22047557" } ] }, { "title": "Polyubiquitination of transforming growth factor beta (TGFbeta)-associated kinase 1 mediates nuclear factor-kappaB activation in response to different inflammatory stimuli.", "journal": "The Journal of biological chemistry", "date": "2012", "authors": "Hamidi A, von Bulow V, Hamidi R, Winssinger N, Barluenga S, Heldin CH, Landstrom M", "evidence": [ { "database": "Reactome", "id": "R-HSA-5607764", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5607764" } ], "reference": [ { "type": "PubMed", "id": "22069318", "url": "https://glygen.org/publication/PubMed/22069318" } ] }, { "title": "Regulation of p53 stability and function by the deubiquitinating enzyme USP42.", "journal": "The EMBO journal", "date": "2011", "authors": "Hock AK, Vigneron AM, Carter S, Ludwig RL, Vousden KH", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "22085928", "url": "https://glygen.org/publication/PubMed/22085928" } ] }, { "title": "An anti-Wnt5a antibody suppresses metastasis of gastric cancer cells in vivo by inhibiting receptor-mediated endocytosis.", "journal": "Molecular cancer therapeutics", "date": "2012", "authors": "Hanaki H, Yamamoto H, Sakane H, Matsumoto S, Ohdan H, Sato A, Kikuchi A", "evidence": [ { "database": "Reactome", "id": "R-HSA-195253", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-195253" } ], "reference": [ { "type": "PubMed", "id": "22101459", "url": "https://glygen.org/publication/PubMed/22101459" } ] }, { "title": "Three point mutations in the CFTR gene in French cystic fibrosis patients: identification by denaturing gradient gel electrophoresis.", "journal": "Human genetics", "date": "1990", "authors": "Vidaud M, Fanen P, Martin J, Ghanem N, Nicolas S, Goossens M", "evidence": [ { "database": "Reactome", "id": "R-HSA-5678895", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5678895" } ], "reference": [ { "type": "PubMed", "id": "2210768", "url": "https://glygen.org/publication/PubMed/2210768" } ] }, { "title": "Ubiquitin-specific protease 19 (USP19) regulates hypoxia-inducible factor 1alpha (HIF-1alpha) during hypoxia.", "journal": "The Journal of biological chemistry", "date": "2012", "authors": "Altun M, Zhao B, Velasco K, Liu H, Hassink G, Paschke J, Pereira T, Lindsten K", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "22128162", "url": "https://glygen.org/publication/PubMed/22128162" } ] }, { "title": "Signaling pathways activated by the phytochemical nordihydroguaiaretic acid contribute to a Keap1-independent regulation of Nrf2 stability: Role of glycogen synthase kinase-3.", "journal": "Free radical biology & medicine", "date": "2012", "authors": "Rojo AI, Medina-Campos ON, Rada P, Zuniga-Toala A, Lopez-Gazcon A, Espada S, Pedraza-Chaverri J, Cuadrado A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9762114", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9762114" } ], "reference": [ { "type": "PubMed", "id": "22142471", "url": "https://glygen.org/publication/PubMed/22142471" } ] }, { "title": "Sec22b regulates phagosomal maturation and antigen crosspresentation by dendritic cells.", "journal": "Cell", "date": "2011", "authors": "Cebrian I, Visentin G, Blanchard N, Jouve M, Bobard A, Moita C, Enninga J, Moita LF, Amigorena S, Savina A", "evidence": [ { "database": "Reactome", "id": "R-HSA-1236974", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1236974" } ], "reference": [ { "type": "PubMed", "id": "22153078", "url": "https://glygen.org/publication/PubMed/22153078" } ] }, { "title": "CFTR and TMEM16A are separate but functionally related Cl- channels.", "journal": "Cellular physiology and biochemistry : international journal of experimental cellular physiology, biochemistry, and pharmacology", "date": "2011", "authors": "Ousingsawat J, Kongsuphol P, Schreiber R, Kunzelmann K", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "22178883", "url": "https://glygen.org/publication/PubMed/22178883" } ] }, { "title": "Domain analysis reveals that a deubiquitinating enzyme USP13 performs non-activating catalysis for Lys63-linked polyubiquitin.", "journal": "PloS one", "date": "2011", "authors": "Zhang YH, Zhou CJ, Zhou ZR, Song AX, Hu HY", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "22216260", "url": "https://glygen.org/publication/PubMed/22216260" } ] }, { "title": "Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-alpha-acetylation features.", "journal": "Molecular & cellular proteomics : MCP", "date": "2012", "authors": "Bienvenut WV, Sumpton D, Martinez A, Lilla S, Espagne C, Meinnel T, Giglione C", "evidence": [ { "database": "UniProtKB", "id": "O00231", "url": "https://www.uniprot.org/uniprot/O00231" } ], "reference": [ { "type": "PubMed", "id": "22223895", "url": "https://glygen.org/publication/PubMed/22223895" } ] }, { "title": "Syk kinase-coupled C-type lectin receptors engage protein kinase C-sigma to elicit Card9 adaptor-mediated innate immunity.", "journal": "Immunity", "date": "2012", "authors": "Strasser D, Neumann K, Bergmann H, Marakalala MJ, Guler R, Rojowska A, Hopfner KP, Brombacher F, Urlaub H, Baier G, Brown GD, Leitges M, Ruland J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5607764", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5607764" } ], "reference": [ { "type": "PubMed", "id": "22265677", "url": "https://glygen.org/publication/PubMed/22265677" } ] }, { "title": "A self-reinforcing regulatory network triggered by limiting IL-7 activates pre-BCR signaling and differentiation.", "journal": "Nature immunology", "date": "2012", "authors": "Ochiai K, Maienschein-Cline M, Mandal M, Triggs JR, Bertolino E, Sciammas R, Dinner AR, Clark MR, Singh H", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "22267219", "url": "https://glygen.org/publication/PubMed/22267219" } ] }, { "title": "IGF2BP1 promotes cell migration by regulating MK5 and PTEN signaling.", "journal": "Genes & development", "date": "2012", "authors": "Stohr N, Kohn M, Lederer M, Glass M, Reinke C, Singer RH, Huttelmaier S", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "22279049", "url": "https://glygen.org/publication/PubMed/22279049" } ] }, { "title": "The LIMD1 protein bridges an association between the prolyl hydroxylases and VHL to repress HIF-1 activity.", "journal": "Nature cell biology", "date": "2012", "authors": "Foxler DE, Bridge KS, James V, Webb TM, Mee M, Wong SC, Feng Y, Constantin-Teodosiu D, Petursdottir TE, Bjornsson J, Ingvarsson S, Ratcliffe PJ, Longmore GD, Sharp TV", "evidence": [ { "database": "Reactome", "id": "R-HSA-1234176", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1234176" } ], "reference": [ { "type": "PubMed", "id": "22286099", "url": "https://glygen.org/publication/PubMed/22286099" } ] }, { "title": "Inhibition of NEDD8-conjugation pathway by novel molecules: potential approaches to anticancer therapy.", "journal": "Molecular oncology", "date": "2012", "authors": "Tanaka T, Nakatani T, Kamitani T", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "22306028", "url": "https://glygen.org/publication/PubMed/22306028" } ] }, { "title": "Novel E3 ligase component FBXL7 ubiquitinates and degrades Aurora A, causing mitotic arrest.", "journal": "Cell cycle (Georgetown, Tex.)", "date": "2012", "authors": "Coon TA, Glasser JR, Mallampalli RK, Chen BB", "evidence": [ { "database": "Reactome", "id": "R-HSA-8854050", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8854050" } ], "reference": [ { "type": "PubMed", "id": "22306998", "url": "https://glygen.org/publication/PubMed/22306998" } ] }, { "title": "Drug bests cystic-fibrosis mutation.", "journal": "Nature", "date": "2012", "authors": "Ledford H", "evidence": [ { "database": "Reactome", "id": "R-HSA-5678895", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5678895" } ], "reference": [ { "type": "PubMed", "id": "22318583", "url": "https://glygen.org/publication/PubMed/22318583" } ] }, { "title": "Identification of mutations in regions corresponding to the two putative nucleotide (ATP)-binding folds of the cystic fibrosis gene.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1990", "authors": "Kerem BS, Zielenski J, Markiewicz D, Bozon D, Gazit E, Yahav J, Kennedy D, Riordan JR, Collins FS, Rommens JM, et al.", "evidence": [ { "database": "Reactome", "id": "R-HSA-5678895", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5678895" } ], "reference": [ { "type": "PubMed", "id": "2236053", "url": "https://glygen.org/publication/PubMed/2236053" } ] }, { "title": "Mammalian homologues of Drosophila fused kinase.", "journal": "Vitamins and hormones", "date": "2012", "authors": "Maloverjan A, Piirsoo M", "evidence": [ { "database": "Reactome", "id": "R-HSA-5632684", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5632684" } ], "reference": [ { "type": "PubMed", "id": "22391301", "url": "https://glygen.org/publication/PubMed/22391301" } ] }, { "title": "Down-regulation of type I Runx2 mediated by dexamethasone is required for 3T3-L1 adipogenesis.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2012", "authors": "Zhang YY, Li X, Qian SW, Guo L, Huang HY, He Q, Liu Y, Ma CG, Tang QQ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8939902", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8939902" } ], "reference": [ { "type": "PubMed", "id": "22422618", "url": "https://glygen.org/publication/PubMed/22422618" } ] }, { "title": "The chaperone-assisted E3 ligase C terminus of Hsc70-interacting protein (CHIP) targets PTEN for proteasomal degradation.", "journal": "The Journal of biological chemistry", "date": "2012", "authors": "Ahmed SF, Deb S, Paul I, Chatterjee A, Mandal T, Chatterjee U, Ghosh MK", "evidence": [ { "database": "Reactome", "id": "R-HSA-8948751", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8948751" } ], "reference": [ { "type": "PubMed", "id": "22427670", "url": "https://glygen.org/publication/PubMed/22427670" } ] }, { "title": "A novel tankyrase inhibitor decreases canonical Wnt signaling in colon carcinoma cells and reduces tumor growth in conditional APC mutant mice.", "journal": "Cancer research", "date": "2012", "authors": "Waaler J, Machon O, Tumova L, Dinh H, Korinek V, Wilson SR, Paulsen JE, Pedersen NM, Eide TJ, Machonova O, Gradl D, Voronkov A, von Kries JP, Krauss S", "evidence": [ { "database": "Reactome", "id": "R-HSA-4641257", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4641257" } ], "reference": [ { "type": "PubMed", "id": "22440753", "url": "https://glygen.org/publication/PubMed/22440753" } ] }, { "title": "NEDD8 links cullin-RING ubiquitin ligase function to the p97 pathway.", "journal": "Nature structural & molecular biology", "date": "2012", "authors": "den Besten W, Verma R, Kleiger G, Oania RS, Deshaies RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "22466964", "url": "https://glygen.org/publication/PubMed/22466964" } ] }, { "title": "ERK3 signals through SRC-3 coactivator to promote human lung cancer cell invasion.", "journal": "The Journal of clinical investigation", "date": "2012", "authors": "Long W, Foulds CE, Qin J, Liu J, Ding C, Lonard DM, Solis LM, Wistuba II, Qin J, Tsai SY, Tsai MJ, O'Malley BW", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "22505454", "url": "https://glygen.org/publication/PubMed/22505454" } ] }, { "title": "The extracellular signal-regulated kinase 3 (mitogen-activated protein kinase 6 [MAPK6])-MAPK-activated protein kinase 5 signaling complex regulates septin function and dendrite morphology.", "journal": "Molecular and cellular biology", "date": "2012", "authors": "Brand F, Schumacher S, Kant S, Menon MB, Simon R, Turgeon B, Britsch S, Meloche S, Gaestel M, Kotlyarov A", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "22508986", "url": "https://glygen.org/publication/PubMed/22508986" } ] }, { "title": "UBXN7 docks on neddylated cullin complexes using its UIM motif and causes HIF1alpha accumulation.", "journal": "BMC biology", "date": "2012", "authors": "Bandau S, Knebel A, Gage ZO, Wood NT, Alexandru G", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "22537386", "url": "https://glygen.org/publication/PubMed/22537386" } ] }, { "title": "Molecular cloning and primary structure of rat testes metalloendopeptidase EC 3.4.24.15.", "journal": "Biochemistry", "date": "1990", "authors": "Pierotti A, Dong KW, Glucksman MJ, Orlowski M, Roberts JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-983168", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983168" } ], "reference": [ { "type": "PubMed", "id": "2261476", "url": "https://glygen.org/publication/PubMed/2261476" } ] }, { "title": "Structure of the nuclear factor kappaB-inducing kinase (NIK) kinase domain reveals a constitutively active conformation.", "journal": "The Journal of biological chemistry", "date": "2012", "authors": "Liu J, Sudom A, Min X, Cao Z, Gao X, Ayres M, Lee F, Cao P, Johnstone S, Plotnikova O, Walker N, Chen G, Wang Z", "evidence": [ { "database": "Reactome", "id": "R-HSA-5607761", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5607761" } ], "reference": [ { "type": "PubMed", "id": "22718757", "url": "https://glygen.org/publication/PubMed/22718757" } ] }, { "title": "A shared molecular mechanism underlies the human rasopathies Legius syndrome and Neurofibromatosis-1.", "journal": "Genes & development", "date": "2012", "authors": "Stowe IB, Mercado EL, Stowe TR, Bell EL, Oses-Prieto JA, Hernandez H, Burlingame AL, McCormick F", "evidence": [ { "database": "Reactome", "id": "R-HSA-5658442", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5658442" } ], "reference": [ { "type": "PubMed", "id": "22751498", "url": "https://glygen.org/publication/PubMed/22751498" } ] }, { "title": "Structural and functional characterization of Nrf2 degradation by the glycogen synthase kinase 3/beta-TrCP axis.", "journal": "Molecular and cellular biology", "date": "2012", "authors": "Rada P, Rojo AI, Evrard-Todeschi N, Innamorato NG, Cotte A, Jaworski T, Tobon-Velasco JC, Devijver H, Garcia-Mayoral MF, Van Leuven F, Hayes JD, Bertho G, Cuadrado A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9762114", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9762114" } ], "reference": [ { "type": "PubMed", "id": "22751928", "url": "https://glygen.org/publication/PubMed/22751928" } ] }, { "title": "Reversible modification of adenomatous polyposis coli (APC) with K63-linked polyubiquitin regulates the assembly and activity of the beta-catenin destruction complex.", "journal": "The Journal of biological chemistry", "date": "2012", "authors": "Tran H, Polakis P", "evidence": [ { "database": "Reactome", "id": "R-HSA-195253", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-195253" } ], "reference": [ { "type": "PubMed", "id": "22761442", "url": "https://glygen.org/publication/PubMed/22761442" } ] }, { "title": "Nrf2 redirects glucose and glutamine into anabolic pathways in metabolic reprogramming.", "journal": "Cancer cell", "date": "2012", "authors": "Mitsuishi Y, Taguchi K, Kawatani Y, Shibata T, Nukiwa T, Aburatani H, Yamamoto M, Motohashi H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9755511", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9755511" } ], "reference": [ { "type": "PubMed", "id": "22789539", "url": "https://glygen.org/publication/PubMed/22789539" } ] }, { "title": "Regulation of PKC-theta function by phosphorylation in T cell receptor signaling.", "journal": "Frontiers in immunology", "date": "2012", "authors": "Wang X, Chuang HC, Li JP, Tan TH", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871837" } ], "reference": [ { "type": "PubMed", "id": "22798961", "url": "https://glygen.org/publication/PubMed/22798961" } ] }, { "title": "Tumour promoting and suppressing roles of the atypical MAP kinase signalling pathway ERK3/4-MK5.", "journal": "Journal of molecular signaling", "date": "2012", "authors": "Kostenko S, Dumitriu G, Moens U", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "22800433", "url": "https://glygen.org/publication/PubMed/22800433" } ] }, { "title": "SPRED proteins provide a NF-ty link to Ras suppression.", "journal": "Genes & development", "date": "2012", "authors": "McClatchey AI, Cichowski K", "evidence": [ { "database": "Reactome", "id": "R-HSA-5658442", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5658442" } ], "reference": [ { "type": "PubMed", "id": "22802525", "url": "https://glygen.org/publication/PubMed/22802525" } ] }, { "title": "Keap1 degradation by autophagy for the maintenance of redox homeostasis.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2012", "authors": "Taguchi K, Fujikawa N, Komatsu M, Ishii T, Unno M, Akaike T, Motohashi H, Yamamoto M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9755511", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9755511" } ], "reference": [ { "type": "PubMed", "id": "22872865", "url": "https://glygen.org/publication/PubMed/22872865" } ] }, { "title": "HDAC8 mutations in Cornelia de Lange syndrome affect the cohesin acetylation cycle.", "journal": "Nature", "date": "2012", "authors": "Deardorff MA, Bando M, Nakato R, Watrin E, Itoh T, Minamino M, Saitoh K, Komata M, Katou Y, Clark D, Cole KE, De Baere E, Decroos C, Di Donato N, Ernst S, Francey LJ, Gyftodimou Y, Hirashima K, Hullings M, Ishikawa Y, Jaulin C, Kaur M, Kiyono T, Lombardi PM, Magnaghi-Jaulin L, Mortier GR, Nozaki N, Petersen MB, Seimiya H, Siu VM, Suzuki Y, Takagaki K, Wilde JJ, Willems PJ, Prigent C, Gillessen-Kaesbach G, Christianson DW, Kaiser FJ, Jackson LG, Hirota T, Krantz ID, Shirahige K", "evidence": [ { "database": "Reactome", "id": "R-HSA-2467813", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2467813" } ], "reference": [ { "type": "PubMed", "id": "22885700", "url": "https://glygen.org/publication/PubMed/22885700" } ] }, { "title": "Core transcriptional regulatory circuit controlled by the TAL1 complex in human T cell acute lymphoblastic leukemia.", "journal": "Cancer cell", "date": "2012", "authors": "Sanda T, Lawton LN, Barrasa MI, Fan ZP, Kohlhammer H, Gutierrez A, Ma W, Tatarek J, Ahn Y, Kelliher MA, Jamieson CH, Staudt LM, Young RA, Look AT", "evidence": [ { "database": "Reactome", "id": "R-HSA-8939236", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8939236" } ], "reference": [ { "type": "PubMed", "id": "22897851", "url": "https://glygen.org/publication/PubMed/22897851" } ] }, { "title": "Structural basis for a reciprocal regulation between SCF and CSN.", "journal": "Cell reports", "date": "2012", "authors": "Enchev RI, Scott DC, da Fonseca PC, Schreiber A, Monda JK, Schulman BA, Peter M, Morris EP", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "22959436", "url": "https://glygen.org/publication/PubMed/22959436" } ] }, { "title": "Nrf2 is controlled by two distinct beta-TrCP recognition motifs in its Neh6 domain, one of which can be modulated by GSK-3 activity.", "journal": "Oncogene", "date": "2013", "authors": "Chowdhry S, Zhang Y, McMahon M, Sutherland C, Cuadrado A, Hayes JD", "evidence": [ { "database": "Reactome", "id": "R-HSA-9762114", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9762114" } ], "reference": [ { "type": "PubMed", "id": "22964642", "url": "https://glygen.org/publication/PubMed/22964642" } ] }, { "title": "Increased proteasome activity in human embryonic stem cells is regulated by PSMD11.", "journal": "Nature", "date": "2012", "authors": "Vilchez D, Boyer L, Morantte I, Lutz M, Merkwirth C, Joyce D, Spencer B, Page L, Masliah E, Berggren WT, Gage FH, Dillin A", "evidence": [ { "database": "UniProtKB", "id": "O00231", "url": "https://www.uniprot.org/uniprot/O00231" } ], "reference": [ { "type": "PubMed", "id": "22972301", "url": "https://glygen.org/publication/PubMed/22972301" } ] }, { "title": "The many roles of the conserved eukaryotic Paf1 complex in regulating transcription, histone modifications, and disease states.", "journal": "Biochimica et biophysica acta", "date": "2013", "authors": "Tomson BN, Arndt KM", "evidence": [ { "database": "Reactome", "id": "R-HSA-5632684", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5632684" } ], "reference": [ { "type": "PubMed", "id": "22982193", "url": "https://glygen.org/publication/PubMed/22982193" } ] }, { "title": "Characterisation of the roles of ABCB1, ABCC1, ABCC2 and ABCG2 in the transport and pharmacokinetics of actinomycin D in vitro and in vivo.", "journal": "Biochemical pharmacology", "date": "2013", "authors": "Hill CR, Jamieson D, Thomas HD, Brown CD, Boddy AV, Veal GJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "23063411", "url": "https://glygen.org/publication/PubMed/23063411" } ] }, { "title": "Insulin-like growth factor 2 mRNA-binding proteins (IGF2BPs): post-transcriptional drivers of cancer progression?", "journal": "Cellular and molecular life sciences : CMLS", "date": "2013", "authors": "Bell JL, Wachter K, Muhleck B, Pazaitis N, Kohn M, Lederer M, Huttelmaier S", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "23069990", "url": "https://glygen.org/publication/PubMed/23069990" } ] }, { "title": "Identification of N-terminal residues of Sonic Hedgehog important for palmitoylation by Hedgehog acyltransferase.", "journal": "The Journal of biological chemistry", "date": "2012", "authors": "Hardy RY, Resh MD", "evidence": [ { "database": "Reactome", "id": "R-HSA-5358346", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5358346" } ], "reference": [ { "type": "PubMed", "id": "23112049", "url": "https://glygen.org/publication/PubMed/23112049" } ] }, { "title": "Planar cell polarity in the inner ear.", "journal": "Current topics in developmental biology", "date": "2012", "authors": "May-Simera H, Kelley MW", "evidence": [ { "database": "Reactome", "id": "R-HSA-4608870", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4608870" } ], "reference": [ { "type": "PubMed", "id": "23140627", "url": "https://glygen.org/publication/PubMed/23140627" } ] }, { "title": "Inhibition of tankyrases induces Axin stabilization and blocks Wnt signalling in breast cancer cells.", "journal": "PloS one", "date": "2012", "authors": "Bao R, Christova T, Song S, Angers S, Yan X, Attisano L", "evidence": [ { "database": "Reactome", "id": "R-HSA-4641257", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4641257" } ], "reference": [ { "type": "PubMed", "id": "23144924", "url": "https://glygen.org/publication/PubMed/23144924" } ] }, { "title": "The deubiquitinating protein USP24 interacts with DDB2 and regulates DDB2 stability.", "journal": "Cell cycle (Georgetown, Tex.)", "date": "2012", "authors": "Zhang L, Lubin A, Chen H, Sun Z, Gong F", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "23159851", "url": "https://glygen.org/publication/PubMed/23159851" } ] }, { "title": "Toward a comprehensive characterization of a human cancer cell phosphoproteome.", "journal": "Journal of proteome research", "date": "2013", "authors": "Zhou H, Di Palma S, Preisinger C, Peng M, Polat AN, Heck AJ, Mohammed S", "evidence": [ { "database": "UniProtKB", "id": "O00231", "url": "https://www.uniprot.org/uniprot/O00231" }, { "database": "iPTMnet", "id": "O00231", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O00231" } ], "reference": [ { "type": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" } ] }, { "title": "Structural conservation of distinctive N-terminal acetylation-dependent interactions across a family of mammalian NEDD8 ligation enzymes.", "journal": "Structure (London, England : 1993)", "date": "2013", "authors": "Monda JK, Scott DC, Miller DJ, Lydeard J, King D, Harper JW, Bennett EJ, Schulman BA", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "23201271", "url": "https://glygen.org/publication/PubMed/23201271" } ] }, { "title": "Dystroglycan organizes axon guidance cue localization and axonal pathfinding.", "journal": "Neuron", "date": "2012", "authors": "Wright KM, Lyon KA, Leung H, Leahy DJ, Ma L, Ginty DD", "evidence": [ { "database": "Reactome", "id": "R-HSA-9010553", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9010553" } ], "reference": [ { "type": "PubMed", "id": "23217742", "url": "https://glygen.org/publication/PubMed/23217742" } ] }, { "title": "GTSE1 is a microtubule plus-end tracking protein that regulates EB1-dependent cell migration.", "journal": "PloS one", "date": "2012", "authors": "Scolz M, Widlund PO, Piazza S, Bublik DR, Reber S, Peche LY, Ciani Y, Hubner N, Isokane M, Monte M, Ellenberg J, Hyman AA, Schneider C, Bird AW", "evidence": [ { "database": "Reactome", "id": "R-HSA-8852276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8852276" } ], "reference": [ { "type": "PubMed", "id": "23236459", "url": "https://glygen.org/publication/PubMed/23236459" } ] }, { "title": "The way Wnt works: components and mechanism.", "journal": "Growth factors (Chur, Switzerland)", "date": "2013", "authors": "Saito-Diaz K, Chen TW, Wang X, Thorne CA, Wallace HA, Page-McCaw A, Lee E", "evidence": [ { "database": "Reactome", "id": "R-HSA-195253", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-195253" } ], "reference": [ { "type": "PubMed", "id": "23256519", "url": "https://glygen.org/publication/PubMed/23256519" } ] }, { "title": "Sestrins activate Nrf2 by promoting p62-dependent autophagic degradation of Keap1 and prevent oxidative liver damage.", "journal": "Cell metabolism", "date": "2013", "authors": "Bae SH, Sung SH, Oh SY, Lim JM, Lee SK, Park YN, Lee HE, Kang D, Rhee SG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9755511", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9755511" } ], "reference": [ { "type": "PubMed", "id": "23274085", "url": "https://glygen.org/publication/PubMed/23274085" } ] }, { "title": "The ciliary G-protein-coupled receptor Gpr161 negatively regulates the Sonic hedgehog pathway via cAMP signaling.", "journal": "Cell", "date": "2013", "authors": "Mukhopadhyay S, Wen X, Ratti N, Loktev A, Rangell L, Scales SJ, Jackson PK", "evidence": [ { "database": "Reactome", "id": "R-HSA-5632684", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5632684" } ], "reference": [ { "type": "PubMed", "id": "23332756", "url": "https://glygen.org/publication/PubMed/23332756" } ] }, { "title": "CBFbeta stabilizes HIV Vif to counteract APOBEC3 at the expense of RUNX1 target gene expression.", "journal": "Molecular cell", "date": "2013", "authors": "Kim DY, Kwon E, Hartley PD, Crosby DC, Mann S, Krogan NJ, Gross JD", "evidence": [ { "database": "Reactome", "id": "R-HSA-8941858", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8941858" } ], "reference": [ { "type": "PubMed", "id": "23333304", "url": "https://glygen.org/publication/PubMed/23333304" } ] }, { "title": "FAT10ylation as a signal for proteasomal degradation.", "journal": "Biochimica et biophysica acta", "date": "2014", "authors": "Schmidtke G, Aichem A, Groettrup M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "23333871", "url": "https://glygen.org/publication/PubMed/23333871" } ] }, { "title": "Identification of the E3 deubiquitinase ubiquitin-specific peptidase 21 (USP21) as a positive regulator of the transcription factor GATA3.", "journal": "The Journal of biological chemistry", "date": "2013", "authors": "Zhang J, Chen C, Hou X, Gao Y, Lin F, Yang J, Gao Z, Pan L, Tao L, Wen C, Yao Z, Tsun A, Shi G, Li B", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "23395819", "url": "https://glygen.org/publication/PubMed/23395819" } ] }, { "title": "DCNL1 functions as a substrate sensor and activator of cullin 2-RING ligase.", "journal": "Molecular and cellular biology", "date": "2013", "authors": "Heir P, Sufan RI, Greer SN, Poon BP, Lee JE, Ohh M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "23401859", "url": "https://glygen.org/publication/PubMed/23401859" } ] }, { "title": "Estrogen Receptor alpha (ERalpha) and Estrogen Related Receptor alpha (ERRalpha) are both transcriptional regulators of the Runx2-I isoform.", "journal": "Molecular and cellular endocrinology", "date": "2013", "authors": "Kammerer M, Gutzwiller S, Stauffer D, Delhon I, Seltenmeyer Y, Fournier B", "evidence": [ { "database": "Reactome", "id": "R-HSA-8939902", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8939902" } ], "reference": [ { "type": "PubMed", "id": "23403054", "url": "https://glygen.org/publication/PubMed/23403054" } ] }, { "title": "RFP-mediated ubiquitination of PTEN modulates its effect on AKT activation.", "journal": "Cell research", "date": "2013", "authors": "Lee JT, Shan J, Zhong J, Li M, Zhou B, Zhou A, Parsons R, Gu W", "evidence": [ { "database": "Reactome", "id": "R-HSA-8948751", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8948751" } ], "reference": [ { "type": "PubMed", "id": "23419514", "url": "https://glygen.org/publication/PubMed/23419514" } ] }, { "title": "Nonredundant functions for Ras GTPase-activating proteins in tissue homeostasis.", "journal": "Science signaling", "date": "2013", "authors": "King PD, Lubeck BA, Lapinski PE", "evidence": [ { "database": "Reactome", "id": "R-HSA-5658442", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5658442" } ], "reference": [ { "type": "PubMed", "id": "23443682", "url": "https://glygen.org/publication/PubMed/23443682" } ] }, { "title": "Cand1 promotes assembly of new SCF complexes through dynamic exchange of F box proteins.", "journal": "Cell", "date": "2013", "authors": "Pierce NW, Lee JE, Liu X, Sweredoski MJ, Graham RL, Larimore EA, Rome M, Zheng N, Clurman BE, Hess S, Shan SO, Deshaies RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "23453757", "url": "https://glygen.org/publication/PubMed/23453757" } ] }, { "title": "USP33 regulates centrosome biogenesis via deubiquitination of the centriolar protein CP110.", "journal": "Nature", "date": "2013", "authors": "Li J, D'Angiolella V, Seeley ES, Kim S, Kobayashi T, Fu W, Campos EI, Pagano M, Dynlacht BD", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "23486064", "url": "https://glygen.org/publication/PubMed/23486064" } ] }, { "title": "The Par3/Par6/aPKC complex and epithelial cell polarity.", "journal": "Experimental cell research", "date": "2013", "authors": "Chen J, Zhang M", "evidence": [ { "database": "Reactome", "id": "R-HSA-4608870", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4608870" } ], "reference": [ { "type": "PubMed", "id": "23535009", "url": "https://glygen.org/publication/PubMed/23535009" } ] }, { "title": "CSN- and CAND1-dependent remodelling of the budding yeast SCF complex.", "journal": "Nature communications", "date": "2013", "authors": "Zemla A, Thomas Y, Kedziora S, Knebel A, Wood NT, Rabut G, Kurz T", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "23535662", "url": "https://glygen.org/publication/PubMed/23535662" } ] }, { "title": "CAND1 controls in vivo dynamics of the cullin 1-RING ubiquitin ligase repertoire.", "journal": "Nature communications", "date": "2013", "authors": "Wu S, Zhu W, Nhan T, Toth JI, Petroski MD, Wolf DA", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "23535663", "url": "https://glygen.org/publication/PubMed/23535663" } ] }, { "title": "CCDC22 deficiency in humans blunts activation of proinflammatory NF-kappaB signaling.", "journal": "The Journal of clinical investigation", "date": "2013", "authors": "Starokadomskyy P, Gluck N, Li H, Chen B, Wallis M, Maine GN, Mao X, Zaidi IW, Hein MY, McDonald FJ, Lenzner S, Zecha A, Ropers HH, Kuss AW, McGaughran J, Gecz J, Burstein E", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "23563313", "url": "https://glygen.org/publication/PubMed/23563313" } ] }, { "title": "Wnt stabilization of beta-catenin reveals principles for morphogen receptor-scaffold assemblies.", "journal": "Science (New York, N.Y.)", "date": "2013", "authors": "Kim SE, Huang H, Zhao M, Zhang X, Zhang A, Semonov MV, MacDonald BT, Zhang X, Garcia Abreu J, Peng L, He X", "evidence": [ { "database": "Reactome", "id": "R-HSA-195253", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-195253" } ], "reference": [ { "type": "PubMed", "id": "23579495", "url": "https://glygen.org/publication/PubMed/23579495" } ] }, { "title": "Deregulation of the COP9 signalosome-cullin-RING ubiquitin-ligase pathway: mechanisms and roles in urological cancers.", "journal": "The international journal of biochemistry & cell biology", "date": "2013", "authors": "Gummlich L, Rabien A, Jung K, Dubiel W", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "23583660", "url": "https://glygen.org/publication/PubMed/23583660" } ] }, { "title": "An ORC/Cdc6/MCM2-7 complex is formed in a multistep reaction to serve as a platform for MCM double-hexamer assembly.", "journal": "Molecular cell", "date": "2013", "authors": "Fernandez-Cid A, Riera A, Tognetti S, Herrera MC, Samel S, Evrin C, Winkler C, Gardenal E, Uhle S, Speck C", "evidence": [ { "database": "Reactome", "id": "R-HSA-68867", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-68867" } ], "reference": [ { "type": "PubMed", "id": "23603117", "url": "https://glygen.org/publication/PubMed/23603117" } ] }, { "title": "IkappaB kinase phosphorylation of SNAP-23 controls platelet secretion.", "journal": "Blood", "date": "2013", "authors": "Karim ZA, Zhang J, Banerjee M, Chicka MC, Al Hawas R, Hamilton TR, Roche PA, Whiteheart SW", "evidence": [ { "database": "Reactome", "id": "R-HSA-1236974", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1236974" } ], "reference": [ { "type": "PubMed", "id": "23613522", "url": "https://glygen.org/publication/PubMed/23613522" } ] }, { "title": "Proteome profiling of human neutrophil granule subsets, secretory vesicles, and cell membrane: correlation with transcriptome profiling of neutrophil precursors.", "journal": "Journal of leukocyte biology", "date": "2013", "authors": "Rorvig S, Ostergaard O, Heegaard NH, Borregaard N", "evidence": [ { "database": "Reactome", "id": "R-HSA-6798695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6798695" } ], "reference": [ { "type": "PubMed", "id": "23650620", "url": "https://glygen.org/publication/PubMed/23650620" } ] }, { "title": "Identifying the Ubiquitin Ligase complex that regulates the NF1 tumor suppressor and Ras.", "journal": "Cancer discovery", "date": "2013", "authors": "Hollstein PE, Cichowski K", "evidence": [ { "database": "Reactome", "id": "R-HSA-5658442", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5658442" } ], "reference": [ { "type": "PubMed", "id": "23661552", "url": "https://glygen.org/publication/PubMed/23661552" } ] }, { "title": "The mechanisms of Hedgehog signalling and its roles in development and disease.", "journal": "Nature reviews. Molecular cell biology", "date": "2013", "authors": "Briscoe J, Therond PP", "evidence": [ { "database": "Reactome", "id": "R-HSA-5358346", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5358346" } ], "reference": [ { "type": "PubMed", "id": "23719536", "url": "https://glygen.org/publication/PubMed/23719536" } ] }, { "title": "Hedgehog signaling from the primary cilium to the nucleus: an emerging picture of ciliary localization, trafficking and transduction.", "journal": "Current opinion in genetics & development", "date": "2013", "authors": "Nozawa YI, Lin C, Chuang PT", "evidence": [ { "database": "Reactome", "id": "R-HSA-5632684", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5632684" } ], "reference": [ { "type": "PubMed", "id": "23725801", "url": "https://glygen.org/publication/PubMed/23725801" } ] }, { "title": "Regulation of axon guidance by compartmentalized nonsense-mediated mRNA decay.", "journal": "Cell", "date": "2013", "authors": "Colak D, Ji SJ, Porse BT, Jaffrey SR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9010553", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9010553" } ], "reference": [ { "type": "PubMed", "id": "23746841", "url": "https://glygen.org/publication/PubMed/23746841" } ] }, { "title": "USP49 deubiquitinates histone H2B and regulates cotranscriptional pre-mRNA splicing.", "journal": "Genes & development", "date": "2013", "authors": "Zhang Z, Jones A, Joo HY, Zhou D, Cao Y, Chen S, Erdjument-Bromage H, Renfrow M, He H, Tempst P, Townes TM, Giles KE, Ma L, Wang H", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "23824326", "url": "https://glygen.org/publication/PubMed/23824326" } ] }, { "title": "USP18 inhibits NF-kappaB and NFAT activation during Th17 differentiation by deubiquitinating the TAK1-TAB1 complex.", "journal": "The Journal of experimental medicine", "date": "2013", "authors": "Liu X, Li H, Zhong B, Blonska M, Gorjestani S, Yan M, Tian Q, Zhang DE, Lin X, Dong C", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "23825189", "url": "https://glygen.org/publication/PubMed/23825189" } ] }, { "title": "Cryo-EM structure of a helicase loading intermediate containing ORC-Cdc6-Cdt1-MCM2-7 bound to DNA.", "journal": "Nature structural & molecular biology", "date": "2013", "authors": "Sun J, Evrin C, Samel SA, Fernandez-Cid A, Riera A, Kawakami H, Stillman B, Speck C, Li H", "evidence": [ { "database": "Reactome", "id": "R-HSA-68867", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-68867" } ], "reference": [ { "type": "PubMed", "id": "23851460", "url": "https://glygen.org/publication/PubMed/23851460" } ] }, { "title": "Derlin2 protein facilitates HRD1-mediated retro-translocation of sonic hedgehog at the endoplasmic reticulum.", "journal": "The Journal of biological chemistry", "date": "2013", "authors": "Huang CH, Hsiao HT, Chu YR, Ye Y, Chen X", "evidence": [ { "database": "Reactome", "id": "R-HSA-5362768", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5362768" } ], "reference": [ { "type": "PubMed", "id": "23867461", "url": "https://glygen.org/publication/PubMed/23867461" } ] }, { "title": "MK5 activates Rag transcription via Foxo1 in developing B cells.", "journal": "The Journal of experimental medicine", "date": "2013", "authors": "Chow KT, Timblin GA, McWhirter SM, Schlissel MS", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "23878308", "url": "https://glygen.org/publication/PubMed/23878308" } ] }, { "title": "The emerging family of CULLIN3-RING ubiquitin ligases (CRL3s): cellular functions and disease implications.", "journal": "The EMBO journal", "date": "2013", "authors": "Genschik P, Sumara I, Lechner E", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "23912815", "url": "https://glygen.org/publication/PubMed/23912815" } ] }, { "title": "Glucocorticoids antagonize RUNX2 during osteoblast differentiation in cultures of ST2 pluripotent mesenchymal cells.", "journal": "Journal of cellular biochemistry", "date": "2014", "authors": "Koromila T, Baniwal SK, Song YS, Martin A, Xiong J, Frenkel B", "evidence": [ { "database": "Reactome", "id": "R-HSA-8939902", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8939902" } ], "reference": [ { "type": "PubMed", "id": "23943595", "url": "https://glygen.org/publication/PubMed/23943595" } ] }, { "title": "Centrosomal protein DZIP1 regulates Hedgehog signaling by promoting cytoplasmic retention of transcription factor GLI3 and affecting ciliogenesis.", "journal": "The Journal of biological chemistry", "date": "2013", "authors": "Wang C, Low WC, Liu A, Wang B", "evidence": [ { "database": "Reactome", "id": "R-HSA-5632684", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5632684" } ], "reference": [ { "type": "PubMed", "id": "23955340", "url": "https://glygen.org/publication/PubMed/23955340" } ] }, { "title": "Regulatory flexibility in the Nrf2-mediated stress response is conferred by conformational cycling of the Keap1-Nrf2 protein complex.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2013", "authors": "Baird L, Lleres D, Swift S, Dinkova-Kostova AT", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "23986495", "url": "https://glygen.org/publication/PubMed/23986495" } ] }, { "title": "Phosphorylation of p62 activates the Keap1-Nrf2 pathway during selective autophagy.", "journal": "Molecular cell", "date": "2013", "authors": "Ichimura Y, Waguri S, Sou YS, Kageyama S, Hasegawa J, Ishimura R, Saito T, Yang Y, Kouno T, Fukutomi T, Hoshii T, Hirao A, Takagi K, Mizushima T, Motohashi H, Lee MS, Yoshimori T, Tanaka K, Yamamoto M, Komatsu M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9755511", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9755511" } ], "reference": [ { "type": "PubMed", "id": "24011591", "url": "https://glygen.org/publication/PubMed/24011591" } ] }, { "title": "RNF185 is a novel E3 ligase of endoplasmic reticulum-associated degradation (ERAD) that targets cystic fibrosis transmembrane conductance regulator (CFTR).", "journal": "The Journal of biological chemistry", "date": "2013", "authors": "El Khouri E, Le Pavec G, Toledano MB, Delaunay-Moisan A", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "24019521", "url": "https://glygen.org/publication/PubMed/24019521" } ] }, { "title": "Deubiquitinating enzyme Usp12 is a novel co-activator of the androgen receptor.", "journal": "The Journal of biological chemistry", "date": "2013", "authors": "Burska UL, Harle VJ, Coffey K, Darby S, Ramsey H, O'Neill D, Logan IR, Gaughan L, Robson CN", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "24056413", "url": "https://glygen.org/publication/PubMed/24056413" } ] }, { "title": "Stabilization of speckle-type POZ protein (Spop) by Daz interacting protein 1 (Dzip1) is essential for Gli turnover and the proper output of Hedgehog signaling.", "journal": "The Journal of biological chemistry", "date": "2013", "authors": "Schwend T, Jin Z, Jiang K, Mitchell BJ, Jia J, Yang J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5632684", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5632684" } ], "reference": [ { "type": "PubMed", "id": "24072710", "url": "https://glygen.org/publication/PubMed/24072710" } ] }, { "title": "Structural architecture of the CARMA1/Bcl10/MALT1 signalosome: nucleation-induced filamentous assembly.", "journal": "Molecular cell", "date": "2013", "authors": "Qiao Q, Yang C, Zheng C, Fontan L, David L, Yu X, Bracken C, Rosen M, Melnick A, Egelman EH, Wu H", "evidence": [ { "database": "Reactome", "id": "R-HSA-5607764", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5607764" } ], "reference": [ { "type": "PubMed", "id": "24074955", "url": "https://glygen.org/publication/PubMed/24074955" } ] }, { "title": "TRIAD1 and HHARI bind to and are activated by distinct neddylated Cullin-RING ligase complexes.", "journal": "The EMBO journal", "date": "2013", "authors": "Kelsall IR, Duda DM, Olszewski JL, Hofmann K, Knebel A, Langevin F, Wood N, Wightman M, Schulman BA, Alpi AF", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "24076655", "url": "https://glygen.org/publication/PubMed/24076655" } ] }, { "title": "Ubiquitin-specific proteases 25 negatively regulates virus-induced type I interferon signaling.", "journal": "PloS one", "date": "2013", "authors": "Zhong H, Wang D, Fang L, Zhang H, Luo R, Shang M, Ouyang C, Ouyang H, Chen H, Xiao S", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "24260525", "url": "https://glygen.org/publication/PubMed/24260525" } ] }, { "title": "Deubiquitylation and stabilization of PTEN by USP13.", "journal": "Nature cell biology", "date": "2013", "authors": "Zhang J, Zhang P, Wei Y, Piao HL, Wang W, Maddika S, Wang M, Chen D, Sun Y, Hung MC, Chen J, Ma L", "evidence": [ { "database": "Reactome", "id": "R-HSA-8948751", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8948751" } ], "reference": [ { "type": "PubMed", "id": "24270891", "url": "https://glygen.org/publication/PubMed/24270891" } ] }, { "title": "An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.", "journal": "Journal of proteomics", "date": "2014", "authors": "Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H", "evidence": [ { "database": "UniProtKB", "id": "O00231", "url": "https://www.uniprot.org/uniprot/O00231" }, { "database": "iPTMnet", "id": "O00231", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O00231" } ], "reference": [ { "type": "PubMed", "id": "24275569", "url": "https://glygen.org/publication/PubMed/24275569" } ] }, { "title": "Notch-Nrf2 axis: regulation of Nrf2 gene expression and cytoprotection by notch signaling.", "journal": "Molecular and cellular biology", "date": "2014", "authors": "Wakabayashi N, Skoko JJ, Chartoumpekis DV, Kimura S, Slocum SL, Noda K, Palliyaguru DL, Fujimuro M, Boley PA, Tanaka Y, Shigemura N, Biswal S, Yamamoto M, Kensler TW", "evidence": [ { "database": "Reactome", "id": "R-HSA-9755511", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9755511" } ], "reference": [ { "type": "PubMed", "id": "24298019", "url": "https://glygen.org/publication/PubMed/24298019" } ] }, { "title": "Activation of Smurf E3 ligase promoted by smoothened regulates hedgehog signaling through targeting patched turnover.", "journal": "PLoS biology", "date": "2013", "authors": "Huang S, Zhang Z, Zhang C, Lv X, Zheng X, Chen Z, Sun L, Wang H, Zhu Y, Zhang J, Yang S, Lu Y, Sun Q, Tao Y, Liu F, Zhao Y, Chen D", "evidence": [ { "database": "Reactome", "id": "R-HSA-5632684", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5632684" } ], "reference": [ { "type": "PubMed", "id": "24302888", "url": "https://glygen.org/publication/PubMed/24302888" } ] }, { "title": "Phosphorylation of heat shock protein 40 (Hsp40/DnaJB1) by mitogen-activated protein kinase-activated protein kinase 5 (MK5/PRAK).", "journal": "The international journal of biochemistry & cell biology", "date": "2014", "authors": "Kostenko S, Jensen KL, Moens U", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "24309468", "url": "https://glygen.org/publication/PubMed/24309468" } ] }, { "title": "Kinetic, thermodynamic, and structural characterizations of the association between Nrf2-DLGex degron and Keap1.", "journal": "Molecular and cellular biology", "date": "2014", "authors": "Fukutomi T, Takagi K, Mizushima T, Ohuchi N, Yamamoto M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "24366543", "url": "https://glygen.org/publication/PubMed/24366543" } ] }, { "title": "Regulation of PTEN inhibition by the pleckstrin homology domain of P-REX2 during insulin signaling and glucose homeostasis.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2014", "authors": "Hodakoski C, Hopkins BD, Barrows D, Mense SM, Keniry M, Anderson KE, Kern PA, Hawkins PT, Stephens LR, Parsons R", "evidence": [ { "database": "Reactome", "id": "R-HSA-8948751", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8948751" } ], "reference": [ { "type": "PubMed", "id": "24367090", "url": "https://glygen.org/publication/PubMed/24367090" } ] }, { "title": "USP21 negatively regulates antiviral response by acting as a RIG-I deubiquitinase.", "journal": "The Journal of experimental medicine", "date": "2014", "authors": "Fan Y, Mao R, Yu Y, Liu S, Shi Z, Cheng J, Zhang H, An L, Zhao Y, Xu X, Chen Z, Kogiso M, Zhang D, Zhang H, Zhang P, Jung JU, Li X, Xu G, Yang J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "24493797", "url": "https://glygen.org/publication/PubMed/24493797" } ] }, { "title": "EFCAB7 and IQCE regulate hedgehog signaling by tethering the EVC-EVC2 complex to the base of primary cilia.", "journal": "Developmental cell", "date": "2014", "authors": "Pusapati GV, Hughes CE, Dorn KV, Zhang D, Sugianto P, Aravind L, Rohatgi R", "evidence": [ { "database": "Reactome", "id": "R-HSA-5632684", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5632684" } ], "reference": [ { "type": "PubMed", "id": "24582806", "url": "https://glygen.org/publication/PubMed/24582806" } ] }, { "title": "ERK3 promotes endothelial cell functions by upregulating SRC-3/SP1-mediated VEGFR2 expression.", "journal": "Journal of cellular physiology", "date": "2014", "authors": "Wang W, Bian K, Vallabhaneni S, Zhang B, Wu RC, O'Malley BW, Long W", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "24585635", "url": "https://glygen.org/publication/PubMed/24585635" } ] }, { "title": "Hrd1 suppresses Nrf2-mediated cellular protection during liver cirrhosis.", "journal": "Genes & development", "date": "2014", "authors": "Wu T, Zhao F, Gao B, Tan C, Yagishita N, Nakajima T, Wong PK, Chapman E, Fang D, Zhang DD", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "24636985", "url": "https://glygen.org/publication/PubMed/24636985" } ] }, { "title": "Biosynthesis of cystic fibrosis transmembrane conductance regulator.", "journal": "The international journal of biochemistry & cell biology", "date": "2014", "authors": "Pranke IM, Sermet-Gaudelus I", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "24685677", "url": "https://glygen.org/publication/PubMed/24685677" } ] }, { "title": "Identification of the cystic fibrosis gene: cloning and characterization of complementary DNA.", "journal": "Science (New York, N.Y.)", "date": "1989", "authors": "Riordan JR, Rommens JM, Kerem B, Alon N, Rozmahel R, Grzelczak Z, Zielenski J, Lok S, Plavsic N, Chou JL, et al.", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "2475911", "url": "https://glygen.org/publication/PubMed/2475911" } ] }, { "title": "Loss of function mutation in the palmitoyl-transferase HHAT leads to syndromic 46,XY disorder of sex development by impeding Hedgehog protein palmitoylation and signaling.", "journal": "PLoS genetics", "date": "2014", "authors": "Callier P, Calvel P, Matevossian A, Makrythanasis P, Bernard P, Kurosaka H, Vannier A, Thauvin-Robinet C, Borel C, Mazaud-Guittot S, Rolland A, Desdoits-Lethimonier C, Guipponi M, Zimmermann C, Stevant I, Kuhne F, Conne B, Santoni F, Lambert S, Huet F, Mugneret F, Jaruzelska J, Faivre L, Wilhelm D, Jegou B, Trainor PA, Resh MD, Antonarakis SE, Nef S", "evidence": [ { "database": "Reactome", "id": "R-HSA-5358346", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5358346" } ], "reference": [ { "type": "PubMed", "id": "24784881", "url": "https://glygen.org/publication/PubMed/24784881" } ] }, { "title": "The 3M complex maintains microtubule and genome integrity.", "journal": "Molecular cell", "date": "2014", "authors": "Yan J, Yan F, Li Z, Sinnott B, Cappell KM, Yu Y, Mo J, Duncan JA, Chen X, Cormier-Daire V, Whitehurst AW, Xiong Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "24793695", "url": "https://glygen.org/publication/PubMed/24793695" } ] }, { "title": "CUL9 mediates the functions of the 3M complex and ubiquitylates survivin to maintain genome integrity.", "journal": "Molecular cell", "date": "2014", "authors": "Li Z, Pei XH, Yan J, Yan F, Cappell KM, Whitehurst AW, Xiong Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "24793696", "url": "https://glygen.org/publication/PubMed/24793696" } ] }, { "title": "An expanding role for RAS GTPase activating proteins (RAS GAPs) in cancer.", "journal": "Advances in biological regulation", "date": "2014", "authors": "Maertens O, Cichowski K", "evidence": [ { "database": "Reactome", "id": "R-HSA-5658442", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5658442" } ], "reference": [ { "type": "PubMed", "id": "24814062", "url": "https://glygen.org/publication/PubMed/24814062" } ] }, { "title": "G-protein-coupled receptors, Hedgehog signaling and primary cilia.", "journal": "Seminars in cell & developmental biology", "date": "2014", "authors": "Mukhopadhyay S, Rohatgi R", "evidence": [ { "database": "Reactome", "id": "R-HSA-5632684", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5632684" } ], "reference": [ { "type": "PubMed", "id": "24845016", "url": "https://glygen.org/publication/PubMed/24845016" } ] }, { "title": "Overlapping binding sites for importin beta1 and suppressor of fused (SuFu) on glioma-associated oncogene homologue 1 (Gli1) regulate its nuclear localization.", "journal": "The Biochemical journal", "date": "2014", "authors": "Szczepny A, Wagstaff KM, Dias M, Gajewska K, Wang C, Davies RG, Kaur G, Ly-Huynh J, Loveland KL, Jans DA", "evidence": [ { "database": "Reactome", "id": "R-HSA-5632684", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5632684" } ], "reference": [ { "type": "PubMed", "id": "24854174", "url": "https://glygen.org/publication/PubMed/24854174" } ] }, { "title": "The mitochondrial deubiquitinase USP30 opposes parkin-mediated mitophagy.", "journal": "Nature", "date": "2014", "authors": "Bingol B, Tea JS, Phu L, Reichelt M, Bakalarski CE, Song Q, Foreman O, Kirkpatrick DS, Sheng M", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "24896179", "url": "https://glygen.org/publication/PubMed/24896179" } ] }, { "title": "Requirement of Smurf-mediated endocytosis of Patched1 in sonic hedgehog signal reception.", "journal": "eLife", "date": "2014", "authors": "Yue S, Tang LY, Tang Y, Tang Y, Shen QH, Ding J, Chen Y, Zhang Z, Yu TT, Zhang YE, Cheng SY", "evidence": [ { "database": "Reactome", "id": "R-HSA-5632684", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5632684" } ], "reference": [ { "type": "PubMed", "id": "24925320", "url": "https://glygen.org/publication/PubMed/24925320" } ] }, { "title": "Sestrin2 promotes Unc-51-like kinase 1 mediated phosphorylation of p62/sequestosome-1.", "journal": "The FEBS journal", "date": "2014", "authors": "Ro SH, Semple IA, Park H, Park H, Park HW, Kim M, Kim JS, Lee JH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9755511", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9755511" } ], "reference": [ { "type": "PubMed", "id": "25040165", "url": "https://glygen.org/publication/PubMed/25040165" } ] }, { "title": "Targeting transcription regulation in cancer with a covalent CDK7 inhibitor.", "journal": "Nature", "date": "2014", "authors": "Kwiatkowski N, Zhang T, Rahl PB, Abraham BJ, Reddy J, Ficarro SB, Dastur A, Amzallag A, Ramaswamy S, Tesar B, Jenkins CE, Hannett NM, McMillin D, Sanda T, Sim T, Kim ND, Look T, Mitsiades CS, Weng AP, Brown JR, Benes CH, Marto JA, Young RA, Gray NS", "evidence": [ { "database": "Reactome", "id": "R-HSA-8939236", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8939236" } ], "reference": [ { "type": "PubMed", "id": "25043025", "url": "https://glygen.org/publication/PubMed/25043025" } ] }, { "title": "TLR signals induce phagosomal MHC-I delivery from the endosomal recycling compartment to allow cross-presentation.", "journal": "Cell", "date": "2014", "authors": "Nair-Gupta P, Baccarini A, Tung N, Seyffer F, Florey O, Huang Y, Banerjee M, Overholtzer M, Roche PA, Tampe R, Brown BD, Amsen D, Whiteheart SW, Blander JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-1236974", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1236974" } ], "reference": [ { "type": "PubMed", "id": "25083866", "url": "https://glygen.org/publication/PubMed/25083866" } ] }, { "title": "Molecular mechanisms for biliary phospholipid and drug efflux mediated by ABCB4 and bile salts.", "journal": "BioMed research international", "date": "2014", "authors": "Morita SY, Terada T", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "25133187", "url": "https://glygen.org/publication/PubMed/25133187" } ] }, { "title": "TRAF-mediated modulation of NF-kB AND JNK activation by TNFR2.", "journal": "Cellular signalling", "date": "2014", "authors": "Cabal-Hierro L, Rodriguez M, Artime N, Iglesias J, Ugarte L, Prado MA, Lazo PS", "evidence": [ { "database": "Reactome", "id": "R-HSA-5668541", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5668541" } ], "reference": [ { "type": "PubMed", "id": "25152365", "url": "https://glygen.org/publication/PubMed/25152365" } ] }, { "title": "Deubiquitination and stabilization of IL-33 by USP21.", "journal": "International journal of clinical and experimental pathology", "date": "2014", "authors": "Tao L, Chen C, Song H, Piccioni M, Shi G, Li B", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "25197364", "url": "https://glygen.org/publication/PubMed/25197364" } ] }, { "title": "Geminin inhibits a late step in the formation of human pre-replicative complexes.", "journal": "The Journal of biological chemistry", "date": "2014", "authors": "Wu M, Lu W, Santos RE, Frattini MG, Kelly TJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-68867", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-68867" } ], "reference": [ { "type": "PubMed", "id": "25231993", "url": "https://glygen.org/publication/PubMed/25231993" } ] }, { "title": "USP33 mediates Slit-Robo signaling in inhibiting colorectal cancer cell migration.", "journal": "International journal of cancer", "date": "2015", "authors": "Huang Z, Wen P, Kong R, Cheng H, Zhang B, Quan C, Bian Z, Chen M, Zhang Z, Chen X, Du X, Liu J, Zhu L, Fushimi K, Hua D, Wu JY", "evidence": [ { "database": "Reactome", "id": "R-HSA-9010553", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9010553" } ], "reference": [ { "type": "PubMed", "id": "25242263", "url": "https://glygen.org/publication/PubMed/25242263" } ] }, { "title": "A feedback loop between RUNX2 and the E3 ligase SMURF1 in regulation of differentiation of human dental pulp stem cells.", "journal": "Journal of endodontics", "date": "2014", "authors": "Yang F, Xu N, Li D, Guan L, He Y, Zhang Y, Lu Q, Zhang X", "evidence": [ { "database": "Reactome", "id": "R-HSA-8939902", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8939902" } ], "reference": [ { "type": "PubMed", "id": "25260729", "url": "https://glygen.org/publication/PubMed/25260729" } ] }, { "title": "The histone H2A deubiquitinase USP16 interacts with HERC2 and fine-tunes cellular response to DNA damage.", "journal": "The Journal of biological chemistry", "date": "2014", "authors": "Zhang Z, Yang H, Wang H", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "25305019", "url": "https://glygen.org/publication/PubMed/25305019" } ] }, { "title": "The neuron-specific protein PGP 9.5 is a ubiquitin carboxyl-terminal hydrolase.", "journal": "Science (New York, N.Y.)", "date": "1989", "authors": "Wilkinson KD, Lee KM, Deshpande S, Duerksen-Hughes P, Boss JM, Pohl J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689603", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689603" } ], "reference": [ { "type": "PubMed", "id": "2530630", "url": "https://glygen.org/publication/PubMed/2530630" } ] }, { "title": "Cullin E3 ligases and their rewiring by viral factors.", "journal": "Biomolecules", "date": "2014", "authors": "Mahon C, Krogan NJ, Craik CS, Pick E", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "25314029", "url": "https://glygen.org/publication/PubMed/25314029" } ] }, { "title": "Heat shock protein 27 phosphorylation state is associated with cancer progression.", "journal": "Frontiers in genetics", "date": "2014", "authors": "Katsogiannou M, Andrieu C, Rocchi P", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "25339975", "url": "https://glygen.org/publication/PubMed/25339975" } ] }, { "title": "SCCRO3 (DCUN1D3) antagonizes the neddylation and oncogenic activity of SCCRO (DCUN1D1).", "journal": "The Journal of biological chemistry", "date": "2014", "authors": "Huang G, Stock C, Bommelje CC, Weeda VB, Shah K, Bains S, Buss E, Shaha M, Rechler W, Ramanathan SY, Singh B", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "25349211", "url": "https://glygen.org/publication/PubMed/25349211" } ] }, { "title": "COMMD1 is linked to the WASH complex and regulates endosomal trafficking of the copper transporter ATP7A.", "journal": "Molecular biology of the cell", "date": "2015", "authors": "Phillips-Krawczak CA, Singla A, Starokadomskyy P, Deng Z, Osborne DG, Li H, Dick CJ, Gomez TS, Koenecke M, Zhang JS, Dai H, Sifuentes-Dominguez LF, Geng LN, Kaufmann SH, Hein MY, Wallis M, McGaughran J, Gecz J, Sluis Bv, Billadeau DD, Burstein E", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "25355947", "url": "https://glygen.org/publication/PubMed/25355947" } ] }, { "title": "Oncogene regulation. An oncogenic super-enhancer formed through somatic mutation of a noncoding intergenic element.", "journal": "Science (New York, N.Y.)", "date": "2014", "authors": "Mansour MR, Abraham BJ, Anders L, Berezovskaya A, Gutierrez A, Durbin AD, Etchin J, Lawton L, Sallan SE, Silverman LB, Loh ML, Hunger SP, Sanda T, Young RA, Look AT", "evidence": [ { "database": "Reactome", "id": "R-HSA-8939236", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8939236" } ], "reference": [ { "type": "PubMed", "id": "25394790", "url": "https://glygen.org/publication/PubMed/25394790" } ] }, { "title": "Protein neddylation: beyond cullin-RING ligases.", "journal": "Nature reviews. Molecular cell biology", "date": "2015", "authors": "Enchev RI, Schulman BA, Peter M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "25531226", "url": "https://glygen.org/publication/PubMed/25531226" } ] }, { "title": "Poly-ADP ribosylation of PTEN by tankyrases promotes PTEN degradation and tumor growth.", "journal": "Genes & development", "date": "2015", "authors": "Li N, Zhang Y, Han X, Liang K, Wang J, Feng L, Wang W, Songyang Z, Lin C, Yang L, Yu Y, Chen J", "evidence": [ { "database": "Reactome", "id": "R-HSA-8948751", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8948751" } ], "reference": [ { "type": "PubMed", "id": "25547115", "url": "https://glygen.org/publication/PubMed/25547115" } ] }, { "title": "The deubiquitinating enzyme USP24 is a regulator of the UV damage response.", "journal": "Cell reports", "date": "2015", "authors": "Zhang L, Nemzow L, Chen H, Lubin A, Rong X, Sun Z, Harris TK, Gong F", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "25578727", "url": "https://glygen.org/publication/PubMed/25578727" } ] }, { "title": "Ivacaftor: a novel mutation modulating drug.", "journal": "Journal of clinical and diagnostic research : JCDR", "date": "2014", "authors": "Kapoor H, Koolwal A, Singh A", "evidence": [ { "database": "Reactome", "id": "R-HSA-5678895", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5678895" } ], "reference": [ { "type": "PubMed", "id": "25584290", "url": "https://glygen.org/publication/PubMed/25584290" } ] }, { "title": "F-box protein Fbxl18 mediates polyubiquitylation and proteasomal degradation of the pro-apoptotic SCF subunit Fbxl7.", "journal": "Cell death & disease", "date": "2015", "authors": "Liu Y, Lear T, Zhao Y, Zhao J, Zou C, Chen BB, Mallampalli RK", "evidence": [ { "database": "Reactome", "id": "R-HSA-8854050", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8854050" } ], "reference": [ { "type": "PubMed", "id": "25654763", "url": "https://glygen.org/publication/PubMed/25654763" } ] }, { "title": "Transepithelial transport of drugs by the multidrug transporter in cultured Madin-Darby canine kidney cell epithelia.", "journal": "The Journal of biological chemistry", "date": "1989", "authors": "Horio M, Chin KV, Currier SJ, Goldenberg S, Williams C, Pastan I, Gottesman MM, Handler J", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "2570070", "url": "https://glygen.org/publication/PubMed/2570070" } ] }, { "title": "Identification of the cystic fibrosis gene: genetic analysis.", "journal": "Science (New York, N.Y.)", "date": "1989", "authors": "Kerem B, Rommens JM, Buchanan JA, Markiewicz D, Cox TK, Chakravarti A, Buchwald M, Tsui LC", "evidence": [ { "database": "Reactome", "id": "R-HSA-5678895", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5678895" } ], "reference": [ { "type": "PubMed", "id": "2570460", "url": "https://glygen.org/publication/PubMed/2570460" } ] }, { "title": "Brk/Protein tyrosine kinase 6 phosphorylates p27KIP1, regulating the activity of cyclin D-cyclin-dependent kinase 4.", "journal": "Molecular and cellular biology", "date": "2015", "authors": "Patel P, Asbach B, Shteyn E, Gomez C, Coltoff A, Bhuyan S, Tyner AL, Wagner R, Blain SW", "evidence": [ { "database": "Reactome", "id": "R-HSA-187577", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-187577" } ], "reference": [ { "type": "PubMed", "id": "25733683", "url": "https://glygen.org/publication/PubMed/25733683" } ] }, { "title": "AKT and 14-3-3 regulate Notch4 nuclear localization.", "journal": "Scientific reports", "date": "2015", "authors": "Ramakrishnan G, Davaakhuu G, Chung WC, Zhu H, Rana A, Filipovic A, Green AR, Atfi A, Pannuti A, Miele L, Tzivion G", "evidence": [ { "database": "Reactome", "id": "R-HSA-9604323", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9604323" } ], "reference": [ { "type": "PubMed", "id": "25740432", "url": "https://glygen.org/publication/PubMed/25740432" } ] }, { "title": "SUMO-2 orchestrates chromatin modifiers in response to DNA damage.", "journal": "Cell Rep.", "date": "2015", "authors": "Hendriks Ivo A, Treffers Louise W, Verlaan-de Vries Matty, Olsen Jesper V, Vertegaal Alfred C O", "evidence": [ { "database": "UniProtKB", "id": "O00231", "url": "https://www.uniprot.org/uniprot/O00231" } ], "reference": [ { "type": "PubMed", "id": "25772364", "url": "https://glygen.org/publication/PubMed/25772364" } ] }, { "title": "Dimethyl fumarate and monoethyl fumarate exhibit differential effects on KEAP1, NRF2 activation, and glutathione depletion in vitro.", "journal": "PloS one", "date": "2015", "authors": "Brennan MS, Matos MF, Li B, Hronowski X, Gao B, Juhasz P, Rhodes KJ, Scannevin RH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9755511", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9755511" } ], "reference": [ { "type": "PubMed", "id": "25793262", "url": "https://glygen.org/publication/PubMed/25793262" } ] }, { "title": "The selective autophagy receptor p62 forms a flexible filamentous helical scaffold.", "journal": "Cell reports", "date": "2015", "authors": "Ciuffa R, Lamark T, Tarafder AK, Guesdon A, Rybina S, Hagen WJ, Johansen T, Sachse C", "evidence": [ { "database": "Reactome", "id": "R-HSA-9755511", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9755511" } ], "reference": [ { "type": "PubMed", "id": "25921531", "url": "https://glygen.org/publication/PubMed/25921531" } ] }, { "title": "Glucose Uptake and Runx2 Synergize to Orchestrate Osteoblast Differentiation and Bone Formation.", "journal": "Cell", "date": "2015", "authors": "Wei J, Shimazu J, Makinistoglu MP, Maurizi A, Kajimura D, Zong H, Takarada T, Lezaki T, Pessin JE, Hinoi E, Karsenty G", "evidence": [ { "database": "Reactome", "id": "R-HSA-8939902", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8939902" } ], "reference": [ { "type": "PubMed", "id": "26091038", "url": "https://glygen.org/publication/PubMed/26091038" } ] }, { "title": "p62 links autophagy and Nrf2 signaling.", "journal": "Free radical biology & medicine", "date": "2015", "authors": "Jiang T, Harder B, Rojo de la Vega M, Wong PK, Chapman E, Zhang DD", "evidence": [ { "database": "Reactome", "id": "R-HSA-9755511", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9755511" } ], "reference": [ { "type": "PubMed", "id": "26117325", "url": "https://glygen.org/publication/PubMed/26117325" } ] }, { "title": "PI3K/AKT activation induces PTEN ubiquitination and destabilization accelerating tumourigenesis.", "journal": "Nature communications", "date": "2015", "authors": "Lee MS, Jeong MH, Lee HW, Han HJ, Ko A, Hewitt SM, Kim JH, Chun KH, Chung JY, Lee C, Cho H, Song J", "evidence": [ { "database": "Reactome", "id": "R-HSA-8948751", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8948751" } ], "reference": [ { "type": "PubMed", "id": "26183061", "url": "https://glygen.org/publication/PubMed/26183061" } ] }, { "title": "Temozolomide competes for P-glycoprotein and contributes to chemoresistance in glioblastoma cells.", "journal": "Cancer letters", "date": "2015", "authors": "Munoz JL, Walker ND, Scotto KW, Rameshwar P", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "26208431", "url": "https://glygen.org/publication/PubMed/26208431" } ] }, { "title": "Structure of the eukaryotic MCM complex at 3.8 A.", "journal": "Nature", "date": "2015", "authors": "Li N, Zhai Y, Zhang Y, Li W, Yang M, Lei J, Tye BK, Gao N", "evidence": [ { "database": "Reactome", "id": "R-HSA-68867", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-68867" } ], "reference": [ { "type": "PubMed", "id": "26222030", "url": "https://glygen.org/publication/PubMed/26222030" } ] }, { "title": "Deubiquitylase OTUD3 regulates PTEN stability and suppresses tumorigenesis.", "journal": "Nature cell biology", "date": "2015", "authors": "Yuan L, Lv Y, Li H, Gao H, Song S, Zhang Y, Xing G, Kong X, Wang L, Li Y, Zhou T, Gao D, Xiao ZX, Yin Y, Wei W, He F, Zhang L", "evidence": [ { "database": "Reactome", "id": "R-HSA-8948751", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8948751" } ], "reference": [ { "type": "PubMed", "id": "26280536", "url": "https://glygen.org/publication/PubMed/26280536" } ] }, { "title": "Distinct and overlapping functions of the cullin E3 ligase scaffolding proteins CUL4A and CUL4B.", "journal": "Gene", "date": "2015", "authors": "Hannah J, Zhou P", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "26344709", "url": "https://glygen.org/publication/PubMed/26344709" } ] }, { "title": "The role and mechanism of CRL4 E3 ubiquitin ligase in cancer and its potential therapy implications.", "journal": "Oncotarget", "date": "2015", "authors": "Sang Y, Yan F, Ren X", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "26460955", "url": "https://glygen.org/publication/PubMed/26460955" } ] }, { "title": "E3 Ubiquitin Ligase Fbw7 Negatively Regulates Osteoblast Differentiation by Targeting Runx2 for Degradation.", "journal": "The Journal of biological chemistry", "date": "2015", "authors": "Kumar Y, Kapoor I, Khan K, Thacker G, Khan MP, Shukla N, Kanaujiya JK, Sanyal S, Chattopadhyay N, Trivedi AK", "evidence": [ { "database": "Reactome", "id": "R-HSA-8939902", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8939902" } ], "reference": [ { "type": "PubMed", "id": "26542806", "url": "https://glygen.org/publication/PubMed/26542806" } ] }, { "title": "Hepatitis B virus stimulates G6PD expression through HBx-mediated Nrf2 activation.", "journal": "Cell death & disease", "date": "2015", "authors": "Liu B, Fang M, He Z, Cui D, Jia S, Lin X, Xu X, Zhou T, Liu W", "evidence": [ { "database": "Reactome", "id": "R-HSA-9755511", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9755511" } ], "reference": [ { "type": "PubMed", "id": "26583321", "url": "https://glygen.org/publication/PubMed/26583321" } ] }, { "title": "Gln40 deamidation blocks structural reconfiguration and activation of SCF ubiquitin ligase complex by Nedd8.", "journal": "Nature communications", "date": "2015", "authors": "Yu C, Mao H, Novitsky EJ, Tang X, Rychnovsky SD, Zheng N, Huang L", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "26632597", "url": "https://glygen.org/publication/PubMed/26632597" } ] }, { "title": "Skp2 inhibits osteogenesis by promoting ubiquitin-proteasome degradation of Runx2.", "journal": "Biochimica et biophysica acta", "date": "2016", "authors": "Thacker G, Kumar Y, Khan MP, Shukla N, Kapoor I, Kanaujiya JK, Lochab S, Ahmed S, Sanyal S, Chattopadhyay N, Trivedi AK", "evidence": [ { "database": "Reactome", "id": "R-HSA-8939902", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8939902" } ], "reference": [ { "type": "PubMed", "id": "26778333", "url": "https://glygen.org/publication/PubMed/26778333" } ] }, { "title": "Characterization of the mammalian family of DCN-type NEDD8 E3 ligases.", "journal": "Journal of cell science", "date": "2016", "authors": "Keuss MJ, Thomas Y, Mcarthur R, Wood NT, Knebel A, Kurz T", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "26906416", "url": "https://glygen.org/publication/PubMed/26906416" } ] }, { "title": "TRIM21 Ubiquitylates SQSTM1/p62 and Suppresses Protein Sequestration to Regulate Redox Homeostasis.", "journal": "Molecular cell", "date": "2016", "authors": "Pan JA, Sun Y, Jiang YP, Bott AJ, Jaber N, Dou Z, Yang B, Chen JS, Catanzaro JM, Du C, Ding WX, Diaz-Meco MT, Moscat J, Ozato K, Lin RZ, Zong WX", "evidence": [ { "database": "Reactome", "id": "R-HSA-9755511", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9755511" } ], "reference": [ { "type": "PubMed", "id": "26942676", "url": "https://glygen.org/publication/PubMed/26942676" } ] }, { "title": "The role of cullin 5-containing ubiquitin ligases.", "journal": "Cell division", "date": "2016", "authors": "Okumura F, Joo-Okumura A, Nakatsukasa K, Kamura T", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "27030794", "url": "https://glygen.org/publication/PubMed/27030794" } ] }, { "title": "SCL/TAL1 in Hematopoiesis and Cellular Reprogramming.", "journal": "Current topics in developmental biology", "date": "2016", "authors": "Hoang T, Lambert JA, Martin R", "evidence": [ { "database": "Reactome", "id": "R-HSA-8939236", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8939236" } ], "reference": [ { "type": "PubMed", "id": "27137657", "url": "https://glygen.org/publication/PubMed/27137657" } ] }, { "title": "The structure and regulation of Cullin 2 based E3 ubiquitin ligases and their biological functions.", "journal": "Cell division", "date": "2016", "authors": "Cai W, Yang H", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "27222660", "url": "https://glygen.org/publication/PubMed/27222660" } ] }, { "title": "Molecular architecture of the recombinant human MCM2-7 helicase in complex with nucleotides and DNA.", "journal": "Cell cycle (Georgetown, Tex.)", "date": "2016", "authors": "Boskovic J, Bragado-Nilsson E, Saligram Prabhakar B, Yefimenko I, Martinez-Gago J, Munoz S, Mendez J, Montoya G", "evidence": [ { "database": "Reactome", "id": "R-HSA-68867", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-68867" } ], "reference": [ { "type": "PubMed", "id": "27249176", "url": "https://glygen.org/publication/PubMed/27249176" } ] }, { "title": "Structure of the human 26S proteasome at a resolution of 3.9 Aa.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "2016", "authors": "Schweitzer Andreas, Aufderheide Antje, Rudack Till, Beck Florian, Pfeifer G\u00fcnter, Plitzko J\u00fcrgen M, Sakata Eri, Schulten Klaus, F\u00f6rster Friedrich, Baumeister Wolfgang", "evidence": [ { "database": "UniProtKB", "id": "O00231", "url": "https://www.uniprot.org/uniprot/O00231" } ], "reference": [ { "type": "PubMed", "id": "27342858", "url": "https://glygen.org/publication/PubMed/27342858" } ] }, { "title": "An atomic structure of the human 26S proteasome.", "journal": "Nat. Struct. Mol. Biol.", "date": "2016", "authors": "Huang Xiuliang, Luan Bai, Wu Jianping, Shi Yigong", "evidence": [ { "database": "UniProtKB", "id": "O00231", "url": "https://www.uniprot.org/uniprot/O00231" } ], "reference": [ { "type": "PubMed", "id": "27428775", "url": "https://glygen.org/publication/PubMed/27428775" } ] }, { "title": "Multicenter Study of a Novel Topical Interleukin-1 Receptor Inhibitor, Isunakinra, in Subjects With Moderate to Severe Dry Eye Disease.", "journal": "Eye & contact lens", "date": "2017", "authors": "Goldstein MH, Martel JR, Sall K, Goldberg DF, Abrams M, Rubin J, Sheppard J, Tauber J, Korenfeld M, Agahigian J, Durham TA, Furfine E", "evidence": [ { "database": "Reactome", "id": "R-HSA-9020702", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9020702" } ], "reference": [ { "type": "PubMed", "id": "27466718", "url": "https://glygen.org/publication/PubMed/27466718" } ] }, { "title": "Two Distinct Types of E3 Ligases Work in Unison to Regulate Substrate Ubiquitylation.", "journal": "Cell", "date": "2016", "authors": "Scott DC, Rhee DY, Duda DM, Kelsall IR, Olszewski JL, Paulo JA, de Jong A, Ovaa H, Alpi AF, Harper JW, Schulman BA", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "27565346", "url": "https://glygen.org/publication/PubMed/27565346" } ] }, { "title": "p97 Negatively Regulates NRF2 by Extracting Ubiquitylated NRF2 from the KEAP1-CUL3 E3 Complex.", "journal": "Molecular and cellular biology", "date": "2017", "authors": "Tao S, Liu P, Luo G, Rojo de la Vega M, Chen H, Wu T, Tillotson J, Chapman E, Zhang DD", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "28115426", "url": "https://glygen.org/publication/PubMed/28115426" } ] }, { "title": "Polymorphisms in the multidrug-resistance 1 gene related to glucocorticoid response in rheumatoid arthritis treatment.", "journal": "Rheumatology international", "date": "2017", "authors": "Cuppen BV, Pardali K, Kraan MC, Marijnissen AC, Yrlid L, Olsson M, Bijlsma JW, Lafeber FP, Fritsch-Stork RD", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "28132103", "url": "https://glygen.org/publication/PubMed/28132103" } ] }, { "title": "In Vivo Human Somitogenesis Guides Somite Development from hPSCs.", "journal": "Cell reports", "date": "2017", "authors": "Xi H, Fujiwara W, Gonzalez K, Jan M, Liebscher S, Van Handel B, Schenke-Layland K, Pyle AD", "evidence": [ { "database": "Reactome", "id": "R-HSA-9824272", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9824272" } ], "reference": [ { "type": "PubMed", "id": "28178531", "url": "https://glygen.org/publication/PubMed/28178531" } ] }, { "title": "Keap1/Cullin3 Modulates p62/SQSTM1 Activity via UBA Domain Ubiquitination.", "journal": "Cell reports", "date": "2017", "authors": "Lee Y, Chou TF, Pittman SK, Keith AL, Razani B, Weihl CC", "evidence": [ { "database": "Reactome", "id": "R-HSA-9755511", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9755511" } ], "reference": [ { "type": "PubMed", "id": "28380357", "url": "https://glygen.org/publication/PubMed/28380357" } ] }, { "title": "A retrovirus carrying an MDR1 cDNA confers multidrug resistance and polarized expression of P-glycoprotein in MDCK cells.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1988", "authors": "Pastan I, Gottesman MM, Ueda K, Lovelace E, Rutherford AV, Willingham MC", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "2898143", "url": "https://glygen.org/publication/PubMed/2898143" } ] }, { "title": "Correcting CFTR folding defects by small-molecule correctors to cure cystic fibrosis.", "journal": "Current opinion in pharmacology", "date": "2017", "authors": "Mijnders M, Kleizen B, Braakman I", "evidence": [ { "database": "Reactome", "id": "R-HSA-5678895", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5678895" } ], "reference": [ { "type": "PubMed", "id": "29055231", "url": "https://glygen.org/publication/PubMed/29055231" } ] }, { "title": "VCP/p97-Mediated Unfolding as a Principle in Protein Homeostasis and Signaling.", "journal": "Molecular cell", "date": "2018", "authors": "van den Boom J, Meyer H", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "29153394", "url": "https://glygen.org/publication/PubMed/29153394" } ] }, { "title": "Regulation of selective autophagy: the p62/SQSTM1 paradigm.", "journal": "Essays in biochemistry", "date": "2017", "authors": "Lamark T, Svenning S, Johansen T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9755511", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9755511" } ], "reference": [ { "type": "PubMed", "id": "29233872", "url": "https://glygen.org/publication/PubMed/29233872" } ] }, { "title": "NRF2 addiction in cancer cells.", "journal": "Cancer science", "date": "2018", "authors": "Kitamura H, Motohashi H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9755511", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9755511" } ], "reference": [ { "type": "PubMed", "id": "29450944", "url": "https://glygen.org/publication/PubMed/29450944" } ] }, { "title": "The cell surface receptors for interleukin-1 alpha and interleukin-1 beta are identical.", "journal": "Nature", "date": "1986", "authors": "Dower SK, Kronheim SR, Hopp TP, Cantrell M, Deeley M, Gillis S, Henney CS, Urdal DL", "evidence": [ { "database": "Reactome", "id": "R-HSA-9020702", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9020702" } ], "reference": [ { "type": "PubMed", "id": "2946959", "url": "https://glygen.org/publication/PubMed/2946959" } ] }, { "title": "Synergy between the KEAP1/NRF2 and PI3K Pathways Drives Non-Small-Cell Lung Cancer with an Altered Immune Microenvironment.", "journal": "Cell metabolism", "date": "2018", "authors": "Best SA, De Souza DP, Kersbergen A, Policheni AN, Dayalan S, Tull D, Rathi V, Gray DH, Ritchie ME, McConville MJ, Sutherland KD", "evidence": [ { "database": "Reactome", "id": "R-HSA-9755511", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9755511" } ], "reference": [ { "type": "PubMed", "id": "29526543", "url": "https://glygen.org/publication/PubMed/29526543" } ] }, { "title": "The KEAP1-NRF2 System: a Thiol-Based Sensor-Effector Apparatus for Maintaining Redox Homeostasis.", "journal": "Physiological reviews", "date": "2018", "authors": "Yamamoto M, Kensler TW, Motohashi H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9762114", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9762114" } ], "reference": [ { "type": "PubMed", "id": "29717933", "url": "https://glygen.org/publication/PubMed/29717933" } ] }, { "title": "VX-445-Tezacaftor-Ivacaftor in Patients with Cystic Fibrosis and One or Two Phe508del Alleles.", "journal": "The New England journal of medicine", "date": "2018", "authors": "Keating D, Marigowda G, Burr L, Daines C, Mall MA, McKone EF, Ramsey BW, Rowe SM, Sass LA, Tullis E, McKee CM, Moskowitz SM, Robertson S, Savage J, Simard C, Van Goor F, Waltz D, Xuan F, Young T, Taylor-Cousar JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-5678895", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5678895" } ], "reference": [ { "type": "PubMed", "id": "30334692", "url": "https://glygen.org/publication/PubMed/30334692" } ] }, { "title": "VX-659-Tezacaftor-Ivacaftor in Patients with Cystic Fibrosis and One or Two Phe508del Alleles.", "journal": "The New England journal of medicine", "date": "2018", "authors": "Davies JC, Moskowitz SM, Brown C, Horsley A, Mall MA, McKone EF, Plant BJ, Prais D, Ramsey BW, Taylor-Cousar JL, Tullis E, Uluer A, McKee CM, Robertson S, Shilling RA, Simard C, Van Goor F, Waltz D, Xuan F, Young T, Rowe SM", "evidence": [ { "database": "Reactome", "id": "R-HSA-5678895", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5678895" } ], "reference": [ { "type": "PubMed", "id": "30334693", "url": "https://glygen.org/publication/PubMed/30334693" } ] }, { "title": "Therapeutic targeting of the NRF2 and KEAP1 partnership in chronic diseases.", "journal": "Nature reviews. Drug discovery", "date": "2019", "authors": "Cuadrado A, Rojo AI, Wells G, Hayes JD, Cousin SP, Rumsey WL, Attucks OC, Franklin S, Levonen AL, Kensler TW, Dinkova-Kostova AT", "evidence": [ { "database": "Reactome", "id": "R-HSA-9755511", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9755511" } ], "reference": [ { "type": "PubMed", "id": "30610225", "url": "https://glygen.org/publication/PubMed/30610225" } ] }, { "title": "Activation of DNA-binding activity in an apparently cytoplasmic precursor of the NF-kappa B transcription factor.", "journal": "Cell", "date": "1988", "authors": "Baeuerle PA, Baltimore D", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169091", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169091" } ], "reference": [ { "type": "PubMed", "id": "3129195", "url": "https://glygen.org/publication/PubMed/3129195" } ] }, { "title": "Effect of Hepatitis Viruses on the Nrf2/Keap1-Signaling Pathway and Its Impact on Viral Replication and Pathogenesis.", "journal": "International journal of molecular sciences", "date": "2019", "authors": "Bender D, Hildt E", "evidence": [ { "database": "Reactome", "id": "R-HSA-9755511", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9755511" } ], "reference": [ { "type": "PubMed", "id": "31546975", "url": "https://glygen.org/publication/PubMed/31546975" } ] }, { "title": "Efficacy and safety of the elexacaftor plus tezacaftor plus ivacaftor combination regimen in people with cystic fibrosis homozygous for the F508del mutation: a double-blind, randomised, phase 3 trial.", "journal": "Lancet (London, England)", "date": "2019", "authors": "Heijerman HGM, McKone EF, Downey DG, Van Braeckel E, Rowe SM, Tullis E, Mall MA, Welter JJ, Ramsey BW, McKee CM, Marigowda G, Moskowitz SM, Waltz D, Sosnay PR, Simard C, Ahluwalia N, Xuan F, Zhang Y, Taylor-Cousar JL, McCoy KS", "evidence": [ { "database": "Reactome", "id": "R-HSA-5678895", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5678895" } ], "reference": [ { "type": "PubMed", "id": "31679946", "url": "https://glygen.org/publication/PubMed/31679946" } ] }, { "title": "Mitochondrial MUL1 E3 ubiquitin ligase regulates Hypoxia Inducible Factor (HIF-1alpha) and metabolic reprogramming by modulating the UBXN7 cofactor protein.", "journal": "Scientific reports", "date": "2020", "authors": "Cilenti L, Di Gregorio J, Ambivero CT, Andl T, Liao R, Zervos AS", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "32005965", "url": "https://glygen.org/publication/PubMed/32005965" } ] }, { "title": "The Molecular Mechanisms Regulating the KEAP1-NRF2 Pathway.", "journal": "Molecular and cellular biology", "date": "2020", "authors": "Baird L, Yamamoto M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9762114", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9762114" } ], "reference": [ { "type": "PubMed", "id": "32284348", "url": "https://glygen.org/publication/PubMed/32284348" } ] }, { "title": "PERK/NRF2 and autophagy form a resistance mechanism against G9a inhibition in leukemia stem cells.", "journal": "Journal of experimental & clinical cancer research : CR", "date": "2020-04-15", "authors": "Jang Ji Eun, Eom Ju-In, Jeung Hoi-Kyung, Chung Haerim, Kim Yu Ri, Kim Jin Seok, Cheong June-Won, Min Yoo Hong", "evidence": [ { "database": "Reactome", "id": "R-HSA-9755511", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9755511" } ], "reference": [ { "type": "PubMed", "id": "32293500", "url": "https://glygen.org/publication/PubMed/32293500" } ] }, { "title": "NRF2, a Transcription Factor for Stress Response and Beyond.", "journal": "International journal of molecular sciences", "date": "2020", "authors": "He F, Ru X, Wen T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9755511", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9755511" } ], "reference": [ { "type": "PubMed", "id": "32640524", "url": "https://glygen.org/publication/PubMed/32640524" } ] }, { "title": "PSMD11, PTPRM and PTPRB as novel biomarkers of pancreatic cancer progression.", "journal": "Biochimica et biophysica acta. General subjects", "date": "2020", "authors": "Sahni S, Krisp C, Molloy MP, Nahm C, Maloney S, Gillson J, Gill AJ, Samra J, Mittal A", "evidence": [ { "database": "RefSeq", "id": "NP_001257411", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001257411" }, { "database": "GlyGen", "id": "A0197", "url": "https://data.glygen.org/GLY_000625" } ], "reference": [ { "type": "PubMed", "id": "32663515", "url": "https://glygen.org/publication/PubMed/32663515" } ] }, { "title": "Structural insights into the multiple binding modes of Dimethyl Fumarate (DMF) and its analogs to the Kelch domain of Keap1.", "journal": "The FEBS journal", "date": "2021", "authors": "Unni S, Deshmukh P, Krishnappa G, Kommu P, Padmanabhan B", "evidence": [ { "database": "Reactome", "id": "R-HSA-9755511", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9755511" } ], "reference": [ { "type": "PubMed", "id": "32672401", "url": "https://glygen.org/publication/PubMed/32672401" } ] }, { "title": "Tandem Bioorthogonal Labeling Uncovers Endogenous Cotranslationally O-GlcNAc Modified Nascent Proteins.", "journal": "Journal of the American Chemical Society", "date": "2020", "authors": "Zhu Y, Willems LI, Salas D, Cecioni S, Wu WB, Foster LJ, Vocadlo DJ", "evidence": [ { "database": "O-GlcNAc Database", "id": "O00231", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O00231" } ], "reference": [ { "type": "PubMed", "id": "32870666", "url": "https://glygen.org/publication/PubMed/32870666" } ] }, { "title": "Relationship between the Expression Level of PSMD11 and Other Proteasome Proteins with the Activity of Ricin and Viscumin.", "journal": "Doklady. Biochemistry and biophysics", "date": "2020", "authors": "Maltseva DV, Raigorodskaya MP, Tikhonova OV, Knyazev EN, Tonevitsky EA", "evidence": [ { "database": "RefSeq", "id": "NP_001257411", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001257411" } ], "reference": [ { "type": "PubMed", "id": "32894464", "url": "https://glygen.org/publication/PubMed/32894464" } ] }, { "title": "Is the emperor wearing shorts? The published structures of ABC transporters.", "journal": "FEBS letters", "date": "2020", "authors": "Jones PM, George AM", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "32981041", "url": "https://glygen.org/publication/PubMed/32981041" } ] }, { "title": "SARS-CoV2-mediated suppression of NRF2-signaling reveals potent antiviral and anti-inflammatory activity of 4-octyl-itaconate and dimethyl fumarate.", "journal": "Nature communications", "date": "2020", "authors": "Olagnier D, Farahani E, Thyrsted J, Blay-Cadanet J, Herengt A, Idorn M, Hait A, Hernaez B, Knudsen A, Iversen MB, Schilling M, Jorgensen SE, Thomsen M, Reinert LS, Lappe M, Hoang HD, Gilchrist VH, Hansen AL, Ottosen R, Nielsen CG, Moller C, van der Horst D, Peri S, Balachandran S, Huang J, Jakobsen M, Svenningsen EB, Poulsen TB, Bartsch L, Thielke AL, Luo Y, Alain T, Rehwinkel J, Alcami A, Hiscott J, Mogensen TH, Paludan SR, Holm CK", "evidence": [ { "database": "Reactome", "id": "R-HSA-9755511", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9755511" } ], "reference": [ { "type": "PubMed", "id": "33009401", "url": "https://glygen.org/publication/PubMed/33009401" } ] }, { "title": "Proteomic profiling and genome-wide mapping of O-GlcNAc chromatin-associated proteins reveal an O-GlcNAc-regulated genotoxic stress response.", "journal": "Nature communications", "date": "2020", "authors": "Liu Y, Chen Q, Zhang N, Zhang K, Dou T, Cao Y, Liu Y, Li K, Hao X, Xie X, Li W, Ren Y, Zhang J", "evidence": [ { "database": "O-GlcNAc Database", "id": "O00231", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O00231" } ], "reference": [ { "type": "PubMed", "id": "33214551", "url": "https://glygen.org/publication/PubMed/33214551" } ] }, { "title": "UBXN7 cofactor of CRL3(KEAP1) and CRL2(VHL) ubiquitin ligase complexes mediates reciprocal regulation of NRF2 and HIF-1alpha proteins.", "journal": "Biochimica et biophysica acta. Molecular cell research", "date": "2021", "authors": "Di Gregorio J, Cilenti L, Ambivero CT, Andl T, Liao R, Zervos AS", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "33444648", "url": "https://glygen.org/publication/PubMed/33444648" } ] }, { "title": "Prognostic Value and Molecular Mechanisms of Proteasome 26S Subunit, Non-ATPase Family Genes for Pancreatic Ductal Adenocarcinoma Patients after Pancreaticoduodenectomy.", "journal": "Journal of investigative surgery : the official journal of the Academy of Surgical Research", "date": "2022", "authors": "Zhou C, Li H, Han X, Pang H, Wu M, Tang Y, Luo X", "evidence": [ { "database": "RefSeq", "id": "NP_001257411", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001257411" } ], "reference": [ { "type": "PubMed", "id": "33525943", "url": "https://glygen.org/publication/PubMed/33525943" } ] }, { "title": "Sulforaphane exhibits in vitro and in vivo antiviral activity against pandemic SARS-CoV-2 and seasonal HCoV-OC43 coronaviruses.", "journal": "bioRxiv : the preprint server for biology", "date": "2021", "authors": "Ordonez AA, Bullen CK, Villabona-Rueda AF, Thompson EA, Turner ML, Davis SL, Komm O, Powell JD, D'Alessio FR, Yolken RH, Jain SK, Jones-Brando L", "evidence": [ { "database": "Reactome", "id": "R-HSA-9755511", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9755511" } ], "reference": [ { "type": "PubMed", "id": "33791708", "url": "https://glygen.org/publication/PubMed/33791708" } ] }, { "title": "c-MYC-directed NRF2 drives malignant progression of head and neck cancer via glucose-6-phosphate dehydrogenase and transketolase activation.", "journal": "Theranostics", "date": "2021", "authors": "Tang YC, Hsiao JR, Jiang SS, Chang JY, Chu PY, Liu KJ, Fang HL, Lin LM, Chen HH, Huang YW, Chen YT, Tsai FY, Lin SF, Chuang YJ, Kuo CC", "evidence": [ { "database": "Reactome", "id": "R-HSA-9755511", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9755511" } ], "reference": [ { "type": "PubMed", "id": "33859744", "url": "https://glygen.org/publication/PubMed/33859744" } ] }, { "title": "O-GlcNAc modification regulates MTA1 transcriptional activity during breast cancer cell genotoxic adaptation.", "journal": "Biochimica et biophysica acta. General subjects", "date": "2021", "authors": "Xie X, Wu Q, Zhang K, Liu Y, Zhang N, Chen Q, Wang L, Li W, Zhang J, Liu Y", "evidence": [ { "database": "O-GlcNAc Database", "id": "O00231", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O00231" } ], "reference": [ { "type": "PubMed", "id": "34019948", "url": "https://glygen.org/publication/PubMed/34019948" } ] }, { "title": "Human multidrug-resistant cell lines: increased mdr1 expression can precede gene amplification.", "journal": "Science (New York, N.Y.)", "date": "1986", "authors": "Shen DW, Fojo A, Chin JE, Roninson IB, Richert N, Pastan I, Gottesman MM", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "3457471", "url": "https://glygen.org/publication/PubMed/3457471" } ] }, { "title": "Expression of a full-length cDNA for the human `MDR1` gene confers resistance to colchicine, doxorubicin, and vinblastine.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1987", "authors": "Ueda K, Cardarelli C, Gottesman MM, Pastan I", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "3472246", "url": "https://glygen.org/publication/PubMed/3472246" } ] }, { "title": "Truncation of the TPR domain of OGT alters substrate and glycosite selection.", "journal": "Analytical and bioanalytical chemistry", "date": "2021", "authors": "Ramirez DH, Yang B, D'Souza AK, Shen D, Woo CM", "evidence": [ { "database": "O-GlcNAc Database", "id": "O00231", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O00231" } ], "reference": [ { "type": "PubMed", "id": "34725712", "url": "https://glygen.org/publication/PubMed/34725712" } ] }, { "title": "Spatiotemporal Activation of Protein O-GlcNAcylation in Living Cells.", "journal": "Journal of the American Chemical Society", "date": "2022", "authors": "He J, Fan Z, Tian Y, Yang W, Zhou Y, Zhu Q, Zhang W, Qin W, Yi W", "evidence": [ { "database": "O-GlcNAc Database", "id": "O00231", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O00231" } ], "reference": [ { "type": "PubMed", "id": "35138101", "url": "https://glygen.org/publication/PubMed/35138101" } ] }, { "title": "PSMD11 modulates circadian clock function through PER and CRY nuclear translocation.", "journal": "PloS one", "date": "2023", "authors": "Cal-Kayitmazbatir Sibel, Francey Lauren J, Lee Yool, Liu Andrew C, Hogenesch John B", "evidence": [ { "database": "RefSeq", "id": "NP_001257411", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001257411" } ], "reference": [ { "type": "PubMed", "id": "36961772", "url": "https://glygen.org/publication/PubMed/36961772" } ] }, { "title": "Stimulation-dependent I kappa B alpha phosphorylation marks the NF-kappa B inhibitor for degradation via the ubiquitin-proteasome pathway.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1995", "authors": "Alkalay I, Yaron A, Hatzubai A, Orian A, Ciechanover A, Ben-Neriah Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169091", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169091" } ], "reference": [ { "type": "PubMed", "id": "7479848", "url": "https://glygen.org/publication/PubMed/7479848" } ] }, { "title": "Signal-induced degradation of I kappa B alpha requires site-specific ubiquitination.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1995", "authors": "Scherer DC, Brockman JA, Chen Z, Maniatis T, Ballard DW", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169091", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169091" } ], "reference": [ { "type": "PubMed", "id": "7479976", "url": "https://glygen.org/publication/PubMed/7479976" } ] }, { "title": "Protein kinase C: structure, function, and regulation.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Newton AC", "evidence": [ { "database": "Reactome", "id": "R-HSA-5607764", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5607764" } ], "reference": [ { "type": "PubMed", "id": "7499357", "url": "https://glygen.org/publication/PubMed/7499357" } ] }, { "title": "Intracellular turnover of cystic fibrosis transmembrane conductance regulator. Inefficient processing and rapid degradation of wild-type and mutant proteins.", "journal": "The Journal of biological chemistry", "date": "1994", "authors": "Ward CL, Kopito RR", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "7523390", "url": "https://glygen.org/publication/PubMed/7523390" } ] }, { "title": "Conformational maturation of CFTR but not its mutant counterpart (delta F508) occurs in the endoplasmic reticulum and requires ATP.", "journal": "The EMBO journal", "date": "1994", "authors": "Lukacs GL, Mohamed A, Kartner N, Chang XB, Riordan JR, Grinstein S", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "7529176", "url": "https://glygen.org/publication/PubMed/7529176" } ] }, { "title": "TRAF2-mediated activation of NF-kappa B by TNF receptor 2 and CD40.", "journal": "Science (New York, N.Y.)", "date": "1995", "authors": "Rothe M, Sarma V, Dixit VM, Goeddel DV", "evidence": [ { "database": "Reactome", "id": "R-HSA-5668541", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5668541" } ], "reference": [ { "type": "PubMed", "id": "7544915", "url": "https://glygen.org/publication/PubMed/7544915" } ] }, { "title": "Degradation of CFTR by the ubiquitin-proteasome pathway.", "journal": "Cell", "date": "1995", "authors": "Ward CL, Omura S, Kopito RR", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "7553863", "url": "https://glygen.org/publication/PubMed/7553863" } ] }, { "title": "Multiple proteolytic systems, including the proteasome, contribute to CFTR processing.", "journal": "Cell", "date": "1995", "authors": "Jensen TJ, Loo MA, Pind S, Williams DB, Goldberg AL, Riordan JR", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "7553864", "url": "https://glygen.org/publication/PubMed/7553864" } ] }, { "title": "Molecular cloning of a new member of the p21-Cdc42/Rac-activated kinase (PAK) family.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Manser E, Chong C, Zhao ZS, Leung T, Michael G, Hall C, Lim L", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "7559638", "url": "https://glygen.org/publication/PubMed/7559638" } ] }, { "title": "Inactivation of NF-kappa B inhibitor I kappa B alpha: ubiquitin-dependent proteolysis and its degradation product.", "journal": "Biochemical and biophysical research communications", "date": "1995", "authors": "Li CC, Dai RM, Longo DL", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169091", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169091" } ], "reference": [ { "type": "PubMed", "id": "7575604", "url": "https://glygen.org/publication/PubMed/7575604" } ] }, { "title": "Metabolism of the polyubiquitin degradation signal: structure, mechanism, and role of isopeptidase T.", "journal": "Biochemistry", "date": "1995", "authors": "Wilkinson KD, Tashayev VL, O'Connor LB, Larsen CN, Kasperek E, Pickart CM", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880" } ], "reference": [ { "type": "PubMed", "id": "7578059", "url": "https://glygen.org/publication/PubMed/7578059" } ] }, { "title": "Significance of PIP2 hydrolysis and regulation of phospholipase C isozymes.", "journal": "Current opinion in cell biology", "date": "1995", "authors": "Lee SB, Rhee SG", "evidence": [ { "database": "Reactome", "id": "R-HSA-5607764", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5607764" } ], "reference": [ { "type": "PubMed", "id": "7612269", "url": "https://glygen.org/publication/PubMed/7612269" } ] }, { "title": "Signal-induced site-specific phosphorylation targets I kappa B alpha to the ubiquitin-proteasome pathway.", "journal": "Genes & development", "date": "1995", "authors": "Chen Z, Hagler J, Palombella VJ, Melandri F, Scherer D, Ballard D, Maniatis T", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169091", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169091" } ], "reference": [ { "type": "PubMed", "id": "7628694", "url": "https://glygen.org/publication/PubMed/7628694" } ] }, { "title": "Association of a RING finger protein with the cytoplasmic domain of the human type-2 tumour necrosis factor receptor.", "journal": "The Biochemical journal", "date": "1995", "authors": "Song HY, Donner DB", "evidence": [ { "database": "Reactome", "id": "R-HSA-5668541", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5668541" } ], "reference": [ { "type": "PubMed", "id": "7639698", "url": "https://glygen.org/publication/PubMed/7639698" } ] }, { "title": "Modulation of cellular thermoresistance and actin filament stability accompanies phosphorylation-induced changes in the oligomeric structure of heat shock protein 27.", "journal": "Molecular and cellular biology", "date": "1995", "authors": "Lavoie JN, Lambert H, Hickey E, Weber LA, Landry J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "7799959", "url": "https://glygen.org/publication/PubMed/7799959" } ] }, { "title": "Tumor necrosis factor alpha-induced phosphorylation of I kappa B alpha is a signal for its degradation but not dissociation from NF-kappa B.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1994", "authors": "Miyamoto S, Maki M, Schmitt MJ, Hatanaka M, Verma IM", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169091", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169091" } ], "reference": [ { "type": "PubMed", "id": "7809113", "url": "https://glygen.org/publication/PubMed/7809113" } ] }, { "title": "Molecular cloning and sequencing of a human cDNA encoding ornithine decarboxylase antizyme.", "journal": "Biochimica et biophysica acta", "date": "1994", "authors": "Tewari DS, Qian Y, Thornton RD, Pieringer J, Taub R, Mochan E, Tewari M", "evidence": [ { "database": "Reactome", "id": "R-HSA-350562", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-350562" } ], "reference": [ { "type": "PubMed", "id": "7811704", "url": "https://glygen.org/publication/PubMed/7811704" } ] }, { "title": "Activation of NF-kappa B requires proteolysis of the inhibitor I kappa B-alpha: signal-induced phosphorylation of I kappa B-alpha alone does not release active NF-kappa B.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1995", "authors": "Lin YC, Brown K, Siebenlist U", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169091", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169091" } ], "reference": [ { "type": "PubMed", "id": "7831327", "url": "https://glygen.org/publication/PubMed/7831327" } ] }, { "title": "Phosphorylation of I kappa B alpha precedes but is not sufficient for its dissociation from NF-kappa B.", "journal": "Molecular and cellular biology", "date": "1995", "authors": "DiDonato JA, Mercurio F, Karin M", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169091", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169091" } ], "reference": [ { "type": "PubMed", "id": "7862124", "url": "https://glygen.org/publication/PubMed/7862124" } ] }, { "title": "P-glycoprotein mediates profound resistance to bisantrene.", "journal": "Oncology research", "date": "1994", "authors": "Zhang XP, Ritke MK, Yalowich JC, Slovak ML, Ho JP, Collins KI, Annable T, Arceci RJ, Durr FE, Greenberger LM", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "7865904", "url": "https://glygen.org/publication/PubMed/7865904" } ] }, { "title": "The product of hedgehog autoproteolytic cleavage active in local and long-range signalling.", "journal": "Nature", "date": "1995", "authors": "Porter JA, von Kessler DP, Ekker SC, Young KE, Lee JJ, Moses K, Beachy PA", "evidence": [ { "database": "Reactome", "id": "R-HSA-5358346", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5358346" } ], "reference": [ { "type": "PubMed", "id": "7885476", "url": "https://glygen.org/publication/PubMed/7885476" } ] }, { "title": "A proteasome inhibitor prevents activation of NF-kappa B and stabilizes a newly phosphorylated form of I kappa B-alpha that is still bound to NF-kappa B.", "journal": "The EMBO journal", "date": "1994", "authors": "Traenckner EB, Wilk S, Baeuerle PA", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169091", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169091" } ], "reference": [ { "type": "PubMed", "id": "7957109", "url": "https://glygen.org/publication/PubMed/7957109" } ] }, { "title": "Autoproteolysis in hedgehog protein biogenesis.", "journal": "Science (New York, N.Y.)", "date": "1994", "authors": "Lee JJ, Ekker SC, von Kessler DP, Porter JA, Sun BI, Beachy PA", "evidence": [ { "database": "Reactome", "id": "R-HSA-5358346", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5358346" } ], "reference": [ { "type": "PubMed", "id": "7985023", "url": "https://glygen.org/publication/PubMed/7985023" } ] }, { "title": "A brain serine/threonine protein kinase activated by Cdc42 and Rac1.", "journal": "Nature", "date": "1994", "authors": "Manser E, Leung T, Salihuddin H, Zhao ZS, Lim L", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "8107774", "url": "https://glygen.org/publication/PubMed/8107774" } ] }, { "title": "Interleukin 1 signaling occurs exclusively via the type I receptor.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1993", "authors": "Sims JE, Gayle MA, Slack JL, Alderson MR, Bird TA, Giri JG, Colotta F, Re F, Mantovani A, Shanebeck K, et al.", "evidence": [ { "database": "Reactome", "id": "R-HSA-9020702", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9020702" } ], "reference": [ { "type": "PubMed", "id": "8327496", "url": "https://glygen.org/publication/PubMed/8327496" } ] }, { "title": "Interleukin-1 type II receptor: a decoy target for IL-1 that is regulated by IL-4.", "journal": "Science (New York, N.Y.)", "date": "1993", "authors": "Colotta F, Re F, Muzio M, Bertini R, Polentarutti N, Sironi M, Giri JG, Dower SK, Sims JE, Mantovani A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9020702", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9020702" } ], "reference": [ { "type": "PubMed", "id": "8332913", "url": "https://glygen.org/publication/PubMed/8332913" } ] }, { "title": "Activation of purified human protein kinase C alpha and beta I isoenzymes in vitro by Ca2+, phosphatidylinositol and phosphatidylinositol 4,5-bisphosphate.", "journal": "The Biochemical journal", "date": "1993", "authors": "Kochs G, Hummel R, Fiebich B, Sarre TF, Marme D, Hug H", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169091", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169091" } ], "reference": [ { "type": "PubMed", "id": "8387275", "url": "https://glygen.org/publication/PubMed/8387275" } ] }, { "title": "The transmembrane form of tumor necrosis factor is the prime activating ligand of the 80 kDa tumor necrosis factor receptor.", "journal": "Cell", "date": "1995", "authors": "Grell M, Douni E, Wajant H, Lohden M, Clauss M, Maxeiner B, Georgopoulos S, Lesslauer W, Kollias G, Pfizenmaier K, Scheurich P", "evidence": [ { "database": "Reactome", "id": "R-HSA-5668541", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5668541" } ], "reference": [ { "type": "PubMed", "id": "8521496", "url": "https://glygen.org/publication/PubMed/8521496" } ] }, { "title": "Critical role for lysines 21 and 22 in signal-induced, ubiquitin-mediated proteolysis of I kappa B-alpha.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Baldi L, Brown K, Franzoso G, Siebenlist U", "evidence": [ { "database": "Reactome", "id": "R-HSA-202424", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202424" } ], "reference": [ { "type": "PubMed", "id": "8550590", "url": "https://glygen.org/publication/PubMed/8550590" } ] }, { "title": "Loss of NF1 results in activation of the Ras signaling pathway and leads to aberrant growth in haematopoietic cells.", "journal": "Nature genetics", "date": "1996", "authors": "Bollag G, Clapp DW, Shih S, Adler F, Zhang YY, Thompson P, Lange BJ, Freedman MH, McCormick F, Jacks T, Shannon K", "evidence": [ { "database": "Reactome", "id": "R-HSA-5658442", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5658442" } ], "reference": [ { "type": "PubMed", "id": "8563751", "url": "https://glygen.org/publication/PubMed/8563751" } ] }, { "title": "IRAK: a kinase associated with the interleukin-1 receptor.", "journal": "Science (New York, N.Y.)", "date": "1996", "authors": "Cao Z, Henzel WJ, Gao X", "evidence": [ { "database": "Reactome", "id": "R-HSA-9020702", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9020702" } ], "reference": [ { "type": "PubMed", "id": "8599092", "url": "https://glygen.org/publication/PubMed/8599092" } ] }, { "title": "Site-specific phosphorylation of IkappaBalpha by a novel ubiquitination-dependent protein kinase activity.", "journal": "Cell", "date": "1996", "authors": "Chen ZJ, Parent L, Maniatis T", "evidence": [ { "database": "Reactome", "id": "R-HSA-202424", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202424" } ], "reference": [ { "type": "PubMed", "id": "8601309", "url": "https://glygen.org/publication/PubMed/8601309" } ] }, { "title": "Immunodeficiency in protein kinase cbeta-deficient mice.", "journal": "Science (New York, N.Y.)", "date": "1996", "authors": "Leitges M, Schmedt C, Guinamard R, Davoust J, Schaal S, Stabel S, Tarakhovsky A", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169091", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169091" } ], "reference": [ { "type": "PubMed", "id": "8670417", "url": "https://glygen.org/publication/PubMed/8670417" } ] }, { "title": "Hedgehog patterning activity: role of a lipophilic modification mediated by the carboxy-terminal autoprocessing domain.", "journal": "Cell", "date": "1996", "authors": "Porter JA, Ekker SC, Park WJ, von Kessler DP, Young KE, Chen CH, Ma Y, Woods AS, Cotter RJ, Koonin EV, Beachy PA", "evidence": [ { "database": "Reactome", "id": "R-HSA-5358346", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5358346" } ], "reference": [ { "type": "PubMed", "id": "8689684", "url": "https://glygen.org/publication/PubMed/8689684" } ] }, { "title": "Targeting of proteins to granule subsets is determined by timing and not by sorting: The specific granule protein NGAL is localized to azurophil granules when expressed in HL-60 cells.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1996", "authors": "Le Cabec V, Cowland JB, Calafat J, Borregaard N", "evidence": [ { "database": "Reactome", "id": "R-HSA-6798695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6798695" } ], "reference": [ { "type": "PubMed", "id": "8692836", "url": "https://glygen.org/publication/PubMed/8692836" } ] }, { "title": "Anatomy of TRAF2. Distinct domains for nuclear factor-kappaB activation and association with tumor necrosis factor signaling proteins.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Takeuchi M, Rothe M, Goeddel DV", "evidence": [ { "database": "Reactome", "id": "R-HSA-5668541", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5668541" } ], "reference": [ { "type": "PubMed", "id": "8702708", "url": "https://glygen.org/publication/PubMed/8702708" } ] }, { "title": "SKP1 connects cell cycle regulators to the ubiquitin proteolysis machinery through a novel motif, the F-box.", "journal": "Cell", "date": "1996", "authors": "Bai C, Sen P, Hofmann K, Ma L, Goebl M, Harper JW, Elledge SJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5607761", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5607761" } ], "reference": [ { "type": "PubMed", "id": "8706131", "url": "https://glygen.org/publication/PubMed/8706131" } ] }, { "title": "Cholesterol modification of hedgehog signaling proteins in animal development.", "journal": "Science (New York, N.Y.)", "date": "1996", "authors": "Porter JA, Young KE, Beachy PA", "evidence": [ { "database": "Reactome", "id": "R-HSA-5358346", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5358346" } ], "reference": [ { "type": "PubMed", "id": "8824192", "url": "https://glygen.org/publication/PubMed/8824192" } ] }, { "title": "TRAF6 is a signal transducer for interleukin-1.", "journal": "Nature", "date": "1996", "authors": "Cao Z, Xiong J, Takeuchi M, Kurama T, Goeddel DV", "evidence": [ { "database": "Reactome", "id": "R-HSA-9020702", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9020702" } ], "reference": [ { "type": "PubMed", "id": "8837778", "url": "https://glygen.org/publication/PubMed/8837778" } ] }, { "title": "Identification of Sonic hedgehog as a candidate gene responsible for holoprosencephaly.", "journal": "Nature genetics", "date": "1996", "authors": "Belloni E, Muenke M, Roessler E, Traverso G, Siegel-Bartelt J, Frumkin A, Mitchell HF, Donis-Keller H, Helms C, Hing AV, Heng HH, Koop B, Martindale D, Rommens JM, Tsui LC, Scherer SW", "evidence": [ { "database": "Reactome", "id": "R-HSA-5362768", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5362768" } ], "reference": [ { "type": "PubMed", "id": "8896571", "url": "https://glygen.org/publication/PubMed/8896571" } ] }, { "title": "Differential nuclear localization of p50, p52, and RelB proteins in human accessory cells of the immune response in situ.", "journal": "European journal of immunology", "date": "1996", "authors": "Feuillard J, Korner M, Israel A, Vassy J, Raphael M", "evidence": [ { "database": "Reactome", "id": "R-HSA-5607761", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5607761" } ], "reference": [ { "type": "PubMed", "id": "8921937", "url": "https://glygen.org/publication/PubMed/8921937" } ] }, { "title": "Tyrosine phosphorylation and translocation of phospholipase C-gamma 2 in polymorphonuclear leukocytes treated with pervanadate.", "journal": "Biochimica et biophysica acta", "date": "1996", "authors": "Kawakami N, Shimohama S, Hayakawa T, Sumida Y, Fujimoto S", "evidence": [ { "database": "Reactome", "id": "R-HSA-5607764", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5607764" } ], "reference": [ { "type": "PubMed", "id": "8972730", "url": "https://glygen.org/publication/PubMed/8972730" } ] }, { "title": "Molecular cloning and expression of subunit 9 of the 26S proteasome.", "journal": "FEBS Lett.", "date": "1997", "authors": "Hoffman L, Rechsteiner M", "evidence": [ { "database": "UniProtKB", "id": "O00231", "url": "https://www.uniprot.org/uniprot/O00231" } ], "reference": [ { "type": "PubMed", "id": "9119060", "url": "https://glygen.org/publication/PubMed/9119060" } ] }, { "title": "The von Hippel-Lindau tumor-suppressor gene product forms a stable complex with human CUL-2, a member of the Cdc53 family of proteins.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1997", "authors": "Pause A, Lee S, Worrell RA, Chen DY, Burgess WH, Linehan WM, Klausner RD", "evidence": [ { "database": "Reactome", "id": "R-HSA-1234176", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1234176" } ], "reference": [ { "type": "PubMed", "id": "9122164", "url": "https://glygen.org/publication/PubMed/9122164" } ] }, { "title": "Molcecular cloning of human antizyme cDNA.", "journal": "Biochemistry and molecular biology international", "date": "1996", "authors": "Yang D, Takii T, Hayashi H, Itoh S, Hayashi M, Onozaki K", "evidence": [ { "database": "Reactome", "id": "R-HSA-350562", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-350562" } ], "reference": [ { "type": "PubMed", "id": "9132164", "url": "https://glygen.org/publication/PubMed/9132164" } ] }, { "title": "I kappa B epsilon, a novel member of the I kappa B family, controls RelA and cRel NF-kappa B activity.", "journal": "The EMBO journal", "date": "1997", "authors": "Whiteside ST, Epinat JC, Rice NR, Israel A", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169091", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169091" } ], "reference": [ { "type": "PubMed", "id": "9135156", "url": "https://glygen.org/publication/PubMed/9135156" } ] }, { "title": "Inhibition of cyclin D1 phosphorylation on threonine-286 prevents its rapid degradation via the ubiquitin-proteasome pathway.", "journal": "Genes & development", "date": "1997", "authors": "Diehl JA, Zindy F, Sherr CJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-75815", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75815" } ], "reference": [ { "type": "PubMed", "id": "9136925", "url": "https://glygen.org/publication/PubMed/9136925" } ] }, { "title": "The Ras-RasGAP complex: structural basis for GTPase activation and its loss in oncogenic Ras mutants.", "journal": "Science (New York, N.Y.)", "date": "1997", "authors": "Scheffzek K, Ahmadian MR, Kabsch W, Wiesmuller L, Lautwein A, Schmitz F, Wittinghofer A", "evidence": [ { "database": "Reactome", "id": "R-HSA-5658442", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5658442" } ], "reference": [ { "type": "PubMed", "id": "9219684", "url": "https://glygen.org/publication/PubMed/9219684" } ] }, { "title": "The mouse Fused locus encodes Axin, an inhibitor of the Wnt signaling pathway that regulates embryonic axis formation.", "journal": "Cell", "date": "1997", "authors": "Zeng L, Fagotto F, Zhang T, Hsu W, Vasicek TJ, Perry WL 3rd, Lee JJ, Tilghman SM, Gumbiner BM, Costantini F", "evidence": [ { "database": "Reactome", "id": "R-HSA-195253", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-195253" } ], "reference": [ { "type": "PubMed", "id": "9230313", "url": "https://glygen.org/publication/PubMed/9230313" } ] }, { "title": "Crucial role of tumor necrosis factor (TNF) receptor 2 and membrane-bound TNF in experimental cerebral malaria.", "journal": "European journal of immunology", "date": "1997", "authors": "Lucas R, Juillard P, Decoster E, Redard M, Burger D, Donati Y, Giroud C, Monso-Hinard C, De Kesel T, Buurman WA, Moore MW, Dayer JM, Fiers W, Bluethmann H, Grau GE", "evidence": [ { "database": "Reactome", "id": "R-HSA-5668541", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5668541" } ], "reference": [ { "type": "PubMed", "id": "9247583", "url": "https://glygen.org/publication/PubMed/9247583" } ] }, { "title": "A cytokine-responsive IkappaB kinase that activates the transcription factor NF-kappaB.", "journal": "Nature", "date": "1997", "authors": "DiDonato JA, Hayakawa M, Rothwarf DM, Zandi E, Karin M", "evidence": [ { "database": "Reactome", "id": "R-HSA-202424", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202424" } ], "reference": [ { "type": "PubMed", "id": "9252186", "url": "https://glygen.org/publication/PubMed/9252186" } ] }, { "title": "Confirmation of the arginine-finger hypothesis for the GAP-stimulated GTP-hydrolysis reaction of Ras.", "journal": "Nature structural biology", "date": "1997", "authors": "Ahmadian MR, Stege P, Scheffzek K, Wittinghofer A", "evidence": [ { "database": "Reactome", "id": "R-HSA-5658442", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5658442" } ], "reference": [ { "type": "PubMed", "id": "9302992", "url": "https://glygen.org/publication/PubMed/9302992" } ] }, { "title": "A new member of the I kappaB protein family, I kappaB epsilon, inhibits RelA (p65)-mediated NF-kappaB transcription.", "journal": "Molecular and cellular biology", "date": "1997", "authors": "Li Z, Nabel GJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169091", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169091" } ], "reference": [ { "type": "PubMed", "id": "9315679", "url": "https://glygen.org/publication/PubMed/9315679" } ] }, { "title": "F-box proteins are receptors that recruit phosphorylated substrates to the SCF ubiquitin-ligase complex.", "journal": "Cell", "date": "1997", "authors": "Skowyra D, Craig KL, Tyers M, Elledge SJ, Harper JW", "evidence": [ { "database": "Reactome", "id": "R-HSA-5607761", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5607761" } ], "reference": [ { "type": "PubMed", "id": "9346238", "url": "https://glygen.org/publication/PubMed/9346238" } ] }, { "title": "IKK-1 and IKK-2: cytokine-activated IkappaB kinases essential for NF-kappaB activation.", "journal": "Science (New York, N.Y.)", "date": "1997", "authors": "Mercurio F, Zhu H, Murray BW, Shevchenko A, Bennett BL, Li J, Young DB, Barbosa M, Mann M, Manning A, Rao A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9020702", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9020702" } ], "reference": [ { "type": "PubMed", "id": "9346484", "url": "https://glygen.org/publication/PubMed/9346484" } ] }, { "title": "Cloning and sequencing of a human cDNA encoding ornithine decarboxylase antizyme inhibitor.", "journal": "Biochimica et biophysica acta", "date": "1997", "authors": "Koguchi K, Kobayashi S, Hayashi T, Matsufuji S, Murakami Y, Hayashi S", "evidence": [ { "database": "Reactome", "id": "R-HSA-350562", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-350562" } ], "reference": [ { "type": "PubMed", "id": "9349715", "url": "https://glygen.org/publication/PubMed/9349715" } ] }, { "title": "The carboxy-terminus of I kappaB alpha determines susceptibility to degradation by the catalytic core of the proteasome.", "journal": "Oncogene", "date": "1997", "authors": "Kroll M, Conconi M, Desterro MJ, Marin A, Thomas D, Friguet B, Hay RT, Virelizier JL, Arenzana-Seisdedos F, Rodriguez MS", "evidence": [ { "database": "Reactome", "id": "R-HSA-202424", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202424" } ], "reference": [ { "type": "PubMed", "id": "9362451", "url": "https://glygen.org/publication/PubMed/9362451" } ] }, { "title": "Recruitment of IRAK to the interleukin 1 receptor complex requires interleukin 1 receptor accessory protein.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1997", "authors": "Huang J, Gao X, Li S, Cao Z", "evidence": [ { "database": "Reactome", "id": "R-HSA-9020702", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9020702" } ], "reference": [ { "type": "PubMed", "id": "9371760", "url": "https://glygen.org/publication/PubMed/9371760" } ] }, { "title": "A dominant-negative cyclin D1 mutant prevents nuclear import of cyclin-dependent kinase 4 (CDK4) and its phosphorylation by CDK-activating kinase.", "journal": "Molecular and cellular biology", "date": "1997", "authors": "Diehl JA, Sherr CJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-75815", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75815" } ], "reference": [ { "type": "PubMed", "id": "9372967", "url": "https://glygen.org/publication/PubMed/9372967" } ] }, { "title": "Two distinct proteolytic processes in the generation of a major histocompatibility complex class I-presented peptide.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1997", "authors": "Craiu A, Akopian T, Goldberg A, Rock KL", "evidence": [ { "database": "Reactome", "id": "R-HSA-983168", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983168" } ], "reference": [ { "type": "PubMed", "id": "9380723", "url": "https://glygen.org/publication/PubMed/9380723" } ] }, { "title": "cDNA cloning and functional analysis of p44.5 and p55, two regulatory subunits of the 26S proteasome.", "journal": "Gene", "date": "1997", "authors": "Saito A, Watanabe TK, Shimada Y, Fujiwara T, Slaughter CA, DeMartino GN, Tanahashi N, Tanaka K", "evidence": [ { "database": "UniProtKB", "id": "O00231", "url": "https://www.uniprot.org/uniprot/O00231" } ], "reference": [ { "type": "PubMed", "id": "9426256", "url": "https://glygen.org/publication/PubMed/9426256" } ] }, { "title": "MyD88: an adapter that recruits IRAK to the IL-1 receptor complex.", "journal": "Immunity", "date": "1997", "authors": "Wesche H, Henzel WJ, Shillinglaw W, Li S, Cao Z", "evidence": [ { "database": "Reactome", "id": "R-HSA-9020702", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9020702" } ], "reference": [ { "type": "PubMed", "id": "9430229", "url": "https://glygen.org/publication/PubMed/9430229" } ] }, { "title": "Axin, a negative regulator of the Wnt signaling pathway, forms a complex with GSK-3beta and beta-catenin and promotes GSK-3beta-dependent phosphorylation of beta-catenin.", "journal": "The EMBO journal", "date": "1998", "authors": "Ikeda S, Kishida S, Yamamoto H, Murai H, Koyama S, Kikuchi A", "evidence": [ { "database": "Reactome", "id": "R-HSA-195253", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-195253" } ], "reference": [ { "type": "PubMed", "id": "9482734", "url": "https://glygen.org/publication/PubMed/9482734" } ] }, { "title": "NF-kappaB-inducing kinase activates IKK-alpha by phosphorylation of Ser-176.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1998", "authors": "Ling L, Cao Z, Goeddel DV", "evidence": [ { "database": "Reactome", "id": "R-HSA-5607761", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5607761" } ], "reference": [ { "type": "PubMed", "id": "9520446", "url": "https://glygen.org/publication/PubMed/9520446" } ] }, { "title": "BAP1: a novel ubiquitin hydrolase which binds to the BRCA1 RING finger and enhances BRCA1-mediated cell growth suppression.", "journal": "Oncogene", "date": "1998", "authors": "Jensen DE, Proctor M, Marquis ST, Gardner HP, Ha SI, Chodosh LA, Ishov AM, Tommerup N, Vissing H, Sekido Y, Minna J, Borodovsky A, Schultz DC, Wilkinson KD, Maul GG, Barlev N, Berger SL, Prendergast GC, Rauscher FJ 3rd", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689603", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689603" } ], "reference": [ { "type": "PubMed", "id": "9528852", "url": "https://glygen.org/publication/PubMed/9528852" } ] }, { "title": "Interaction of Rac1 with GTPase-activating proteins and putative effectors. A comparison with Cdc42 and RhoA.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Zhang B, Chernoff J, Zheng Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "9535855", "url": "https://glygen.org/publication/PubMed/9535855" } ] }, { "title": "Identification of a palmitic acid-modified form of human Sonic hedgehog.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Pepinsky RB, Zeng C, Wen D, Rayhorn P, Baker DP, Williams KP, Bixler SA, Ambrose CM, Garber EA, Miatkowski K, Taylor FR, Wang EA, Galdes A", "evidence": [ { "database": "Reactome", "id": "R-HSA-5358346", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5358346" } ], "reference": [ { "type": "PubMed", "id": "9593755", "url": "https://glygen.org/publication/PubMed/9593755" } ] }, { "title": "Suppressor of fused links fused and Cubitus interruptus on the hedgehog signalling pathway.", "journal": "Current biology : CB", "date": "1998", "authors": "Monnier V, Dussillol F, Alves G, Lamour-Isnard C, Plessis A", "evidence": [ { "database": "Reactome", "id": "R-HSA-5632684", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5632684" } ], "reference": [ { "type": "PubMed", "id": "9601642", "url": "https://glygen.org/publication/PubMed/9601642" } ] }, { "title": "PRAK, a novel protein kinase regulated by the p38 MAP kinase.", "journal": "The EMBO journal", "date": "1998", "authors": "New L, Jiang Y, Zhao M, Liu K, Zhu W, Flood LJ, Kato Y, Parry GC, Han J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "9628874", "url": "https://glygen.org/publication/PubMed/9628874" } ] }, { "title": "Geminin, an inhibitor of DNA replication, is degraded during mitosis.", "journal": "Cell", "date": "1998", "authors": "McGarry TJ, Kirschner MW", "evidence": [ { "database": "Reactome", "id": "R-HSA-68867", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-68867" } ], "reference": [ { "type": "PubMed", "id": "9635433", "url": "https://glygen.org/publication/PubMed/9635433" } ] }, { "title": "Stoichiometry of coupling of rhodamine 123 transport to ATP hydrolysis by P-glycoprotein.", "journal": "European journal of biochemistry", "date": "1998", "authors": "Shapiro AB, Ling V", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "9652413", "url": "https://glygen.org/publication/PubMed/9652413" } ] }, { "title": "A novel human WD protein, h-beta TrCp, that interacts with HIV-1 Vpu connects CD4 to the ER degradation pathway through an F-box motif.", "journal": "Molecular cell", "date": "1998", "authors": "Margottin F, Bour SP, Durand H, Selig L, Benichou S, Richard V, Thomas D, Strebel K, Benarous R", "evidence": [ { "database": "Reactome", "id": "R-HSA-180534", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-180534" } ], "reference": [ { "type": "PubMed", "id": "9660940", "url": "https://glygen.org/publication/PubMed/9660940" } ] }, { "title": "Interferon-gamma can stimulate post-proteasomal trimming of the N terminus of an antigenic peptide by inducing leucine aminopeptidase.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Beninga J, Rock KL, Goldberg AL", "evidence": [ { "database": "Reactome", "id": "R-HSA-983168", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983168" } ], "reference": [ { "type": "PubMed", "id": "9668046", "url": "https://glygen.org/publication/PubMed/9668046" } ] }, { "title": "Dishevelled activates JNK and discriminates between JNK pathways in planar polarity and wingless signaling.", "journal": "Cell", "date": "1998", "authors": "Boutros M, Paricio N, Strutt DI, Mlodzik M", "evidence": [ { "database": "Reactome", "id": "R-HSA-4608870", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4608870" } ], "reference": [ { "type": "PubMed", "id": "9674432", "url": "https://glygen.org/publication/PubMed/9674432" } ] }, { "title": "T cell receptor (TCR) interacting molecule (TRIM), a novel disulfide-linked dimer associated with the TCR-CD3-zeta complex, recruits intracellular signaling proteins to the plasma membrane.", "journal": "The Journal of experimental medicine", "date": "1998", "authors": "Bruyns E, Marie-Cardine A, Kirchgessner H, Sagolla K, Shevchenko A, Mann M, Autschbach F, Bensussan A, Meuer S, Schraven B", "evidence": [ { "database": "Reactome", "id": "R-HSA-202424", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202424" } ], "reference": [ { "type": "PubMed", "id": "9687533", "url": "https://glygen.org/publication/PubMed/9687533" } ] }, { "title": "Direct phosphorylation of IkappaB by IKKalpha and IKKbeta: discrimination between free and NF-kappaB-bound substrate.", "journal": "Science (New York, N.Y.)", "date": "1998", "authors": "Zandi E, Chen Y, Karin M", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169091", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169091" } ], "reference": [ { "type": "PubMed", "id": "9721103", "url": "https://glygen.org/publication/PubMed/9721103" } ] }, { "title": "Molecular determinants of NF-kappaB-inducing kinase action.", "journal": "Molecular and cellular biology", "date": "1998", "authors": "Lin X, Mu Y, Cunningham ET Jr, Marcu KB, Geleziunas R, Greene WC", "evidence": [ { "database": "Reactome", "id": "R-HSA-5676590", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5676590" } ], "reference": [ { "type": "PubMed", "id": "9742107", "url": "https://glygen.org/publication/PubMed/9742107" } ] }, { "title": "Cyclin D3: requirement for G1/S transition and high abundance in quiescent tissues suggest a dual role in proliferation and differentiation.", "journal": "Oncogene", "date": "1998", "authors": "Bartkova J, Lukas J, Strauss M, Bartek J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "9747882", "url": "https://glygen.org/publication/PubMed/9747882" } ] }, { "title": "Cleavage of the C-terminus of NEDD8 by UCH-L3.", "journal": "Biochemical and biophysical research communications", "date": "1998", "authors": "Wada H, Kito K, Caskey LS, Yeh ET, Kamitani T", "evidence": [ { "database": "Reactome", "id": "R-HSA-5689603", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689603" } ], "reference": [ { "type": "PubMed", "id": "9790970", "url": "https://glygen.org/publication/PubMed/9790970" } ] }, { "title": "Retroviral transfer of the human MDR1 gene confers resistance to bisantrene-specific hematotoxicity.", "journal": "Clinical cancer research : an official journal of the American Association for Cancer Research", "date": "1996", "authors": "Aksentijevich I, Cardarelli CO, Pastan I, Gottesman MM", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "9816258", "url": "https://glygen.org/publication/PubMed/9816258" } ] }, { "title": "Reconstituted human cardiac KATP channels: functional identity with the native channels from the sarcolemma of human ventricular cells.", "journal": "Circulation research", "date": "1998", "authors": "Babenko AP, Gonzalez G, Aguilar-Bryan L, Bryan J", "evidence": [ { "database": "Reactome", "id": "R-HSA-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556" } ], "reference": [ { "type": "PubMed", "id": "9831708", "url": "https://glygen.org/publication/PubMed/9831708" } ] }, { "title": "Overexpression of ErbB2 blocks Taxol-induced apoptosis by upregulation of p21Cip1, which inhibits p34Cdc2 kinase.", "journal": "Molecular cell", "date": "1998", "authors": "Yu D, Jing T, Liu B, Yao J, Tan M, McDonnell TJ, Hung MC", "evidence": [ { "database": "Reactome", "id": "R-HSA-8852276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8852276" } ], "reference": [ { "type": "PubMed", "id": "9844631", "url": "https://glygen.org/publication/PubMed/9844631" } ] }, { "title": "Identification of the receptor component of the IkappaBalpha-ubiquitin ligase.", "journal": "Nature", "date": "1998", "authors": "Yaron A, Hatzubai A, Davis M, Lavon I, Amit S, Manning AM, Andersen JS, Mann M, Mercurio F, Ben-Neriah Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169091", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169091" } ], "reference": [ { "type": "PubMed", "id": "9859996", "url": "https://glygen.org/publication/PubMed/9859996" } ] }, { "title": "Hedgehog stimulates maturation of Cubitus interruptus into a labile transcriptional activator.", "journal": "Nature", "date": "1998", "authors": "Ohlmeyer JT, Kalderon D", "evidence": [ { "database": "Reactome", "id": "R-HSA-5632684", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5632684" } ], "reference": [ { "type": "PubMed", "id": "9874371", "url": "https://glygen.org/publication/PubMed/9874371" } ] }, { "title": "Keap1 represses nuclear activation of antioxidant responsive elements by Nrf2 through binding to the amino-terminal Neh2 domain.", "journal": "Genes & development", "date": "1999", "authors": "Itoh K, Wakabayashi N, Katoh Y, Ishii T, Igarashi K, Engel JD, Yamamoto M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664" } ], "reference": [ { "type": "PubMed", "id": "9887101", "url": "https://glygen.org/publication/PubMed/9887101" } ] }, { "title": "Transcription-dependent nuclear-cytoplasmic trafficking is required for the function of the von Hippel-Lindau tumor suppressor protein.", "journal": "Molecular and cellular biology", "date": "1999", "authors": "Lee S, Neumann M, Stearman R, Stauber R, Pause A, Pavlakis GN, Klausner RD", "evidence": [ { "database": "Reactome", "id": "R-HSA-1234176", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1234176" } ], "reference": [ { "type": "PubMed", "id": "9891082", "url": "https://glygen.org/publication/PubMed/9891082" } ] }, { "title": "Structure, expression, and function of human pituitary tumor-transforming gene (PTTG).", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "1999", "authors": "Zhang X, Horwitz GA, Prezant TR, Valentini A, Nakashima M, Bronstein MD, Melmed S", "evidence": [ { "database": "Reactome", "id": "R-HSA-2467813", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2467813" } ], "reference": [ { "type": "PubMed", "id": "9892021", "url": "https://glygen.org/publication/PubMed/9892021" } ] }, { "title": "All three IkappaB isoforms and most Rel family members are stably associated with the IkappaB kinase 1/2 complex.", "journal": "European journal of biochemistry", "date": "1999", "authors": "Heilker R, Freuler F, Pulfer R, Di Padova F, Eder J", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169091", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169091" } ], "reference": [ { "type": "PubMed", "id": "9914500", "url": "https://glygen.org/publication/PubMed/9914500" } ] }, { "title": "The SCFbeta-TRCP-ubiquitin ligase complex associates specifically with phosphorylated destruction motifs in IkappaBalpha and beta-catenin and stimulates IkappaBalpha ubiquitination in vitro.", "journal": "Genes & development", "date": "1999", "authors": "Winston JT, Strack P, Beer-Romero P, Chu CY, Elledge SJ, Harper JW", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169091", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169091" } ], "reference": [ { "type": "PubMed", "id": "9990852", "url": "https://glygen.org/publication/PubMed/9990852" } ] }, { "title": "Signal-induced ubiquitination of IkappaBalpha by the F-box protein Slimb/beta-TrCP.", "journal": "Genes & development", "date": "1999", "authors": "Spencer E, Jiang J, Chen ZJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9020702", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9020702" } ], "reference": [ { "type": "PubMed", "id": "9990853", "url": "https://glygen.org/publication/PubMed/9990853" } ] } ], "pathway": [ { "id": "hsa:5717", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:5717", "resource": "KEGG Pathway" }, { "id": "R-HSA-1169091", "name": "Activation of NF-kappaB in B cells", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169091", "resource": "Reactome", "description": "Activation of NF-kappaB in B cells" }, { "id": "R-HSA-1234176", "name": "Oxygen-dependent proline hydroxylation of Hypoxia-inducible Factor Alpha", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1234176", "resource": "Reactome", "description": "Oxygen-dependent proline hydroxylation of Hypoxia-inducible Factor Alpha" }, { "id": "R-HSA-1236974", "name": "ER-Phagosome pathway", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1236974", "resource": "Reactome", "description": "ER-Phagosome pathway" }, { "id": "R-HSA-1236978", "name": "Cross-presentation of soluble exogenous antigens (endosomes)", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1236978", "resource": "Reactome", "description": "Cross-presentation of soluble exogenous antigens (endosomes)" }, { "id": "R-HSA-174084", "name": "Autodegradation of Cdh1 by Cdh1:APC/C", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-174084", "resource": "Reactome", "description": "Autodegradation of Cdh1 by Cdh1:APC/C" }, { "id": "R-HSA-174113", "name": "SCF-beta-TrCP mediated degradation of Emi1", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-174113", "resource": "Reactome", "description": "SCF-beta-TrCP mediated degradation of Emi1" }, { "id": "R-HSA-174154", "name": "APC/C:Cdc20 mediated degradation of Securin", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-174154", "resource": "Reactome", "description": "APC/C:Cdc20 mediated degradation of Securin" }, { "id": "R-HSA-174178", "name": "APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-174178", "resource": "Reactome", "description": "APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1" }, { "id": "R-HSA-174184", "name": "Cdc20:Phospho-APC/C mediated degradation of Cyclin A", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-174184", "resource": "Reactome", "description": "Cdc20:Phospho-APC/C mediated degradation of Cyclin A" }, { "id": "R-HSA-180534", "name": "Vpu mediated degradation of CD4", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-180534", "resource": "Reactome", "description": "Vpu mediated degradation of CD4" }, { "id": "R-HSA-180585", "name": "Vif-mediated degradation of APOBEC3G", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-180585", "resource": "Reactome", "description": "Vif-mediated degradation of APOBEC3G" }, { "id": "R-HSA-187577", "name": "SCF(Skp2)-mediated degradation of p27/p21", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-187577", "resource": "Reactome", "description": "SCF(Skp2)-mediated degradation of p27/p21" }, { "id": "R-HSA-195253", "name": "Degradation of beta-catenin by the destruction complex", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-195253", "resource": "Reactome", "description": "Degradation of beta-catenin by the destruction complex" }, { "id": "R-HSA-202424", "name": "Downstream TCR signaling", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202424", "resource": "Reactome", "description": "Downstream TCR signaling" }, { "id": "R-HSA-211733", "name": "Regulation of activated PAK-2p34 by proteasome mediated degradation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211733", "resource": "Reactome", "description": "Regulation of activated PAK-2p34 by proteasome mediated degradation" }, { "id": "R-HSA-2467813", "name": "Separation of Sister Chromatids", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2467813", "resource": "Reactome", "description": "Separation of Sister Chromatids" }, { "id": "R-HSA-2871837", "name": "FCERI mediated NF-kB activation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871837", "resource": "Reactome", "description": "FCERI mediated NF-kB activation" }, { "id": "R-HSA-349425", "name": "Autodegradation of the E3 ubiquitin ligase COP1", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-349425", "resource": "Reactome", "description": "Autodegradation of the E3 ubiquitin ligase COP1" }, { "id": "R-HSA-350562", "name": "Regulation of ornithine decarboxylase (ODC)", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-350562", "resource": "Reactome", "description": "Regulation of ornithine decarboxylase (ODC)" }, { "id": "R-HSA-382556", "name": "ABC-family proteins mediated transport", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556", "resource": "Reactome", "description": "ABC-family proteins mediated transport" }, { "id": "R-HSA-450408", "name": "AUF1 (hnRNP D0) binds and destabilizes mRNA", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-450408", "resource": "Reactome", "description": "AUF1 (hnRNP D0) binds and destabilizes mRNA" }, { "id": "R-HSA-4608870", "name": "Asymmetric localization of PCP proteins", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4608870", "resource": "Reactome", "description": "Asymmetric localization of PCP proteins" }, { "id": "R-HSA-4641257", "name": "Degradation of AXIN", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4641257", "resource": "Reactome", "description": "Degradation of AXIN" }, { "id": "R-HSA-4641258", "name": "Degradation of DVL", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4641258", "resource": "Reactome", "description": "Degradation of DVL" }, { "id": "R-HSA-5358346", "name": "Hedgehog ligand biogenesis", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5358346", "resource": "Reactome", "description": "Hedgehog ligand biogenesis" }, { "id": "R-HSA-5362768", "name": "Hh mutants are degraded by ERAD", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5362768", "resource": "Reactome", "description": "Hh mutants are degraded by ERAD" }, { "id": "R-HSA-5607761", "name": "Dectin-1 mediated noncanonical NF-kB signaling", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5607761", "resource": "Reactome", "description": "Dectin-1 mediated noncanonical NF-kB signaling" }, { "id": "R-HSA-5607764", "name": "CLEC7A (Dectin-1) signaling", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5607764", "resource": "Reactome", "description": "CLEC7A (Dectin-1) signaling" }, { "id": "R-HSA-5610780", "name": "Degradation of GLI1 by the proteasome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5610780", "resource": "Reactome", "description": "Degradation of GLI1 by the proteasome" }, { "id": "R-HSA-5610783", "name": "Degradation of GLI2 by the proteasome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5610783", "resource": "Reactome", "description": "Degradation of GLI2 by the proteasome" }, { "id": "R-HSA-5610785", "name": "GLI3 is processed to GLI3R by the proteasome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5610785", "resource": "Reactome", "description": "GLI3 is processed to GLI3R by the proteasome" }, { "id": "R-HSA-5632684", "name": "Hedgehog 'on' state", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5632684", "resource": "Reactome", "description": "Hedgehog 'on' state" }, { "id": "R-HSA-5658442", "name": "Regulation of RAS by GAPs", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5658442", "resource": "Reactome", "description": "Regulation of RAS by GAPs" }, { "id": "R-HSA-5668541", "name": "TNFR2 non-canonical NF-kB pathway", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5668541", "resource": "Reactome", "description": "TNFR2 non-canonical NF-kB pathway" }, { "id": "R-HSA-5676590", "name": "NIK-->noncanonical NF-kB signaling", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5676590", "resource": "Reactome", "description": "NIK-->noncanonical NF-kB signaling" }, { "id": "R-HSA-5678895", "name": "Defective CFTR causes cystic fibrosis", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5678895", "resource": "Reactome", "description": "Defective CFTR causes cystic fibrosis" }, { "id": "R-HSA-5687128", "name": "MAPK6/MAPK4 signaling", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128", "resource": "Reactome", "description": "MAPK6/MAPK4 signaling" }, { "id": "R-HSA-5689603", "name": "UCH proteinases", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689603", "resource": "Reactome", "description": "UCH proteinases" }, { "id": "R-HSA-5689880", "name": "Ub-specific processing proteases", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880", "resource": "Reactome", "description": "Ub-specific processing proteases" }, { "id": "R-HSA-6798695", "name": "Neutrophil degranulation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6798695", "resource": "Reactome", "description": "Neutrophil degranulation" }, { "id": "R-HSA-68867", "name": "Assembly of the pre-replicative complex", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-68867", "resource": "Reactome", "description": "Assembly of the pre-replicative complex" }, { "id": "R-HSA-68949", "name": "Orc1 removal from chromatin", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-68949", "resource": "Reactome", "description": "Orc1 removal from chromatin" }, { "id": "R-HSA-69017", "name": "CDK-mediated phosphorylation and removal of Cdc6", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69017", "resource": "Reactome", "description": "CDK-mediated phosphorylation and removal of Cdc6" }, { "id": "R-HSA-69481", "name": "G2/M Checkpoints", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69481", "resource": "Reactome", "description": "G2/M Checkpoints" }, { "id": "R-HSA-69601", "name": "Ubiquitin Mediated Degradation of Phosphorylated Cdc25A", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69601", "resource": "Reactome", "description": "Ubiquitin Mediated Degradation of Phosphorylated Cdc25A" }, { "id": "R-HSA-75815", "name": "Ubiquitin-dependent degradation of Cyclin D", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75815", "resource": "Reactome", "description": "Ubiquitin-dependent degradation of Cyclin D" }, { "id": "R-HSA-8852276", "name": "The role of GTSE1 in G2/M progression after G2 checkpoint", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8852276", "resource": "Reactome", "description": "The role of GTSE1 in G2/M progression after G2 checkpoint" }, { "id": "R-HSA-8854050", "name": "FBXL7 down-regulates AURKA during mitotic entry and in early mitosis", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8854050", "resource": "Reactome", "description": "FBXL7 down-regulates AURKA during mitotic entry and in early mitosis" }, { "id": "R-HSA-8939236", "name": "RUNX1 regulates transcription of genes involved in differentiation of HSCs", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8939236", "resource": "Reactome", "description": "RUNX1 regulates transcription of genes involved in differentiation of HSCs" }, { "id": "R-HSA-8939902", "name": "Regulation of RUNX2 expression and activity", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8939902", "resource": "Reactome", "description": "Regulation of RUNX2 expression and activity" }, { "id": "R-HSA-8941858", "name": "Regulation of RUNX3 expression and activity", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8941858", "resource": "Reactome", "description": "Regulation of RUNX3 expression and activity" }, { "id": "R-HSA-8948751", "name": "Regulation of PTEN stability and activity", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8948751", "resource": "Reactome", "description": "Regulation of PTEN stability and activity" }, { "id": "R-HSA-8951664", "name": "Neddylation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664", "resource": "Reactome", "description": "Neddylation" }, { "id": "R-HSA-9010553", "name": "Regulation of expression of SLITs and ROBOs", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9010553", "resource": "Reactome", "description": "Regulation of expression of SLITs and ROBOs" }, { "id": "R-HSA-9020702", "name": "Interleukin-1 signaling", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9020702", "resource": "Reactome", "description": "Interleukin-1 signaling" }, { "id": "R-HSA-9604323", "name": "Negative regulation of NOTCH4 signaling", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9604323", "resource": "Reactome", "description": "Negative regulation of NOTCH4 signaling" }, { "id": "R-HSA-9755511", "name": "KEAP1-NFE2L2 pathway", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9755511", "resource": "Reactome", "description": "KEAP1-NFE2L2 pathway" }, { "id": "R-HSA-9762114", "name": "GSK3B and BTRC:CUL1-mediated-degradation of NFE2L2", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9762114", "resource": "Reactome", "description": "GSK3B and BTRC:CUL1-mediated-degradation of NFE2L2" }, { "id": "R-HSA-9824272", "name": "Somitogenesis", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9824272", "resource": "Reactome", "description": "Somitogenesis" }, { "id": "R-HSA-983168", "name": "Antigen processing: Ubiquitination & Proteasome degradation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983168", "resource": "Reactome", "description": "Antigen processing: Ubiquitination & Proteasome degradation" } ], "orthologs": [ { "uniprot_canonical_ac": "F1LMZ8-1", "protein_name": "26S proteasome non-ATPase regulatory subunit 11", "gene_name": "Psmd11", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MAAAAVVEFQRAQSLLSTDREASIDILHSIVKRDIQENDEEAVQVKEQSILELGSLLAKTGQAAELGGLLKYVRPFLNSISKAKAARLVRSLLDLFLDMEAATGQEVELCLECIEWAKSEKRTFLRQALEARLVSLYFDTKRYQEALHLGSQLLRELKKMDDKALLVEVQLLESKTYHALSNLPKARAALTSARTTANAIYCPPKLQATLDMQSGIIHAAEEKDWKTAYSYFYEAFEGYDSIDSPKAITSLKYMLLCKIMLNTPEDVQALVSGKLALRYAGRQTEALKCVAQASKNRSLADFEKALTDYRAELRDDPIISTHLAKLYDNLLEQNLIRVIEPFSRVQIEHISSLIKLSKADVERKLSQMILDKKFHGILDQGEGVLIIFDEPPVDKTYEAALETIQNMSKVVDSLYNKAKKLT", "length": 422 }, "evidence": [ { "id": "45924414", "url": "http://www.informatics.jax.org/homology/45924414", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q12377-1", "protein_name": "26S proteasome regulatory subunit RPN6", "gene_name": "RPN6", "tax_id": 559292, "organism": "Saccharomyces cerevisiae S288C", "sequence": { "sequence": "MSLPGSKLEEARRLVNEKQYNEAEQVYLSLLDKDSSQSSAAAGASVDDKRRNEQETSILELGQLYVTMGAKDKLREFIPHSTEYMMQFAKSKTVKVLKTLIEKFEQVPDSLDDQIFVCEKSIEFAKREKRVFLKHSLSIKLATLHYQKKQYKDSLALINDLLREFKKLDDKPSLVDVHLLESKVYHKLRNLAKSKASLTAARTAANSIYCPTQTVAELDLMSGILHCEDKDYKTAFSYFFESFESYHNLTTHNSYEKACQVLKYMLLSKIMLNLIDDVKNILNAKYTKETYQSRGIDAMKAVAEAYNNRSLLDFNTALKQYEKELMGDELTRSHFNALYDTLLESNLCKIIEPFECVEISHISKIIGLDTQQVEGKLSQMILDKIFYGVLDQGNGWLYVYETPNQDATYDSALELVGQLNKVVDQLFEKASVLY", "length": 434 }, "evidence": [ { "id": "O00231", "url": "https://omabrowser.org/oma/group/O00231/", "database": "OMA" } ], "common_name": "Yeast" }, { "uniprot_canonical_ac": "Q7KLV9-1", "protein_name": "26S proteasome non-ATPase regulatory subunit 11", "gene_name": "Rpn6", "tax_id": 7227, "organism": "Drosophila melanogaster", "sequence": { "sequence": "MAGATLFERAQALSSVNREEQDSSLLNKLVRDQEGAENDEERIRIKEQGILQQGELYKQEGKAKELADLIKVTRPFLSSISKAKAAKLVRSLVDMFLDMDAGTGIEVQLCKDCIEWAKQEKRTFLRQSLEARLIALYFDTALYTEALALGAQLLRELKKLDDKNLLVEVQLLESKTYHALSNLPKARAALTSARTTANAIYCPPKVQGALDLQSGILHAADERDFKTAFSYFYEAFEGFDSVDSVKALTSLKYMLLCKIMLGQSDDVNQLVSGKLAITYSGRDIDAMKSVAEASHKRSLADFQAALKEYKKELAEDVIVQAHLGTLYDTMLEQNLCRIIEPYSRVQVAHVAESIQLPMPQVEKKLSQMILDKKFSGILDQGEGVLIVFEETPVDKTYERVLETIQSMGKVVDTLYQKAKKLS", "length": 422 }, "evidence": [ { "id": "O00231", "url": "https://omabrowser.org/oma/group/O00231/", "database": "OMA" } ], "common_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q8BG32-1", "protein_name": "26S proteasome non-ATPase regulatory subunit 11", "gene_name": "Psmd11", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MAAAAVVEFQRAQSLLSTDREASIDILHSIVKRDIQENDEEAVQVKEQSILELGSLLAKTGQAAELGGLLKYVRPFLNSISKAKAARLVRSLLDLFLDMEAATGQEVELCLECIEWAKSEKRTFLRQALEARLVSLYFDTKRYQEALHLGSQLLRELKKMDDKALLVEVQLLESKTYHALSNLPKARAALTSARTTANAIYCPPKLQATLDMQSGIIHAAEEKDWKTAYSYFYEAFEGYDSIDSPKAITSLKYMLLCKIMLNTPEDVQALVSGKLALRYAGRQTEALKCVAQASKNRSLADFEKALTDYRAELRDDPIISTHLAKLYDNLLEQNLIRVIEPFSRVQIEHISSLIKLSKADVERKLSQMILDKKFHGILDQGEGVLIIFDEPPVDKTYEAALETIQNMSKVVDSLYSKAKKLT", "length": 422 }, "evidence": [ { "id": "45924414", "url": "http://www.informatics.jax.org/homology/45924414", "database": "MGI" }, { "id": "O00231", "url": "https://omabrowser.org/oma/group/O00231/", "database": "OMA" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 10, "go_terms": [ { "name": "proteasome accessory complex", "id": "GO:0022624", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0022624", "evidence": [ { "database": "UniProtKB", "id": "O00231", "url": "https://www.uniprot.org/uniprot/O00231" } ], "pmid": "" }, { "name": "extracellular region", "id": "GO:0005576", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576", "evidence": [ { "database": "UniProtKB", "id": "O00231", "url": "https://www.uniprot.org/uniprot/O00231" } ], "pmid": "" }, { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "O00231", "url": "https://www.uniprot.org/uniprot/O00231" } ], "pmid": "" }, { "name": "nucleoplasm", "id": "GO:0005654", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654", "evidence": [ { "database": "UniProtKB", "id": "O00231", "url": "https://www.uniprot.org/uniprot/O00231" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "O00231", "url": "https://www.uniprot.org/uniprot/O00231" } ], "pmid": "" }, { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "O00231", "url": "https://www.uniprot.org/uniprot/O00231" } ], "pmid": "" }, { "name": "secretory granule lumen", "id": "GO:0034774", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034774", "evidence": [ { "database": "UniProtKB", "id": "O00231", "url": "https://www.uniprot.org/uniprot/O00231" } ], "pmid": "" }, { "name": "ficolin-1-rich granule lumen", "id": "GO:1904813", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1904813", "evidence": [ { "database": "UniProtKB", "id": "O00231", "url": "https://www.uniprot.org/uniprot/O00231" } ], "pmid": "" }, { "name": "proteasome complex", "id": "GO:0000502", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000502", "evidence": [ { "database": "UniProtKB", "id": "O00231", "url": "https://www.uniprot.org/uniprot/O00231" } ], "pmid": "" }, { "name": "proteasome regulatory particle, lid subcomplex", "id": "GO:0008541", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008541", "evidence": [ { "database": "UniProtKB", "id": "O00231", "url": "https://www.uniprot.org/uniprot/O00231" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 4, "go_terms": [ { "name": "stem cell differentiation", "id": "GO:0048863", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048863", "evidence": [ { "database": "UniProtKB", "id": "O00231", "url": "https://www.uniprot.org/uniprot/O00231" } ], "pmid": "" }, { "name": "proteasome-mediated ubiquitin-dependent protein catabolic process", "id": "GO:0043161", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043161", "evidence": [ { "database": "UniProtKB", "id": "O00231", "url": "https://www.uniprot.org/uniprot/O00231" } ], "pmid": "" }, { "name": "ubiquitin-dependent protein catabolic process", "id": "GO:0006511", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006511", "evidence": [ { "database": "UniProtKB", "id": "O00231", "url": "https://www.uniprot.org/uniprot/O00231" } ], "pmid": "" }, { "name": "proteasome assembly", "id": "GO:0043248", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043248", "evidence": [ { "database": "UniProtKB", "id": "O00231", "url": "https://www.uniprot.org/uniprot/O00231" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "structural molecule activity", "id": "GO:0005198", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005198", "evidence": [ { "database": "UniProtKB", "id": "O00231", "url": "https://www.uniprot.org/uniprot/O00231" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 296, "end_pos": 298, "annotation": "n_glycosylation_sequon" }, { "start_pos": 406, "end_pos": 408, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "Phosphorylated by AMPK.", "evidence": [ { "database": "UniProtKB", "id": "O00231", "url": "https://www.uniprot.org/uniprot/O00231" }, { "database": "PubMed", "id": "19616115", "url": "https://glygen.org/publication/PubMed/19616115" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [ { "assessed_biomarker_entity": "26S proteasome non-ATPase regulatory subunit 11 (PSMD11)", "biomarker_id": "A0197", "evidence": [ { "id": "GLY_000625", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000625" }, { "id": "32663515", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32663515" } ], "instances": [ { "best_biomarker_type": "prognostic", "status": "increased PSMD11 level", "disease": { "disease_id": "DOID:1793", "recommended_name": { "id": "DOID:1793", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1793", "name": "pancreatic cancer", "description": "An endocrine gland cancer located_in the pancreas." }, "synonyms": [ { "id": "DOID:1793", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1793", "name": "Ca body of pancreas", "description": "" }, { "id": "DOID:1793", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1793", "name": "Ca head of pancreas", "description": "" }, { "id": "DOID:1793", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1793", "name": "Ca tail of pancreas", "description": "" }, { "id": "DOID:1793", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1793", "name": "malignant neoplasm of body of pancreas", "description": "" }, { "id": "DOID:1793", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1793", "name": "malignant neoplasm of head of pancreas", "description": "" }, { "id": "DOID:1793", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1793", "name": "malignant neoplasm of tail of pancreas", "description": "" }, { "id": "DOID:1793", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1793", "name": "pancreas neoplasm", "description": "" }, { "id": "DOID:1793", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1793", "name": "pancreatic neoplasm", "description": "" }, { "id": "DOID:1793", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1793", "name": "pancreatic tumor", "description": "" } ] }, "tissue": { "name": "blood", "namespace": "UBERON", "id": "0000178", "url": "http://purl.obolibrary.org/obo/UBERON_0000178" }, "evidence": [ { "id": "GLY_000625", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000625" }, { "id": "32663515", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32663515" } ] } ] } ], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [ 230, 340 ], "glycation_sites": [], "phosphorylation_sites": [ 14, 23, 79, 81, 263, 272 ], "sequon_annotation_sites": [ { "start_pos": 296, "end_pos": 298 }, { "start_pos": 406, "end_pos": 408 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 6 }, { "field": "total_sites", "count": 6 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "subjects_tested", "subjects_positive", "frequency", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "subjects_tested", "subjects_positive", "frequency", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 918 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }