{ "uniprot_canonical_ac": "O00220-1", "uniprot_ac": "O00220", "uniprot_id": "TR10A_HUMAN", "mass": { "chemical_mass": 50089.0, "monoisotopic_mass": 50089.0 }, "refseq": { "ac": "NP_003835", "name": "tumor necrosis factor receptor superfamily member 10A", "summary": "The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor is activated by tumor necrosis factor-related apoptosis inducing ligand (TNFSF10/TRAIL), and thus transduces cell death signal and induces cell apoptosis. Studies with FADD-deficient mice suggested that FADD, a death domain containing adaptor protein, is required for the apoptosis mediated by this protein. [provided by RefSeq, Jul 2008].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003835" }, "gene_names": [ { "name": "TNFRSF10A", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/O00220", "id": "O00220" }, { "name": "APO2; CD261; DR4; TRAILR-1; TRAILR1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003835", "id": "NP_003835" }, { "name": "APO2", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O00220", "id": "O00220" }, { "name": "DR4", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O00220", "id": "O00220" }, { "name": "TNFRSF10A", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003835", "id": "NP_003835" }, { "name": "TRAILR1", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O00220", "id": "O00220" } ], "protein_names": [ { "name": "Tumor necrosis factor receptor superfamily member 10A", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "O00220" }, { "name": "Death receptor 4", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O00220" }, { "name": "TNF-related apoptosis-inducing ligand receptor 1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O00220" }, { "name": "TRAIL receptor 1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O00220" }, { "name": "TRAIL-R1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O00220" }, { "name": "death receptor 4; cytotoxic TRAIL receptor; TRAIL-R1; TRAIL receptor 1; TNF-related apoptosis-inducing ligand receptor 1; tumor necrosis factor receptor superfamily, member 10a", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003835", "id": "NP_003835" }, { "name": "tumor necrosis factor receptor superfamily member 10A", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003835", "id": "NP_003835" } ], "function": [ { "annotation": "Associations of Single-Nucleotide Polymorphisms in Slovenian Patients with Acute Central Serous Chorioretinopathy. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_003835", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003835" }, { "database": "PubMed", "id": "35052395", "url": "https://glygen.org/publication/PubMed/35052395" } ] }, { "annotation": "Downregulation of death receptor 4 is tightly associated with positive response of EGFR mutant lung cancer to EGFR-targeted therapy and improved prognosis. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_003835", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003835" }, { "database": "PubMed", "id": "33664875", "url": "https://glygen.org/publication/PubMed/33664875" } ] }, { "annotation": "Epigenetic Modification of Death Receptor Genes for TRAIL and TRAIL Resistance in Childhood B-Cell Precursor Acute Lymphoblastic Leukemia. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_003835", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003835" }, { "database": "PubMed", "id": "34198757", "url": "https://glygen.org/publication/PubMed/34198757" } ] }, { "annotation": "Genetic variations in tumor ecrosis factor related apoptosis-inducing ligand receptor-1 (TRAIL-R1) gene and the susceptibility to b-cell non-hodgkin lymphoma (B-NHL) in Egypt. Erratum:[Cancer Biomark. 2022;33(2):275. PMID: 35068443]", "evidence": [ { "database": "RefSeq", "id": "NP_003835", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003835" }, { "database": "PubMed", "id": "34275891", "url": "https://glygen.org/publication/PubMed/34275891" } ] }, { "annotation": "Oxaliplatin resistance in colorectal cancer enhances TRAIL sensitivity via death receptor 4 upregulation and lipid raft localization. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_003835", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003835" }, { "database": "PubMed", "id": "34342264", "url": "https://glygen.org/publication/PubMed/34342264" } ] }, { "annotation": "Receptor for the cytotoxic ligand TNFSF10/TRAIL (PubMed:26457518). The adapter molecule FADD recruits caspase-8 to the activated receptor. The resulting death-inducing signaling complex (DISC) performs caspase-8 proteolytic activation which initiates the subsequent cascade of caspases (aspartate-specific cysteine proteases) mediating apoptosis (PubMed:19090789). Promotes the activation of NF-kappa-B (PubMed:9430227).", "evidence": [ { "database": "UniProtKB", "id": "O00220", "url": "https://www.uniprot.org/uniprot/O00220#function" }, { "database": "PubMed", "id": "19090789", "url": "https://glygen.org/publication/PubMed/19090789" }, { "database": "PubMed", "id": "9430227", "url": "https://glygen.org/publication/PubMed/9430227" } ] }, { "annotation": "Receptor for the cytotoxic ligand TNFSF10/TRAIL. The adapter molecule FADD recruits caspase-8 to the activated receptor. The resulting death-inducing signaling complex (DISC) performs caspase-8 proteolytic activation which initiates the subsequent cascade of caspases (aspartate-specific cysteine proteases) mediating apoptosis.", "evidence": [ { "database": "UniProtKB", "id": "F8U8C0", "url": "https://www.uniprot.org/uniprot/F8U8C0#function" }, { "database": "UniProtKB", "id": "PIRNR037867", "url": "https://www.uniprot.org/uniprot/PIRNR037867#function" } ] }, { "annotation": "The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor is activated by tumor necrosis factor-related apoptosis inducing ligand (TNFSF10/TRAIL), and thus transduces cell death signal and induces cell apoptosis. Studies with FADD-deficient mice suggested that FADD, a death domain containing adaptor protein, is required for the apoptosis mediated by this protein. [provided by RefSeq, Jul 2008].", "evidence": [ { "database": "RefSeq", "id": "NP_003835", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003835" } ] } ], "disease": [], "snv": [ { "evidence": [ { "id": "rs1485577162", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1485577162" }, { "id": "rs1485577162", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1485577162" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 115, "end_pos": 115, "sequence_org": "D", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (DQS->NQS).", "chr_id": "8", "chr_pos": "23212176", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "D115", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "O00220", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O00220" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 126, "end_pos": 126, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "S", "sequence_mut": "I", "comment": "Somatic mutation passed 1 out of 6 filters: o-glyco-site-loss (S->I).", "chr_id": "8", "chr_pos": "23212142", "ref_nt": "C", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "S126", "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs532602797", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs532602797" }, { "id": "rs532602797", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs532602797" }, { "id": "rs532602797", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs532602797#frequency_tab" }, { "id": "rs532602797", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs532602797" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 156, "end_pos": 156, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAS->SAS).", "chr_id": "8", "chr_pos": "23202698", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N156", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs532602797", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs532602797" }, { "id": "rs532602797", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs532602797" }, { "id": "rs532602797", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs532602797#frequency_tab" }, { "id": "rs532602797", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs532602797" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 156, "end_pos": 156, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAS->TAS).", "chr_id": "8", "chr_pos": "23202698", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N156", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs771322440", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs771322440" }, { "id": "rs771322440", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs771322440" }, { "id": "rs771322440", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs771322440" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 198, "end_pos": 198, "sequence_org": "D", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (DNS->NNS).", "chr_id": "8", "chr_pos": "23201845", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "D198", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs538852484", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs538852484" }, { "id": "rs538852484", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs538852484#frequency_tab" }, { "id": "rs538852484", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs538852484" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 199, "end_pos": 199, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NDN->NDS).", "chr_id": "8", "chr_pos": "23201841", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N199", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1304606685", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1304606685" }, { "id": "rs1304606685", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1304606685#frequency_tab" }, { "id": "rs1304606685", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1304606685" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 201, "end_pos": 201, "sequence_org": "A", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NSA->NST).", "chr_id": "8", "chr_pos": "23201836", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "A201", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1162044271", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1162044271" }, { "id": "rs1162044271", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1162044271" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 25, "end_pos": 25, "sequence_org": "S", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (SGT->NGT).", "chr_id": "8", "chr_pos": "23224988", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S25", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1434088454", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1434088454" }, { "id": "rs1434088454", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1434088454#frequency_tab" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 264, "end_pos": 264, "sequence_org": "I", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (IGS->NGS).", "chr_id": "8", "chr_pos": "23200513", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "I264", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs764151190", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs764151190" }, { "id": "rs764151190", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs764151190" }, { "id": "rs764151190", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs764151190#frequency_tab" }, { "id": "rs764151190", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs764151190" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 299, "end_pos": 299, "sequence_org": "I", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NEI->NET).", "chr_id": "8", "chr_pos": "23199384", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "I299", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs145301145", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs145301145" }, { "id": "rs145301145", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs145301145" }, { "id": "rs145301145", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs145301145#frequency_tab" }, { "id": "rs145301145", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs145301145" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 424, "end_pos": 424, "sequence_org": "S", "sequence_mut": "*", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->*).", "chr_id": "8", "chr_pos": "23191830", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S424", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1445882171", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1445882171" }, { "id": "rs1445882171", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1445882171#frequency_tab" }, { "id": "rs1445882171", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1445882171" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 424, "end_pos": 424, "sequence_org": "S", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->A).", "chr_id": "8", "chr_pos": "23191831", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S424", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "O00220", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O00220" }, { "id": "rs145301145", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs145301145" }, { "id": "rs145301145", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs145301145" }, { "id": "rs145301145", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs145301145#frequency_tab" }, { "id": "rs145301145", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs145301145" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 424, "end_pos": 424, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "S", "sequence_mut": "L", "comment": "Somatic mutation passed 1 out of 6 filters: o-glyco-site-loss (S->L).", "chr_id": "8", "chr_pos": "23191830", "ref_nt": "G", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "S424", "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease", "ebi", "germline" ] }, { "evidence": [ { "id": "rs145301145", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs145301145" }, { "id": "rs145301145", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs145301145" }, { "id": "rs145301145", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs145301145#frequency_tab" }, { "id": "rs145301145", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs145301145" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 424, "end_pos": 424, "sequence_org": "S", "sequence_mut": "W", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->W).", "chr_id": "8", "chr_pos": "23191830", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S424", "keywords": [ "ebi", "germline" ] } ], "mutagenesis": [ { "start_pos": 261, "end_pos": 261, "sequence_org": "C", "sequence_mut": "S", "comment": "No effect on palmitoylation. Loss of palmitoylation, decreased association with membranes, decreased oligomerization, decreased death-induced signaling complex assembly associated with decreased function in TRAIL-induced cell death; when associated with S-262 and S-263.", "evidence": [ { "database": "UniProtKB", "id": "O00220", "url": "https://www.uniprot.org/uniprot/O00220" }, { "database": "PubMed", "id": "19090789", "url": "https://glygen.org/publication/PubMed/19090789" }, { "database": "PubMed", "id": "22240897", "url": "https://glygen.org/publication/PubMed/22240897" } ] }, { "start_pos": 262, "end_pos": 262, "sequence_org": "C", "sequence_mut": "S", "comment": "No effect on palmitoylation. Loss of palmitoylation, decreased association with membranes, decreased oligomerization, decreased death-induced signaling complex assembly associated with decreased function in TRAIL-induced cell death; when associated with S-261 and S-263.", "evidence": [ { "database": "UniProtKB", "id": "O00220", "url": "https://www.uniprot.org/uniprot/O00220" }, { "database": "PubMed", "id": "19090789", "url": "https://glygen.org/publication/PubMed/19090789" } ] }, { "start_pos": 263, "end_pos": 263, "sequence_org": "C", "sequence_mut": "S", "comment": "No effect on palmitoylation. Loss of palmitoylation, decreased association with membranes, decreased oligomerization, decreased death-induced signaling complex assembly associated with decreased function in TRAIL-induced cell death; when associated with S-261 and S-262.", "evidence": [ { "database": "UniProtKB", "id": "O00220", "url": "https://www.uniprot.org/uniprot/O00220" }, { "database": "PubMed", "id": "19090789", "url": "https://glygen.org/publication/PubMed/19090789" } ] }, { "start_pos": 268, "end_pos": 268, "sequence_org": "C", "sequence_mut": "S", "comment": "No effect on palmitoylation.", "evidence": [ { "database": "UniProtKB", "id": "O00220", "url": "https://www.uniprot.org/uniprot/O00220" }, { "database": "PubMed", "id": "19090789", "url": "https://glygen.org/publication/PubMed/19090789" } ] }, { "start_pos": 274, "end_pos": 274, "sequence_org": "C", "sequence_mut": "S", "comment": "No effect on palmitoylation.", "evidence": [ { "database": "UniProtKB", "id": "O00220", "url": "https://www.uniprot.org/uniprot/O00220" }, { "database": "PubMed", "id": "19090789", "url": "https://glygen.org/publication/PubMed/19090789" } ] }, { "start_pos": 279, "end_pos": 279, "sequence_org": "C", "sequence_mut": "S", "comment": "No effect on palmitoylation.", "evidence": [ { "database": "UniProtKB", "id": "O00220", "url": "https://www.uniprot.org/uniprot/O00220" }, { "database": "PubMed", "id": "19090789", "url": "https://glygen.org/publication/PubMed/19090789" } ] } ], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "71.96", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000104689", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000104689" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "80.92", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000104689", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000104689" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "82.96", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000104689", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000104689" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "71.83", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000104689", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000104689" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "80.56", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000104689", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000104689" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "72.31", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000104689", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000104689" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "73.28", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000104689", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000104689" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "78.54", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000104689", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000104689" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "70.72", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000104689", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000104689" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "76.19", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000104689", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000104689" } ] } ], "expression_disease": [ { "significant": "No", "trend": "down", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "O00220", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O00220" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "O00220", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O00220" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "O00220", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O00220" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "O00220", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O00220" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "O00220", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O00220" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "No", "trend": "down", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "O00220", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O00220" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "O00220", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O00220" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "O00220", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O00220" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "O00220", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O00220" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "O00220", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O00220" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "O00220", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O00220" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "O00220", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O00220" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O00220", "url": "https://www.uniprot.org/uniprot/O00220" } ], "common_name": "Human" } ], "gene": [ { "name": "TNFRSF10A", "url": "https://www.uniprot.org/uniprot/O00220", "locus": { "chromosome": "8", "start_pos": 23190452, "end_pos": 23225102, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000104689", "url": "https://www.ensembl.org/id/ENSG00000104689" } ] } } ], "crossref": [ { "id": "ENSG00000104689", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000104689", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "O00220", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O00220", "database": "BioMuta", "categories": [ "Variation" ] }, { "id": "cd08315", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd08315", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd10580", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd10580", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "CHEMBL3551", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL3551", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "TNFRSF10A", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=TNFRSF10A", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "8797", "url": "https://www.ncbi.nlm.nih.gov/gene/8797", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "11904", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=11904", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "O00220", "url": "https://www.ebi.ac.uk/intact/interactors/id:O00220*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR000488", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000488", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR001368", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001368", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR011029", "url": "https://www.ebi.ac.uk/interpro/entry/IPR011029", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR020465", "url": "https://www.ebi.ac.uk/interpro/entry/IPR020465", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR034024", "url": "https://www.ebi.ac.uk/interpro/entry/IPR034024", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR034029", "url": "https://www.ebi.ac.uk/interpro/entry/IPR034029", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:8797", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:8797", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "603611", "url": "http://www.omim.org/entry/603611", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_O00220", "url": "https://www.nextprot.org/entry/NX_O00220", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "O00220", "url": "https://oglcnac.org/atlas/detail/O00220", "database": "O-GlcNAc Atlas", "categories": [ "Glycoproteomics" ] }, { "id": "O00220", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O00220", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "CAKCKPG", "url": "https://omabrowser.org/oma/group/CAKCKPG/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "4604019at2759", "url": "http://www.orthodb.org/?query=4604019at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR46330", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR46330", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR46330:SF12", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR46330:SF12", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "5CIR", "url": "https://www.rcsb.org/structure/5CIR", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00020", "url": "http://pfam.xfam.org/family/PF00020", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF00531", "url": "http://pfam.xfam.org/family/PF00531", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "O00220", "url": "https://pharos.nih.gov/targets/O00220", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR:000050628", "url": "https://proconsortium.org/app/entry/PR:000050628", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR_O00220", "url": "http://purl.obolibrary.org/obo/PR_O00220", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-140534", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140534", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-3371378", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3371378", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-5213460", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5213460", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-5218900", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5218900", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-6803211", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803211", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-69416", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69416", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-75158", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75158", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_003835", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003835", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "O00220", "url": "DISABLED", "database": "UniCarbKB", "categories": [ "Glycoproteomics" ] }, { "id": "E5RFH1", "url": "https://www.uniprot.org/uniprot/E5RFH1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E5RFH1-1", "url": "https://www.uniprot.org/uniprot/E5RFH1-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F8U8C0", "url": "https://www.uniprot.org/uniprot/F8U8C0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F8U8C0-1", "url": "https://www.uniprot.org/uniprot/F8U8C0-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O00220", "url": "https://www.uniprot.org/uniprot/O00220", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O00220-1", "url": "https://www.uniprot.org/uniprot/O00220-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MAPPPARVHLGAFLAVTPNPGSAASGTEAAAATPSKVWGSSAGRIEPRGGGRGALPTSMGQHGPSARARAGRAPGPRPAREASPRLRVHKTFKFVVVGVLLQVVPSSAATIKLHDQSIGTQQWEHSPLGELCPPGSHRSEHPGACNRCTEGVGYTNASNNLFACLPCTACKSDEEERSPCTTTRNTACQCKPGTFRNDNSAEMCRKCSRGCPRGMVKVKDCTPWSDIECVHKESGNGHNIWVILVVTLVVPLLLVAVLIVCCCIGSGCGGDPKCMDRVCFWRLGLLRGPGAEDNAHNEILSNADSLSTFVSEQQMESQEPADLTGVTVQSPGEAQCLLGPAEAEGSQRRRLLVPANGADPTETLMLFFDKFANIVPFDSWDQLMRQLDLTKNEIDVVRAGTAGPGDALYAMLMKWVNKTGRNASIHTLLDALERMEERHAREKIQDLLVDSGKFIYLEDGTGSAVSLE", "length": 468, "header": "sp|O00220-1|TR10A_HUMAN Isoform 1 of Tumor necrosis factor receptor superfamily member 10A OS=Homo sapiens OX=9606 GN=TNFRSF10A PE=1 SV=3 CANONICAL=O00220-1" }, "isoforms": [ { "isoform_ac": "E5RFH1-1", "url": "", "sequence": { "sequence": "MCRKCSRGCPRGMVKVKDCTPWSDIECVHKESGNGHNIWVILVVTLVVPLLLVAVLIVCCCIGSGCGGDPKCMDR", "length": 75, "header": "tr|E5RFH1-1|E5RFH1_HUMAN Computationally mapped isoform of TNF receptor superfamily member 10a OS=Homo sapiens OX=9606 GN=TNFRSF10A PE=1 SV=1 CANONICAL=O00220-1" }, "locus": { "chromosome": "8", "start_pos": 23201830, "end_pos": 23199886, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000524158.5", "url": "https://www.ensembl.org/id/ENST00000524158.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000428884.1", "url": "https://www.ensembl.org/id/ENSP00000428884.1" } ] } }, { "isoform_ac": "F8U8C0-1", "url": "", "sequence": { "sequence": "MAPPPARVHLACKSDEEERSPCTTTRNTACQCKPGTFRNDNSAEMCRKCSRGCPRGMVKVKDCTPWSDIECVHKESGNGHNIWVILVVTLVVPLLLVAVLIVCCCIGSGCGGDPKCMDRVCFWRLGLLRGPGAEDNAHNEILSNADSLSTFVSEQQMESQEPADLTGVTVQSPGEAQCLLGPAEAEGSQRRRLLVPANGADPTETLMLFFDKFANIVPFDSWDQLMRQLDLTKNEIDVVRAGTAGPGDALYAMLMKWVNKTGRNASIHTLLDALERMEERHAREKIQDLLVDSGKFIYLEDGTGSAVSLE", "length": 310, "header": "tr|F8U8C0-1|F8U8C0_HUMAN Computationally mapped isoform of Tumor necrosis factor receptor superfamily member 10a variant 2 OS=Homo sapiens OX=9606 GN=TNFRSF10A PE=1 SV=1 CANONICAL=O00220-1" }, "locus": { "chromosome": "8", "start_pos": 23225061, "end_pos": 23191697, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000613472.1", "url": "https://www.ensembl.org/id/ENST00000613472.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000480778.1", "url": "https://www.ensembl.org/id/ENSP00000480778.1" } ] } }, { "isoform_ac": "O00220-1", "url": "", "sequence": { "sequence": "MAPPPARVHLGAFLAVTPNPGSAASGTEAAAATPSKVWGSSAGRIEPRGGGRGALPTSMGQHGPSARARAGRAPGPRPAREASPRLRVHKTFKFVVVGVLLQVVPSSAATIKLHDQSIGTQQWEHSPLGELCPPGSHRSEHPGACNRCTEGVGYTNASNNLFACLPCTACKSDEEERSPCTTTRNTACQCKPGTFRNDNSAEMCRKCSRGCPRGMVKVKDCTPWSDIECVHKESGNGHNIWVILVVTLVVPLLLVAVLIVCCCIGSGCGGDPKCMDRVCFWRLGLLRGPGAEDNAHNEILSNADSLSTFVSEQQMESQEPADLTGVTVQSPGEAQCLLGPAEAEGSQRRRLLVPANGADPTETLMLFFDKFANIVPFDSWDQLMRQLDLTKNEIDVVRAGTAGPGDALYAMLMKWVNKTGRNASIHTLLDALERMEERHAREKIQDLLVDSGKFIYLEDGTGSAVSLE", "length": 468, "header": "sp|O00220-1|TR10A_HUMAN Isoform 1 of Tumor necrosis factor receptor superfamily member 10A OS=Homo sapiens OX=9606 GN=TNFRSF10A PE=1 SV=3 CANONICAL=O00220-1" }, "locus": { "chromosome": "8", "start_pos": 23225061, "end_pos": 23191697, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000221132.8", "url": "https://www.ensembl.org/id/ENST00000221132.8" }, { "database": "Ensembl Peptide", "id": "ENSP00000221132.3", "url": "https://www.ensembl.org/id/ENSP00000221132.3" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "LHDQSIGTQQWEHSPLGELCPPGSHR", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 113, "start_aa": "Leu", "end_pos": 138, "end_aa": "Arg", "evidence": [ { "id": "O00220", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 117, "start_aa": "Ser", "end_pos": 117, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser117", "evidence": [ { "id": "O00220", "database": "UniCarbKB", "url": "" }, { "id": "25813380", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25813380" }, { "id": "10.1074/mcp.M114.046862", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1074/mcp.M114.046862" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 120, "start_aa": "Thr", "end_pos": 120, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr120", "evidence": [ { "id": "O00220", "database": "UniCarbKB", "url": "" }, { "id": "25813380", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25813380" }, { "id": "10.1074/mcp.M114.046862", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1074/mcp.M114.046862" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 126, "start_aa": "Ser", "end_pos": 126, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser126", "evidence": [ { "id": "O00220", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 156, "start_aa": "Asn", "end_pos": 156, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn156", "evidence": [ { "id": "O00220", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O00220#ptm_processing" }, { "id": "24190977", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24190977" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 159, "start_aa": "Asn", "end_pos": 159, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn159", "evidence": [ { "id": "24190977", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24190977" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 160, "start_aa": "Asn", "end_pos": 160, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn160", "evidence": [ { "id": "24190977", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24190977" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 424, "start_aa": "Ser", "end_pos": 424, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser424", "evidence": [ { "id": "O00220", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O00220" }, { "id": "30987996", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30987996" }, { "id": "O00220", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O00220" } ] } ], "phosphorylation": [ { "start_pos": 424, "end_pos": 424, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O00220", "url": "https://www.uniprot.org/uniprot/O00220" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "iPTMnet", "id": "O00220", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O00220" }, { "database": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" } ], "site_lbl": "Ser424" }, { "start_pos": 461, "end_pos": 461, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "phospho.ELM", "id": "O00220", "url": "http://phospho.elm.eu.org/byAccession/O00220.html" }, { "database": "iPTMnet", "id": "O00220", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O00220" }, { "database": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" } ], "site_lbl": "Thr461" }, { "start_pos": 463, "end_pos": 463, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O00220", "url": "https://www.uniprot.org/uniprot/O00220" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "iPTMnet", "id": "O00220", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O00220" }, { "database": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" }, { "database": "phospho.ELM", "id": "O00220", "url": "http://phospho.elm.eu.org/byAccession/O00220.html" }, { "database": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" } ], "site_lbl": "Ser463" }, { "start_pos": 466, "end_pos": 466, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O00220", "url": "https://www.uniprot.org/uniprot/O00220" }, { "database": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "iPTMnet", "id": "O00220", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O00220" }, { "database": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" }, { "database": "phospho.ELM", "id": "O00220", "url": "http://phospho.elm.eu.org/byAccession/O00220.html" } ], "site_lbl": "Ser466" }, { "start_pos": 83, "end_pos": 83, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "phospho.ELM", "id": "O00220", "url": "http://phospho.elm.eu.org/byAccession/O00220.html" }, { "database": "iPTMnet", "id": "O00220", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O00220" }, { "database": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" } ], "site_lbl": "Ser83" } ], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported_with_glycan", "glycoprotein_reported" ], "publication": [ { "title": "Precision mapping of the human O-GalNAc glycoproteome through SimpleCell technology", "journal": "EMBO J", "date": "2013", "authors": "Steentoft C., Vakhrushev S.Y., Joshi H.J., Kong Y., Vester-Christensen M.B., Schjoldager K.T., Lavrsen K., Dabelsteen S., Pedersen N.B., Marcos-Silva L., Gupta R., Bennett E.P., Mandel U., Brunak S., Wandall H.H., Levery S.B., Clausen H.", "evidence": [ { "database": "UniCarbKB", "id": "O00220", "url": "" } ], "reference": [ { "type": "DOI", "id": "10.1038/emboj.2013.79", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "title": "Probing the O-Glycoproteome of Gastric Cancer Cell Lines for Biomarker Discovery", "journal": "Molecular & Cellular Proteomics", "date": "2015", "authors": "Campos D., Freitas D., Gomes J., Magalh\u00e3es A., Steentoft C., Gomes C., Vester-Christensen M. B., Ferreira J. A., Afonso L. P., Santos L. L., Pinto de Sousa J., Mandel U., Clausen H., Vakhrushev S. Y., Reis C. A.", "evidence": [ { "database": "UniCarbKB", "id": "O00220", "url": "" } ], "reference": [ { "type": "DOI", "id": "10.1074/mcp.M114.046862", "url": "https://glygen.org/publication/DOI/10.1074/mcp.M114.046862" } ] }, { "title": "The biology of the 17-1A antigen (Ep-CAM).", "journal": "Journal of molecular medicine (Berlin, Germany)", "date": "1999", "authors": "Balzar M, Winter MJ, de Boer CJ, Litvinov SV", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "10606205", "url": "https://glygen.org/publication/PubMed/10606205" } ] }, { "title": "The CD2-subset of the Ig superfamily of cell surface molecules: receptor-ligand pairs expressed by NK cells and other immune cells.", "journal": "Seminars in immunology", "date": "2000", "authors": "Tangye SG, Phillips JH, Lanier LL", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "10764623", "url": "https://glygen.org/publication/PubMed/10764623" } ] }, { "title": "Wild-type p53 transactivates the KILLER/DR5 gene through an intronic sequence-specific DNA-binding site.", "journal": "Oncogene", "date": "2000", "authors": "Takimoto R, El-Deiry WS", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803211", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803211" } ], "reference": [ { "type": "PubMed", "id": "10777207", "url": "https://glygen.org/publication/PubMed/10777207" } ] }, { "title": "The caspase-8 inhibitor FLIP promotes activation of NF-kappaB and Erk signaling pathways.", "journal": "Current biology : CB", "date": "2000", "authors": "Kataoka T, Budd RC, Holler N, Thome M, Martinon F, Irmler M, Burns K, Hahne M, Kennedy N, Kovacsovics M, Tschopp J", "evidence": [ { "database": "Reactome", "id": "R-HSA-3371378", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3371378" } ], "reference": [ { "type": "PubMed", "id": "10837247", "url": "https://glygen.org/publication/PubMed/10837247" } ] }, { "title": "FADD/MORT1 and caspase-8 are recruited to TRAIL receptors 1 and 2 and are essential for apoptosis mediated by TRAIL receptor 2.", "journal": "Immunity", "date": "2000", "authors": "Sprick MR, Weigand MA, Rieser E, Rauch CT, Juo P, Blenis J, Krammer PH, Walczak H", "evidence": [ { "database": "Reactome", "id": "R-HSA-69416", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69416" } ], "reference": [ { "type": "PubMed", "id": "10894160", "url": "https://glygen.org/publication/PubMed/10894160" } ] }, { "title": "Molecular analysis of neisserial Opa protein interactions with the CEA family of receptors: identification of determinants contributing to the differential specificities of binding.", "journal": "Cellular microbiology", "date": "1999", "authors": "Popp A, Dehio C, Grunert F, Meyer TF, Gray-Owen SD", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "11207550", "url": "https://glygen.org/publication/PubMed/11207550" } ] }, { "title": "Characterization of residues and sequences of the carbohydrate recognition domain required for cell surface localization and ligand binding of human lectin-like oxidized LDL receptor.", "journal": "Journal of cell science", "date": "2001", "authors": "Shi X, Niimi S, Ohtani T, Machida S", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "11256994", "url": "https://glygen.org/publication/PubMed/11256994" } ] }, { "title": "Evidence that the death receptor DR4 is a DNA damage-inducible, p53-regulated gene.", "journal": "Journal of cellular physiology", "date": "2001", "authors": "Guan B, Yue P, Clayman GL, Sun SY", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803211", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803211" } ], "reference": [ { "type": "PubMed", "id": "11382926", "url": "https://glygen.org/publication/PubMed/11382926" } ] }, { "title": "Fas-associated death domain protein (FADD) and caspase-8 mediate up-regulation of c-Fos by Fas ligand and tumor necrosis factor-related apoptosis-inducing ligand (TRAIL) via a FLICE inhibitory protein (FLIP)-regulated pathway.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Siegmund D, Mauri D, Peters N, Juo P, Thome M, Reichwein M, Blenis J, Scheurich P, Tschopp J, Wajant H", "evidence": [ { "database": "Reactome", "id": "R-HSA-3371378", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3371378" } ], "reference": [ { "type": "PubMed", "id": "11384965", "url": "https://glygen.org/publication/PubMed/11384965" } ] }, { "title": "NF-kappaB signals induce the expression of c-FLIP.", "journal": "Molecular and cellular biology", "date": "2001", "authors": "Micheau O, Lens S, Gaide O, Alevizopoulos K, Tschopp J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5218900", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5218900" } ], "reference": [ { "type": "PubMed", "id": "11463813", "url": "https://glygen.org/publication/PubMed/11463813" } ] }, { "title": "CD84 functions as a homophilic adhesion molecule and enhances IFN-gamma secretion: adhesion is mediated by Ig-like domain 1.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2001", "authors": "Martin M, Romero X, de la Fuente MA, Tovar V, Zapater N, Esplugues E, Pizcueta P, Bosch J, Engel P", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "11564780", "url": "https://glygen.org/publication/PubMed/11564780" } ] }, { "title": "Caspase-10 is an initiator caspase in death receptor signaling.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2001", "authors": "Wang J, Chun HJ, Wong W, Spencer DM, Lenardo MJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-75158", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75158" } ], "reference": [ { "type": "PubMed", "id": "11717445", "url": "https://glygen.org/publication/PubMed/11717445" } ] }, { "title": "Expression of Fc alpha/mu receptor by human mesangial cells: a candidate receptor for immune complex deposition in IgA nephropathy.", "journal": "Biochemical and biophysical research communications", "date": "2002", "authors": "McDonald KJ, Cameron AJ, Allen JM, Jardine AG", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "11779189", "url": "https://glygen.org/publication/PubMed/11779189" } ] }, { "title": "JAM-1 is a ligand of the beta(2) integrin LFA-1 involved in transendothelial migration of leukocytes.", "journal": "Nature immunology", "date": "2002", "authors": "Ostermann G, Weber KS, Zernecke A, Schroder A, Weber C", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "11812992", "url": "https://glygen.org/publication/PubMed/11812992" } ] }, { "title": "JAM2 interacts with alpha4beta1. Facilitation by JAM3.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Cunningham SA, Rodriguez JM, Arrate MP, Tran TM, Brock TA", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "12070135", "url": "https://glygen.org/publication/PubMed/12070135" } ] }, { "title": "Tipping the balance between necrosis and apoptosis in human and murine cells treated with interferon and dsRNA.", "journal": "Cell death and differentiation", "date": "2002", "authors": "Kalai M, Van Loo G, Vanden Berghe T, Meeus A, Burm W, Saelens X, Vandenabeele P", "evidence": [ { "database": "Reactome", "id": "R-HSA-140534", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140534" } ], "reference": [ { "type": "PubMed", "id": "12181749", "url": "https://glygen.org/publication/PubMed/12181749" } ] }, { "title": "Caspase-10 is recruited to and activated at the native TRAIL and CD95 death-inducing signalling complexes in a FADD-dependent manner but can not functionally substitute caspase-8.", "journal": "The EMBO journal", "date": "2002", "authors": "Sprick MR, Rieser E, Stahl H, Grosse-Wilde A, Weigand MA, Walczak H", "evidence": [ { "database": "Reactome", "id": "R-HSA-75158", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75158" } ], "reference": [ { "type": "PubMed", "id": "12198154", "url": "https://glygen.org/publication/PubMed/12198154" } ] }, { "title": "The junctional adhesion molecule 3 (JAM-3) on human platelets is a counterreceptor for the leukocyte integrin Mac-1.", "journal": "The Journal of experimental medicine", "date": "2002", "authors": "Santoso S, Sachs UJ, Kroll H, Linder M, Ruf A, Preissner KT, Chavakis T", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "12208882", "url": "https://glygen.org/publication/PubMed/12208882" } ] }, { "title": "The long form of FLIP is an activator of caspase-8 at the Fas death-inducing signaling complex.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Micheau O, Thome M, Schneider P, Holler N, Tschopp J, Nicholson DW, Briand C, Grutter MG", "evidence": [ { "database": "Reactome", "id": "R-HSA-3371378", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3371378" } ], "reference": [ { "type": "PubMed", "id": "12215447", "url": "https://glygen.org/publication/PubMed/12215447" } ] }, { "title": "Plasmodium falciparum erythrocyte invasion through glycophorin C and selection for Gerbich negativity in human populations.", "journal": "Nature medicine", "date": "2003", "authors": "Maier AG, Duraisingh MT, Reeder JC, Patel SS, Kazura JW, Zimmerman PA, Cowman AF", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "12469115", "url": "https://glygen.org/publication/PubMed/12469115" } ] }, { "title": "A unified model for apical caspase activation.", "journal": "Molecular cell", "date": "2003", "authors": "Boatright KM, Renatus M, Scott FL, Sperandio S, Shin H, Pedersen IM, Ricci JE, Edris WA, Sutherlin DP, Green DR, Salvesen GS", "evidence": [ { "database": "Reactome", "id": "R-HSA-69416", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69416" } ], "reference": [ { "type": "PubMed", "id": "12620239", "url": "https://glygen.org/publication/PubMed/12620239" } ] }, { "title": "Insights into the regulatory mechanism for caspase-8 activation.", "journal": "Molecular cell", "date": "2003", "authors": "Donepudi M, Mac Sweeney A, Briand C, Grutter MG", "evidence": [ { "database": "Reactome", "id": "R-HSA-140534", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140534" } ], "reference": [ { "type": "PubMed", "id": "12620240", "url": "https://glygen.org/publication/PubMed/12620240" } ] }, { "title": "MIF signal transduction initiated by binding to CD74.", "journal": "The Journal of experimental medicine", "date": "2003", "authors": "Leng L, Metz CN, Fang Y, Xu J, Donnelly S, Baugh J, Delohery T, Chen Y, Mitchell RA, Bucala R", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "12782713", "url": "https://glygen.org/publication/PubMed/12782713" } ] }, { "title": "Induction of TNF receptor I-mediated apoptosis via two sequential signaling complexes.", "journal": "Cell", "date": "2003", "authors": "Micheau O, Tschopp J", "evidence": [ { "database": "Reactome", "id": "R-HSA-69416", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69416" } ], "reference": [ { "type": "PubMed", "id": "12887920", "url": "https://glygen.org/publication/PubMed/12887920" } ] }, { "title": "Interdimer processing mechanism of procaspase-8 activation.", "journal": "The EMBO journal", "date": "2003", "authors": "Chang DW, Xing Z, Capacio VL, Peter ME, Yang X", "evidence": [ { "database": "Reactome", "id": "R-HSA-69416", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69416" } ], "reference": [ { "type": "PubMed", "id": "12912912", "url": "https://glygen.org/publication/PubMed/12912912" } ] }, { "title": "Structural biology of the cell adhesion protein CD2: from molecular recognition to protein folding and design.", "journal": "Current protein & peptide science", "date": "2003", "authors": "Wilkins AL, Yang W, Yang JJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "14529530", "url": "https://glygen.org/publication/PubMed/14529530" } ] }, { "title": "Platelet-monocyte complexes support monocyte adhesion to endothelium by enhancing secondary tethering and cluster formation.", "journal": "Arteriosclerosis, thrombosis, and vascular biology", "date": "2004", "authors": "da Costa Martins P, van den Berk N, Ulfman LH, Koenderman L, Hordijk PL, Zwaginga JJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "14615387", "url": "https://glygen.org/publication/PubMed/14615387" } ] }, { "title": "Tumor necrosis factor-related apoptosis-inducing ligand (TRAIL) decoy receptor TRAIL-R3 is up-regulated by p53 in breast tumor cells through a mechanism involving an intronic p53-binding site.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Ruiz de Almodovar C, Ruiz-Ruiz C, Rodriguez A, Ortiz-Ferron G, Redondo JM, Lopez-Rivas A", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803211", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803211" } ], "reference": [ { "type": "PubMed", "id": "14623878", "url": "https://glygen.org/publication/PubMed/14623878" } ] }, { "title": "Human lectin-like oxidized low-density lipoprotein receptor-1 functions as a dimer in living cells.", "journal": "DNA and cell biology", "date": "2004", "authors": "Xie Q, Matsunaga S, Niimi S, Ogawa S, Tokuyasu K, Sakakibara Y, Machida S", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "15000751", "url": "https://glygen.org/publication/PubMed/15000751" } ] }, { "title": "N-terminal fragment of c-FLIP(L) processed by caspase 8 specifically interacts with TRAF2 and induces activation of the NF-kappaB signaling pathway.", "journal": "Molecular and cellular biology", "date": "2004", "authors": "Kataoka T, Tschopp J", "evidence": [ { "database": "Reactome", "id": "R-HSA-3371378", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3371378" } ], "reference": [ { "type": "PubMed", "id": "15024054", "url": "https://glygen.org/publication/PubMed/15024054" } ] }, { "title": "p53 upregulates death receptor 4 expression through an intronic p53 binding site.", "journal": "Cancer research", "date": "2004", "authors": "Liu X, Yue P, Khuri FR, Sun SY", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803211", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803211" } ], "reference": [ { "type": "PubMed", "id": "15289308", "url": "https://glygen.org/publication/PubMed/15289308" } ] }, { "title": "NFkappaB activation by Fas is mediated through FADD, caspase-8, and RIP and is inhibited by FLIP.", "journal": "The Journal of cell biology", "date": "2004", "authors": "Kreuz S, Siegmund D, Rumpf JJ, Samel D, Leverkus M, Janssen O, Hacker G, Dittrich-Breiholz O, Kracht M, Scheurich P, Wajant H", "evidence": [ { "database": "Reactome", "id": "R-HSA-3371378", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3371378" } ], "reference": [ { "type": "PubMed", "id": "15289496", "url": "https://glygen.org/publication/PubMed/15289496" } ] }, { "title": "The functional interaction of the beta 2 integrin lymphocyte function-associated antigen-1 with junctional adhesion molecule-A is mediated by the I domain.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2004", "authors": "Fraemohs L, Koenen RR, Ostermann G, Heinemann B, Weber C", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "15528364", "url": "https://glygen.org/publication/PubMed/15528364" } ] }, { "title": "Involvement of JAM-A in mononuclear cell recruitment on inflamed or atherosclerotic endothelium: inhibition by soluble JAM-A.", "journal": "Arteriosclerosis, thrombosis, and vascular biology", "date": "2005", "authors": "Ostermann G, Fraemohs L, Baltus T, Schober A, Lietz M, Zernecke A, Liehn EA, Weber C", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "15681301", "url": "https://glygen.org/publication/PubMed/15681301" } ] }, { "title": "Integrin alpha8beta1-fibronectin interactions promote cell survival via PI3 kinase pathway.", "journal": "Biochemical and biophysical research communications", "date": "2005", "authors": "Farias E, Lu M, Li X, Schnapp LM", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "15721307", "url": "https://glygen.org/publication/PubMed/15721307" } ] }, { "title": "Selective knockdown of the long variant of cellular FLICE inhibitory protein augments death receptor-mediated caspase-8 activation and apoptosis.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Sharp DA, Lawrence DA, Ashkenazi A", "evidence": [ { "database": "Reactome", "id": "R-HSA-3371378", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3371378" } ], "reference": [ { "type": "PubMed", "id": "15760909", "url": "https://glygen.org/publication/PubMed/15760909" } ] }, { "title": "p53-Dependent and p53-independent induction of insulin-like growth factor binding protein-3 by deoxyribonucleic acid damage and hypoxia.", "journal": "The Journal of clinical endocrinology and metabolism", "date": "2005", "authors": "Grimberg A, Coleman CM, Burns TF, Himelstein BP, Koch CJ, Cohen P, El-Deiry WS", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803211", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803211" } ], "reference": [ { "type": "PubMed", "id": "15769996", "url": "https://glygen.org/publication/PubMed/15769996" } ] }, { "title": "Apoptosis induced by the toll-like receptor adaptor TRIF is dependent on its receptor interacting protein homotypic interaction motif.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2005", "authors": "Kaiser WJ, Offermann MK", "evidence": [ { "database": "Reactome", "id": "R-HSA-140534", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140534" } ], "reference": [ { "type": "PubMed", "id": "15814722", "url": "https://glygen.org/publication/PubMed/15814722" } ] }, { "title": "Human erythrocyte glycophorins: protein and gene structure analyses.", "journal": "Transfusion medicine reviews", "date": "1992", "authors": "Cartron JP, Rahuel C", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "1591491", "url": "https://glygen.org/publication/PubMed/1591491" } ] }, { "title": "Association of death receptor 4 haplotype 626C-683C with an increased breast cancer risk.", "journal": "Carcinogenesis", "date": "2005", "authors": "Frank B, Hemminki K, Shanmugam KS, Meindl A, Klaes R, Schmutzler RK, Wappenschmidt B, Untch M, Bugert P, Bartram CR, Burwinkel B", "evidence": [ { "database": "Entrez", "id": "8797", "url": "https://www.ncbi.nlm.nih.gov/gene/8797" } ], "reference": [ { "type": "PubMed", "id": "15975957", "url": "https://glygen.org/publication/PubMed/15975957" } ] }, { "title": "Decoy receptor 2 (DcR2) is a p53 target gene and regulates chemosensitivity.", "journal": "Cancer research", "date": "2005", "authors": "Liu X, Yue P, Khuri FR, Sun SY", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803211", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803211" } ], "reference": [ { "type": "PubMed", "id": "16230375", "url": "https://glygen.org/publication/PubMed/16230375" } ] }, { "title": "beta 1 integrin function in vivo: adhesion, migration and more.", "journal": "Cancer metastasis reviews", "date": "2005", "authors": "Brakebusch C, Fassler R", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "16258728", "url": "https://glygen.org/publication/PubMed/16258728" } ] }, { "title": "Junctional adhesion molecules (JAM)-B and -C contribute to leukocyte extravasation to the skin and mediate cutaneous inflammation.", "journal": "The Journal of investigative dermatology", "date": "2005", "authors": "Ludwig RJ, Zollner TM, Santoso S, Hardt K, Gille J, Baatz H, Johann PS, Pfeffer J, Radeke HH, Schon MP, Kaufmann R, Boehncke WH, Podda M", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "16297198", "url": "https://glygen.org/publication/PubMed/16297198" } ] }, { "title": "CD48 stimulation by 2B4 (CD244)-expressing targets activates human NK cells.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2006", "authors": "Messmer B, Eissmann P, Stark S, Watzl C", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "16585556", "url": "https://glygen.org/publication/PubMed/16585556" } ] }, { "title": "The SIRP family of receptors and immune regulation.", "journal": "Nature reviews. Immunology", "date": "2006", "authors": "Barclay AN, Brown MH", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "16691243", "url": "https://glygen.org/publication/PubMed/16691243" } ] }, { "title": "Signalling and functional diversity within the Axl subfamily of receptor tyrosine kinases.", "journal": "Cytokine & growth factor reviews", "date": "2006", "authors": "Hafizi S, Dahlback B", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "16737840", "url": "https://glygen.org/publication/PubMed/16737840" } ] }, { "title": "Junctional adhesion molecule-A regulates cell migration and resistance to shear stress.", "journal": "Journal of cellular physiology", "date": "2006", "authors": "Huang H, Cruz F, Bazzoni G", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "16783819", "url": "https://glygen.org/publication/PubMed/16783819" } ] }, { "title": "Gas6 and protein S. Vitamin K-dependent ligands for the Axl receptor tyrosine kinase subfamily.", "journal": "The FEBS journal", "date": "2006", "authors": "Hafizi S, Dahlback B", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "17064312", "url": "https://glygen.org/publication/PubMed/17064312" } ] }, { "title": "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.", "journal": "Cell", "date": "2006", "authors": "Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M", "evidence": [ { "database": "UniProtKB", "id": "O00220", "url": "https://www.uniprot.org/uniprot/O00220" }, { "database": "iPTMnet", "id": "O00220", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O00220" } ], "reference": [ { "type": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" } ] }, { "title": "JAM-C regulates tight junctions and integrin-mediated cell adhesion and migration.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Mandicourt G, Iden S, Ebnet K, Aurrand-Lions M, Imhof BA", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "17099249", "url": "https://glygen.org/publication/PubMed/17099249" } ] }, { "title": "PECAM-1, a key player in neuroinflammation.", "journal": "European journal of neurology", "date": "2006", "authors": "Kalinowska A, Losy J", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "17116209", "url": "https://glygen.org/publication/PubMed/17116209" } ] }, { "title": "GPI-anchored CEA family glycoproteins CEA and CEACAM6 mediate their biological effects through enhanced integrin alpha5beta1-fibronectin interaction.", "journal": "Journal of cellular physiology", "date": "2007", "authors": "Ordonez C, Zhai AB, Camacho-Leal P, Demarte L, Fan MM, Stanners CP", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "17167768", "url": "https://glygen.org/publication/PubMed/17167768" } ] }, { "title": "Impact of salt bridges on the equilibrium binding and adhesion of human CD2 and CD58.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Bayas MV, Kearney A, Avramovic A, van der Merwe PA, Leckband DE", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "17172599", "url": "https://glygen.org/publication/PubMed/17172599" } ] }, { "title": "P-selectin glycoprotein ligand-1 is expressed on endothelial cells and mediates monocyte adhesion to activated endothelium.", "journal": "Arteriosclerosis, thrombosis, and vascular biology", "date": "2007", "authors": "da Costa Martins P, Garcia-Vallejo JJ, van Thienen JV, Fernandez-Borja M, van Gils JM, Beckers C, Horrevoets AJ, Hordijk PL, Zwaginga JJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "17322099", "url": "https://glygen.org/publication/PubMed/17322099" } ] }, { "title": "Receptor-mediated endocytosis is not required for tumor necrosis factor-related apoptosis-inducing ligand (TRAIL)-induced apoptosis.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Kohlhaas SL, Craxton A, Sun XM, Pinkoski MJ, Cohen GM", "evidence": [ { "database": "Reactome", "id": "R-HSA-75158", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75158" } ], "reference": [ { "type": "PubMed", "id": "17327223", "url": "https://glygen.org/publication/PubMed/17327223" } ] }, { "title": "Platelets recruit human dendritic cells via Mac-1/JAM-C interaction and modulate dendritic cell function in vitro.", "journal": "Arteriosclerosis, thrombosis, and vascular biology", "date": "2007", "authors": "Langer HF, Daub K, Braun G, Schonberger T, May AE, Schaller M, Stein GM, Stellos K, Bueltmann A, Siegel-Axel D, Wendel HP, Aebert H, Roecken M, Seizer P, Santoso S, Wesselborg S, Brossart P, Gawaz M", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "17379836", "url": "https://glygen.org/publication/PubMed/17379836" } ] }, { "title": "Macrophages and dendritic cells use different Axl/Mertk/Tyro3 receptors in clearance of apoptotic cells.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2007", "authors": "Seitz HM, Camenisch TD, Lemke G, Earp HS, Matsushima GK", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "17442946", "url": "https://glygen.org/publication/PubMed/17442946" } ] }, { "title": "TREM-1 ligand expression on platelets enhances neutrophil activation.", "journal": "Blood", "date": "2007", "authors": "Haselmayer P, Grosse-Hovest L, von Landenberg P, Schild H, Radsak MP", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "17452516", "url": "https://glygen.org/publication/PubMed/17452516" } ] }, { "title": "JAM-A mediates neutrophil transmigration in a stimulus-specific manner in vivo: evidence for sequential roles for JAM-A and PECAM-1 in neutrophil transmigration.", "journal": "Blood", "date": "2007", "authors": "Woodfin A, Reichel CA, Khandoga A, Corada M, Voisin MB, Scheiermann C, Haskard DO, Dejana E, Krombach F, Nourshargh S", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "17505016", "url": "https://glygen.org/publication/PubMed/17505016" } ] }, { "title": "The role of junctional adhesion molecules in vascular inflammation.", "journal": "Nature reviews. Immunology", "date": "2007", "authors": "Weber C, Fraemohs L, Dejana E", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "17525755", "url": "https://glygen.org/publication/PubMed/17525755" } ] }, { "title": "Structure of CD84 provides insight into SLAM family function.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2007", "authors": "Yan Q, Malashkevich VN, Fedorov A, Fedorov E, Cao E, Lary JW, Cole JL, Nathenson SG, Almo SC", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "17563375", "url": "https://glygen.org/publication/PubMed/17563375" } ] }, { "title": "The neutrophil-specific antigen CD177 is a counter-receptor for platelet endothelial cell adhesion molecule-1 (CD31).", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Sachs UJ, Andrei-Selmer CL, Maniar A, Weiss T, Paddock C, Orlova VV, Choi EY, Newman PJ, Preissner KT, Chavakis T, Santoso S", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "17580308", "url": "https://glygen.org/publication/PubMed/17580308" } ] }, { "title": "Epithelial cell adhesion molecule: more than a carcinoma marker and adhesion molecule.", "journal": "The American journal of pathology", "date": "2007", "authors": "Trzpis M, McLaughlin PM, de Leij LM, Harmsen MC", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "17600130", "url": "https://glygen.org/publication/PubMed/17600130" } ] }, { "title": "JAM family and related proteins in leukocyte migration (Vestweber series).", "journal": "Arteriosclerosis, thrombosis, and vascular biology", "date": "2007", "authors": "Bradfield PF, Nourshargh S, Aurrand-Lions M, Imhof BA", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "17615384", "url": "https://glygen.org/publication/PubMed/17615384" } ] }, { "title": "JAM-C regulates unidirectional monocyte transendothelial migration in inflammation.", "journal": "Blood", "date": "2007", "authors": "Bradfield PF, Scheiermann C, Nourshargh S, Ody C, Luscinskas FW, Rainger GE, Nash GB, Miljkovic-Licina M, Aurrand-Lions M, Imhof BA", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "17625065", "url": "https://glygen.org/publication/PubMed/17625065" } ] }, { "title": "The Glu228Ala polymorphism in the ligand binding domain of death receptor 4 is associated with increased risk for prostate cancer metastases.", "journal": "The Prostate", "date": "2008", "authors": "Langsenlehner T, Langsenlehner U, Renner W, Kapp KS, Krippl P, Hofmann G, Clar H, Pummer K, Mayer R", "evidence": [ { "database": "Entrez", "id": "8797", "url": "https://www.ncbi.nlm.nih.gov/gene/8797" } ], "reference": [ { "type": "PubMed", "id": "18163425", "url": "https://glygen.org/publication/PubMed/18163425" } ] }, { "title": "Arf and Rho GAP adapter protein ARAP1 participates in the mobilization of TRAIL-R1/DR4 to the plasma membrane.", "journal": "Apoptosis", "date": "2008", "authors": "S\u00edmov\u00e1 S\u00e1rka, Kl\u00edma Martin, Cermak Lukas, Sourkov\u00e1 Vladim\u00edra, Andera Ladislav", "evidence": [ { "database": "UniProtKB", "id": "O00220", "url": "https://www.uniprot.org/uniprot/O00220" } ], "reference": [ { "type": "PubMed", "id": "18165900", "url": "https://glygen.org/publication/PubMed/18165900" } ] }, { "title": "Association of TRAF2 with the short form of cellular FLICE-like inhibitory protein prevents TNFR1-mediated apoptosis.", "journal": "Journal of molecular signaling", "date": "2008", "authors": "Kim DJ, Park C, Oh B, Kim YY", "evidence": [ { "database": "Reactome", "id": "R-HSA-5218900", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5218900" } ], "reference": [ { "type": "PubMed", "id": "18190721", "url": "https://glygen.org/publication/PubMed/18190721" } ] }, { "title": "TNF signaling gets FLIPped off: TNF-induced regulation of FLIP.", "journal": "Cell cycle (Georgetown, Tex.)", "date": "2008", "authors": "Rushworth SA, Taylor A, Langa S, MacEwan DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-3371378", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3371378" } ], "reference": [ { "type": "PubMed", "id": "18256533", "url": "https://glygen.org/publication/PubMed/18256533" } ] }, { "title": "TNF-alpha induces two distinct caspase-8 activation pathways.", "journal": "Cell", "date": "2008", "authors": "Wang L, Du F, Wang X", "evidence": [ { "database": "Reactome", "id": "R-HSA-69416", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69416" } ], "reference": [ { "type": "PubMed", "id": "18485876", "url": "https://glygen.org/publication/PubMed/18485876" } ] }, { "title": "Differential responses of FLIPLong and FLIPShort-overexpressing human myeloid leukemia cells to TNF-alpha and TRAIL-initiated apoptotic signals.", "journal": "Experimental hematology", "date": "2008", "authors": "Seal S, Hockenbery DM, Spaulding EY, Kiem HP, Abbassi N, Deeg HJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-3371378", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3371378" } ], "reference": [ { "type": "PubMed", "id": "18838202", "url": "https://glygen.org/publication/PubMed/18838202" } ] }, { "title": "Identification of an antiapoptotic protein complex at death receptors.", "journal": "Cell Death Differ.", "date": "2008", "authors": "Sun M, Song L, Li Y, Zhou T, Jope RS", "evidence": [ { "database": "UniProtKB", "id": "O00220", "url": "https://www.uniprot.org/uniprot/O00220" } ], "reference": [ { "type": "PubMed", "id": "18846110", "url": "https://glygen.org/publication/PubMed/18846110" } ] }, { "title": "Palmitoylation of the TRAIL receptor DR4 confers an efficient TRAIL-induced cell death signalling.", "journal": "The Biochemical journal", "date": "2009", "authors": "Rossin A, Derouet M, Abdel-Sater F, Hueber AO", "evidence": [ { "database": "UniProtKB", "id": "O00220", "url": "https://www.uniprot.org/uniprot/O00220" } ], "reference": [ { "type": "PubMed", "id": "19090789", "url": "https://glygen.org/publication/PubMed/19090789" } ] }, { "title": "Structural and biochemical studies on procaspase-8: new insights on initiator caspase activation.", "journal": "Structure (London, England : 1993)", "date": "2009", "authors": "Keller N, Mares J, Zerbe O, Grutter MG", "evidence": [ { "database": "Reactome", "id": "R-HSA-140534", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140534" } ], "reference": [ { "type": "PubMed", "id": "19278658", "url": "https://glygen.org/publication/PubMed/19278658" } ] }, { "title": "Glycophorin B is the erythrocyte receptor of Plasmodium falciparum erythrocyte-binding ligand, EBL-1.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2009", "authors": "Mayer DC, Cofie J, Jiang L, Hartl DL, Tracy E, Kabat J, Mendoza LH, Miller LH", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "19279206", "url": "https://glygen.org/publication/PubMed/19279206" } ] }, { "title": "Mechanism of procaspase-8 activation by c-FLIPL.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2009", "authors": "Yu JW, Jeffrey PD, Shi Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-3371378", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3371378" } ], "reference": [ { "type": "PubMed", "id": "19416807", "url": "https://glygen.org/publication/PubMed/19416807" } ] }, { "title": "Receptor interacting protein kinase-3 determines cellular necrotic response to TNF-alpha.", "journal": "Cell", "date": "2009", "authors": "He S, Wang L, Miao L, Wang T, Du F, Zhao L, Wang X", "evidence": [ { "database": "Reactome", "id": "R-HSA-5213460", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5213460" } ], "reference": [ { "type": "PubMed", "id": "19524512", "url": "https://glygen.org/publication/PubMed/19524512" } ] }, { "title": "Phosphorylation-driven assembly of the RIP1-RIP3 complex regulates programmed necrosis and virus-induced inflammation.", "journal": "Cell", "date": "2009", "authors": "Cho YS, Challa S, Moquin D, Genga R, Ray TD, Guildford M, Chan FK", "evidence": [ { "database": "Reactome", "id": "R-HSA-5213460", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5213460" } ], "reference": [ { "type": "PubMed", "id": "19524513", "url": "https://glygen.org/publication/PubMed/19524513" } ] }, { "title": "Active transcription of the human FAS/CD95/TNFRSF6 gene involves the p53 family.", "journal": "Biochemical and biophysical research communications", "date": "2009", "authors": "Schilling T, Schleithoff ES, Kairat A, Melino G, Stremmel W, Oren M, Krammer PH, Muller M", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803211", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803211" } ], "reference": [ { "type": "PubMed", "id": "19615968", "url": "https://glygen.org/publication/PubMed/19615968" } ] }, { "title": "Global effects of kinase inhibitors on signaling networks revealed by quantitative phosphoproteomics.", "journal": "Molecular & cellular proteomics : MCP", "date": "2009", "authors": "Pan C, Olsen JV, Daub H, Mann M", "evidence": [ { "database": "iPTMnet", "id": "O00220", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O00220" } ], "reference": [ { "type": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" } ] }, { "title": "Reconstitution of the death-inducing signaling complex reveals a substrate switch that determines CD95-mediated death or survival.", "journal": "Molecular cell", "date": "2009", "authors": "Hughes MA, Harper N, Butterworth M, Cain K, Cohen GM, MacFarlane M", "evidence": [ { "database": "Reactome", "id": "R-HSA-69416", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69416" } ], "reference": [ { "type": "PubMed", "id": "19683492", "url": "https://glygen.org/publication/PubMed/19683492" } ] }, { "title": "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.", "journal": "Science signaling", "date": "2010", "authors": "Olsen JV, Vermeulen M, Santamaria A, Kumar C, Miller ML, Jensen LJ, Gnad F, Cox J, Jensen TS, Nigg EA, Brunak S, Mann M", "evidence": [ { "database": "UniProtKB", "id": "O00220", "url": "https://www.uniprot.org/uniprot/O00220" }, { "database": "iPTMnet", "id": "O00220", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O00220" } ], "reference": [ { "type": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ] }, { "title": "c-FLIP is involved in erythropoietin-mediated protection of erythroid-differentiated cells from TNF-alpha-induced apoptosis.", "journal": "Cell biology international", "date": "2010", "authors": "Vittori D, Vota D, Callero M, Chamorro ME, Nesse A", "evidence": [ { "database": "Reactome", "id": "R-HSA-3371378", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3371378" } ], "reference": [ { "type": "PubMed", "id": "20218968", "url": "https://glygen.org/publication/PubMed/20218968" } ] }, { "title": "Inducible dimerization and inducible cleavage reveal a requirement for both processes in caspase-8 activation.", "journal": "The Journal of biological chemistry", "date": "2010", "authors": "Oberst A, Pop C, Tremblay AG, Blais V, Denault JB, Salvesen GS, Green DR", "evidence": [ { "database": "Reactome", "id": "R-HSA-140534", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140534" } ], "reference": [ { "type": "PubMed", "id": "20308068", "url": "https://glygen.org/publication/PubMed/20308068" } ] }, { "title": "Identification of a novel cell death receptor mediating IGFBP-3-induced anti-tumor effects in breast and prostate cancer.", "journal": "The Journal of biological chemistry", "date": "2010", "authors": "Ingermann AR, Yang YF, Han J, Mikami A, Garza AE, Mohanraj L, Fan L, Idowu M, Ware JL, Kim HS, Lee DY, Oh Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803211", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803211" } ], "reference": [ { "type": "PubMed", "id": "20353938", "url": "https://glygen.org/publication/PubMed/20353938" } ] }, { "title": "Model-based dissection of CD95 signaling dynamics reveals both a pro- and antiapoptotic role of c-FLIPL.", "journal": "The Journal of cell biology", "date": "2010", "authors": "Fricker N, Beaudouin J, Richter P, Eils R, Krammer PH, Lavrik IN", "evidence": [ { "database": "Reactome", "id": "R-HSA-3371378", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3371378" } ], "reference": [ { "type": "PubMed", "id": "20696707", "url": "https://glygen.org/publication/PubMed/20696707" } ] }, { "title": "Unraveling the binding mechanism of trivalent tumor necrosis factor ligands and their receptors.", "journal": "Molecular & cellular proteomics : MCP", "date": "2011", "authors": "Reis CR, van Assen AH, Quax WJ, Cool RH", "evidence": [ { "database": "Reactome", "id": "R-HSA-75158", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75158" } ], "reference": [ { "type": "PubMed", "id": "20852190", "url": "https://glygen.org/publication/PubMed/20852190" } ] }, { "title": "Cellular FLIP(L) plays a survival role and regulates morphogenesis in breast epithelial cells.", "journal": "Biochimica et biophysica acta", "date": "2011", "authors": "Yerbes R, Palacios C, Reginato MJ, Lopez-Rivas A", "evidence": [ { "database": "Reactome", "id": "R-HSA-3371378", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3371378" } ], "reference": [ { "type": "PubMed", "id": "20951169", "url": "https://glygen.org/publication/PubMed/20951169" } ] }, { "title": "Pregnancy-specific glycoprotein 1 induces endothelial tubulogenesis through interaction with cell surface proteoglycans.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Lisboa FA, Warren J, Sulkowski G, Aparicio M, David G, Zudaire E, Dveksler GS", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "21193412", "url": "https://glygen.org/publication/PubMed/21193412" } ] }, { "title": "FLIP(L) induces caspase 8 activity in the absence of interdomain caspase 8 cleavage and alters substrate specificity.", "journal": "The Biochemical journal", "date": "2011", "authors": "Pop C, Oberst A, Drag M, Van Raam BJ, Riedl SJ, Green DR, Salvesen GS", "evidence": [ { "database": "Reactome", "id": "R-HSA-3371378", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3371378" } ], "reference": [ { "type": "PubMed", "id": "21235526", "url": "https://glygen.org/publication/PubMed/21235526" } ] }, { "title": "Analysis of glycoprotein E-selectin ligands on human and mouse marrow cells enriched for hematopoietic stem/progenitor cells.", "journal": "Blood", "date": "2011", "authors": "Merzaban JS, Burdick MM, Gadhoum SZ, Dagia NM, Chu JT, Fuhlbrigge RC, Sackstein R", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "21659548", "url": "https://glygen.org/publication/PubMed/21659548" } ] }, { "title": "cIAPs block Ripoptosome formation, a RIP1/caspase-8 containing intracellular cell death complex differentially regulated by cFLIP isoforms.", "journal": "Molecular cell", "date": "2011", "authors": "Feoktistova M, Geserick P, Kellert B, Dimitrova DP, Langlais C, Hupe M, Cain K, MacFarlane M, Hacker G, Leverkus M", "evidence": [ { "database": "Reactome", "id": "R-HSA-140534", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140534" } ], "reference": [ { "type": "PubMed", "id": "21737330", "url": "https://glygen.org/publication/PubMed/21737330" } ] }, { "title": "Regulation in the targeting of TRAIL receptor 1 to cell surface via GODZ for TRAIL sensitivity in tumor cells.", "journal": "Cell death and differentiation", "date": "2012", "authors": "Oh Y, Jeon YJ, Hong GS, Kim I, Woo HN, Jung YK", "evidence": [ { "database": "UniProtKB", "id": "O00220", "url": "https://www.uniprot.org/uniprot/O00220" } ], "reference": [ { "type": "PubMed", "id": "22240897", "url": "https://glygen.org/publication/PubMed/22240897" } ] }, { "title": "Mixed lineage kinase domain-like protein mediates necrosis signaling downstream of RIP3 kinase.", "journal": "Cell", "date": "2012", "authors": "Sun L, Wang H, Wang Z, He S, Chen S, Liao D, Wang L, Yan J, Liu W, Lei X, Wang X", "evidence": [ { "database": "Reactome", "id": "R-HSA-5213460", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5213460" } ], "reference": [ { "type": "PubMed", "id": "22265413", "url": "https://glygen.org/publication/PubMed/22265413" } ] }, { "title": "Mixed lineage kinase domain-like is a key receptor interacting protein 3 downstream component of TNF-induced necrosis.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2012", "authors": "Zhao J, Jitkaew S, Cai Z, Choksi S, Li Q, Luo J, Liu ZG", "evidence": [ { "database": "Reactome", "id": "R-HSA-5213460", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5213460" } ], "reference": [ { "type": "PubMed", "id": "22421439", "url": "https://glygen.org/publication/PubMed/22421439" } ] }, { "title": "The RIP1/RIP3 necrosome forms a functional amyloid signaling complex required for programmed necrosis.", "journal": "Cell", "date": "2012", "authors": "Li J, McQuade T, Siemer AB, Napetschnig J, Moriwaki K, Hsiao YS, Damko E, Moquin D, Walz T, McDermott A, Chan FK, Wu H", "evidence": [ { "database": "Reactome", "id": "R-HSA-5213460", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5213460" } ], "reference": [ { "type": "PubMed", "id": "22817896", "url": "https://glygen.org/publication/PubMed/22817896" } ] }, { "title": "Toward a comprehensive characterization of a human cancer cell phosphoproteome.", "journal": "Journal of proteome research", "date": "2013", "authors": "Zhou H, Di Palma S, Preisinger C, Peng M, Polat AN, Heck AJ, Mohammed S", "evidence": [ { "database": "UniProtKB", "id": "O00220", "url": "https://www.uniprot.org/uniprot/O00220" }, { "database": "iPTMnet", "id": "O00220", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O00220" } ], "reference": [ { "type": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" } ] }, { "title": "ASPP1/2 regulate p53-dependent death of retinal ganglion cells through PUMA and Fas/CD95 activation in vivo.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "date": "2013", "authors": "Wilson AM, Morquette B, Abdouh M, Unsain N, Barker PA, Feinstein E, Bernier G, Di Polo A", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803211", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803211" } ], "reference": [ { "type": "PubMed", "id": "23365256", "url": "https://glygen.org/publication/PubMed/23365256" } ] }, { "title": "Human cytomegalovirus glycoprotein UL141 targets the TRAIL death receptors to thwart host innate antiviral defenses.", "journal": "Cell Host Microbe", "date": "2013", "authors": "Smith Wendell, Tomasec Peter, Aicheler Rebecca, Loewendorf Andrea, Nem\u010dovi\u010dov\u00e1 Ivana, Wang Eddie C Y, Stanton Richard J, Macauley Matt, Norris Paula, Willen Laure, Ruckova Eva, Nomoto Akio, Schneider Pascal, Hahn Gabriele, Zajonc Dirk M, Ware Carl F, Wilkinson Gavin W G, Benedict Chris A", "evidence": [ { "database": "UniProtKB", "id": "O00220", "url": "https://www.uniprot.org/uniprot/O00220" } ], "reference": [ { "type": "PubMed", "id": "23498957", "url": "https://glygen.org/publication/PubMed/23498957" } ] }, { "title": "Precision mapping of the human O-GalNAc glycoproteome through SimpleCell technology.", "journal": "The EMBO journal", "date": "2013", "authors": "Steentoft C, Vakhrushev SY, Joshi HJ, Kong Y, Vester-Christensen MB, Schjoldager KT, Lavrsen K, Dabelsteen S, Pedersen NB, Marcos-Silva L, Gupta R, Bennett EP, Mandel U, Brunak S, Wandall HH, Levery SB, Clausen H", "evidence": [ { "database": "UniCarbKB", "id": "O00220", "url": "" } ], "reference": [ { "type": "PubMed", "id": "23584533", "url": "https://glygen.org/publication/PubMed/23584533" } ] }, { "title": "Pregnancy-specific glycoprotein 1 (PSG1) activates TGF-beta and prevents dextran sodium sulfate (DSS)-induced colitis in mice.", "journal": "Mucosal immunology", "date": "2014", "authors": "Blois SM, Sulkowski G, Tirado-Gonzalez I, Warren J, Freitag N, Klapp BF, Rifkin D, Fuss I, Strober W, Dveksler GS", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "23945545", "url": "https://glygen.org/publication/PubMed/23945545" } ] }, { "title": "Biochemical analysis of the Plasmodium falciparum erythrocyte-binding antigen-175 (EBA175)-glycophorin-A interaction: implications for vaccine design.", "journal": "The Journal of biological chemistry", "date": "2013", "authors": "Wanaguru M, Crosnier C, Johnson S, Rayner JC, Wright GJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "24043627", "url": "https://glygen.org/publication/PubMed/24043627" } ] }, { "title": "Positive and negative phosphorylation regulates RIP1- and RIP3-induced programmed necrosis.", "journal": "The Biochemical journal", "date": "2013", "authors": "McQuade T, Cho Y, Chan FK", "evidence": [ { "database": "Reactome", "id": "R-HSA-5213460", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5213460" } ], "reference": [ { "type": "PubMed", "id": "24059293", "url": "https://glygen.org/publication/PubMed/24059293" } ] }, { "title": "Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.", "journal": "Molecular & cellular proteomics : MCP", "date": "2014", "authors": "Guo A, Gu H, Zhou J, Mulhern D, Wang Y, Lee KA, Yang V, Aguiar M, Kornhauser J, Jia X, Ren J, Beausoleil SA, Silva JC, Vemulapalli V, Bedford MT, Comb MJ", "evidence": [ { "database": "UniProtKB", "id": "O00220", "url": "https://www.uniprot.org/uniprot/O00220" } ], "reference": [ { "type": "PubMed", "id": "24129315", "url": "https://glygen.org/publication/PubMed/24129315" } ] }, { "title": "N-linked glycosylation enrichment for in-depth cell surface proteomics of diffuse large B-cell lymphoma subtypes.", "journal": "Molecular & cellular proteomics : MCP", "date": "2014", "authors": "Deeb SJ, Cox J, Schmidt-Supprian M, Mann M", "evidence": [ { "database": "GlyGen", "id": "GLY_000143", "url": "https://data.glygen.org/GLY_000143" } ], "reference": [ { "type": "PubMed", "id": "24190977", "url": "https://glygen.org/publication/PubMed/24190977" } ] }, { "title": "Plasma membrane translocation of trimerized MLKL protein is required for TNF-induced necroptosis.", "journal": "Nature cell biology", "date": "2014", "authors": "Cai Z, Jitkaew S, Zhao J, Chiang HC, Choksi S, Liu J, Ward Y, Wu LG, Liu ZG", "evidence": [ { "database": "Reactome", "id": "R-HSA-5213460", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5213460" } ], "reference": [ { "type": "PubMed", "id": "24316671", "url": "https://glygen.org/publication/PubMed/24316671" } ] }, { "title": "Mixed lineage kinase domain-like protein MLKL causes necrotic membrane disruption upon phosphorylation by RIP3.", "journal": "Molecular cell", "date": "2014", "authors": "Wang H, Sun L, Su L, Rizo J, Liu L, Wang LF, Wang FS, Wang X", "evidence": [ { "database": "Reactome", "id": "R-HSA-5213460", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5213460" } ], "reference": [ { "type": "PubMed", "id": "24703947", "url": "https://glygen.org/publication/PubMed/24703947" } ] }, { "title": "Dominant negative effects of tumor necrosis factor (TNF)-related apoptosis-inducing ligand (TRAIL) receptor 4 on TRAIL receptor 1 signaling by formation of heteromeric complexes.", "journal": "The Journal of biological chemistry", "date": "2014", "authors": "Neumann S, Hasenauer J, Pollak N, Scheurich P", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "24764293", "url": "https://glygen.org/publication/PubMed/24764293" } ] }, { "title": "MLKL compromises plasma membrane integrity by binding to phosphatidylinositol phosphates.", "journal": "Cell reports", "date": "2014", "authors": "Dondelinger Y, Declercq W, Montessuit S, Roelandt R, Goncalves A, Bruggeman I, Hulpiau P, Weber K, Sehon CA, Marquis RW, Bertin J, Gough PJ, Savvides S, Martinou JC, Bertrand MJ, Vandenabeele P", "evidence": [ { "database": "Reactome", "id": "R-HSA-5213460", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5213460" } ], "reference": [ { "type": "PubMed", "id": "24813885", "url": "https://glygen.org/publication/PubMed/24813885" } ] }, { "title": "The roles of protein C and thrombomodulin in the regulation of blood coagulation.", "journal": "The Journal of biological chemistry", "date": "1989", "authors": "Esmon CT", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "2538457", "url": "https://glygen.org/publication/PubMed/2538457" } ] }, { "title": "Probing the O-glycoproteome of gastric cancer cell lines for biomarker discovery.", "journal": "Molecular & cellular proteomics : MCP", "date": "2015", "authors": "Campos D, Freitas D, Gomes J, Magalhaes A, Steentoft C, Gomes C, Vester-Christensen MB, Ferreira JA, Afonso LP, Santos LL, Pinto de Sousa J, Mandel U, Clausen H, Vakhrushev SY, Reis CA", "evidence": [ { "database": "UniCarbKB", "id": "O00220", "url": "" } ], "reference": [ { "type": "PubMed", "id": "25813380", "url": "https://glygen.org/publication/PubMed/25813380" } ] }, { "title": "Involvement of p53 in insulin-like growth factor binding protein-3 regulation in the breast cancer cell response to DNA damage.", "journal": "Oncotarget", "date": "2015", "authors": "Marzec KA, Lin MZ, Martin JL, Baxter RC", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803211", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803211" } ], "reference": [ { "type": "PubMed", "id": "26378048", "url": "https://glygen.org/publication/PubMed/26378048" } ] }, { "title": "The structure of the death receptor 4-TNF-related apoptosis-inducing ligand (DR4-TRAIL) complex.", "journal": "Acta Crystallogr. F", "date": "2015", "authors": "Ramamurthy V, Yamniuk AP, Lawrence EJ, Yong W, Schneeweis LA, Cheng L, Murdock M, Corbett MJ, Doyle ML, Sheriff S", "evidence": [ { "database": "UniProtKB", "id": "O00220", "url": "https://www.uniprot.org/uniprot/O00220" } ], "reference": [ { "type": "PubMed", "id": "26457518", "url": "https://glygen.org/publication/PubMed/26457518" } ] }, { "title": "The Structure of the Necrosome RIPK1-RIPK3 Core, a Human Hetero-Amyloid Signaling Complex.", "journal": "Cell", "date": "2018", "authors": "Mompean M, Li W, Li J, Laage S, Siemer AB, Bozkurt G, Wu H, McDermott AE", "evidence": [ { "database": "Reactome", "id": "R-HSA-5213460", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5213460" } ], "reference": [ { "type": "PubMed", "id": "29681455", "url": "https://glygen.org/publication/PubMed/29681455" } ] }, { "title": "Conformational switching of the pseudokinase domain promotes human MLKL tetramerization and cell death by necroptosis.", "journal": "Nature communications", "date": "2018", "authors": "Petrie EJ, Sandow JJ, Jacobsen AV, Smith BJ, Griffin MDW, Lucet IS, Dai W, Young SN, Tanzer MC, Wardak A, Liang LY, Cowan AD, Hildebrand JM, Kersten WJA, Lessene G, Silke J, Czabotar PE, Webb AI, Murphy JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-5213460", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5213460" } ], "reference": [ { "type": "PubMed", "id": "29930286", "url": "https://glygen.org/publication/PubMed/29930286" } ] }, { "title": "Mapping the O-glycoproteome using site-specific extraction of O-linked glycopeptides (EXoO).", "journal": "Molecular systems biology", "date": "2018", "authors": "Yang W, Ao M, Hu Y, Li QK, Zhang H", "evidence": [ { "database": "UniCarbKB", "id": "O00220", "url": "" } ], "reference": [ { "type": "PubMed", "id": "30459171", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "title": "DR4-Ser424 O-GlcNAcylation Promotes Sensitization of TRAIL-Tolerant Persisters and TRAIL-Resistant Cancer Cells to Death.", "journal": "Cancer research", "date": "2019", "authors": "Lee H, Oh Y, Jeon YJ, Lee SY, Kim H, Lee HJ, Jung YK", "evidence": [ { "database": "O-GlcNAc Database", "id": "O00220", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O00220" }, { "database": "O-GlcNAc Atlas", "id": "O00220", "url": "https://oglcnac.org/atlas/detail/O00220" } ], "reference": [ { "type": "PubMed", "id": "30987996", "url": "https://glygen.org/publication/PubMed/30987996" } ] }, { "title": "Autophosphorylation at serine 166 regulates RIP kinase 1-mediated cell death and inflammation.", "journal": "Nature communications", "date": "2020", "authors": "Laurien L, Nagata M, Schunke H, Delanghe T, Wiederstein JL, Kumari S, Schwarzer R, Corona T, Kruger M, Bertrand MJM, Kondylis V, Pasparakis M", "evidence": [ { "database": "Reactome", "id": "R-HSA-5213460", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5213460" } ], "reference": [ { "type": "PubMed", "id": "32269263", "url": "https://glygen.org/publication/PubMed/32269263" } ] }, { "title": "MLKL trafficking and accumulation at the plasma membrane control the kinetics and threshold for necroptosis.", "journal": "Nature communications", "date": "2020", "authors": "Samson AL, Zhang Y, Geoghegan ND, Gavin XJ, Davies KA, Mlodzianoski MJ, Whitehead LW, Frank D, Garnish SE, Fitzgibbon C, Hempel A, Young SN, Jacobsen AV, Cawthorne W, Petrie EJ, Faux MC, Shield-Artin K, Lalaoui N, Hildebrand JM, Silke J, Rogers KL, Lessene G, Hawkins ED, Murphy JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-5213460", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5213460" } ], "reference": [ { "type": "PubMed", "id": "32561730", "url": "https://glygen.org/publication/PubMed/32561730" } ] }, { "title": "Downregulation of death receptor 4 is tightly associated with positive response of EGFR mutant lung cancer to EGFR-targeted therapy and improved prognosis.", "journal": "Theranostics", "date": "2021", "authors": "Zhang S, Chen Z, Shi P, Fan S, He Y, Wang Q, Li Y, Ramalingam SS, Owonikoko TK, Sun SY", "evidence": [ { "database": "RefSeq", "id": "NP_003835", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003835" } ], "reference": [ { "type": "PubMed", "id": "33664875", "url": "https://glygen.org/publication/PubMed/33664875" } ] }, { "title": "Epigenetic Modification of Death Receptor Genes for TRAIL and TRAIL Resistance in Childhood B-Cell Precursor Acute Lymphoblastic Leukemia.", "journal": "Genes", "date": "2021", "authors": "Watanabe A, Miyake K, Akahane K, Goi K, Kagami K, Yagita H, Inukai T", "evidence": [ { "database": "RefSeq", "id": "NP_003835", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003835" } ], "reference": [ { "type": "PubMed", "id": "34198757", "url": "https://glygen.org/publication/PubMed/34198757" } ] }, { "title": "Genetic variations in tumor ecrosis factor related apoptosis-inducing ligand receptor-1 (TRAIL-R1) gene and the susceptibility to b-cell non-hodgkin lymphoma (B-NHL) in Egypt.", "journal": "Cancer biomarkers : section A of Disease markers", "date": "2021", "authors": "Khorshied M, Soliman N, Khorshid O, Bakr S", "evidence": [ { "database": "RefSeq", "id": "NP_003835", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003835" } ], "reference": [ { "type": "PubMed", "id": "34275891", "url": "https://glygen.org/publication/PubMed/34275891" } ] }, { "title": "Oxaliplatin resistance in colorectal cancer enhances TRAIL sensitivity via death receptor 4 upregulation and lipid raft localization.", "journal": "eLife", "date": "2021", "authors": "Greenlee JD, Lopez-Cavestany M, Ortiz-Otero N, Liu K, Subramanian T, Cagir B, King MR", "evidence": [ { "database": "RefSeq", "id": "NP_003835", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003835" } ], "reference": [ { "type": "PubMed", "id": "34342264", "url": "https://glygen.org/publication/PubMed/34342264" } ] }, { "title": "Associations of Single-Nucleotide Polymorphisms in Slovenian Patients with Acute Central Serous Chorioretinopathy.", "journal": "Genes", "date": "2021", "authors": "Kiraly P, Zupan A, Matjasic A, Mekjavic PJ", "evidence": [ { "database": "RefSeq", "id": "NP_003835", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003835" } ], "reference": [ { "type": "PubMed", "id": "35052395", "url": "https://glygen.org/publication/PubMed/35052395" } ] }, { "title": "Human plasma protein C: isolation, characterization, and mechanism of activation by alpha-thrombin.", "journal": "The Journal of clinical investigation", "date": "1979", "authors": "Kisiel W", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "468991", "url": "https://glygen.org/publication/PubMed/468991" } ] }, { "title": "Insight into E-selectin/ligand interaction from the crystal structure and mutagenesis of the lec/EGF domains.", "journal": "Nature", "date": "1994", "authors": "Graves BJ, Crowther RL, Chandran C, Rumberger JM, Li S, Huang KS, Presky DH, Familletti PC, Wolitzky BA, Burns DK", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "7509040", "url": "https://glygen.org/publication/PubMed/7509040" } ] }, { "title": "The P-selectin glycoprotein ligand from human neutrophils displays sialylated, fucosylated, O-linked poly-N-acetyllactosamine.", "journal": "The Journal of biological chemistry", "date": "1994", "authors": "Moore KL, Eaton SF, Lyons DE, Lichenstein HS, Cummings RD, McEver RP", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "7521878", "url": "https://glygen.org/publication/PubMed/7521878" } ] }, { "title": "Induction of the growth inhibitor IGF-binding protein 3 by p53.", "journal": "Nature", "date": "1995", "authors": "Buckbinder L, Talbott R, Velasco-Miguel S, Takenaka I, Faha B, Seizinger BR, Kley N", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803211", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803211" } ], "reference": [ { "type": "PubMed", "id": "7566179", "url": "https://glygen.org/publication/PubMed/7566179" } ] }, { "title": "Ep-CAM: a human epithelial antigen is a homophilic cell-cell adhesion molecule.", "journal": "The Journal of cell biology", "date": "1994", "authors": "Litvinov SV, Velders MP, Bakker HA, Fleuren GJ, Warnaar SO", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "8163559", "url": "https://glygen.org/publication/PubMed/8163559" } ] }, { "title": "The surrogate light chain in B-cell development.", "journal": "Immunology today", "date": "1993", "authors": "Melchers F, Karasuyama H, Haasner D, Bauer S, Kudo A, Sakaguchi N, Jameson B, Rolink A", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "8166770", "url": "https://glygen.org/publication/PubMed/8166770" } ] }, { "title": "The alpha v beta 1 integrin functions as a fibronectin receptor but does not support fibronectin matrix assembly and cell migration on fibronectin.", "journal": "The Journal of cell biology", "date": "1993", "authors": "Zhang Z, Morla AO, Vuori K, Bauer JS, Juliano RL, Ruoslahti E", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "8314844", "url": "https://glygen.org/publication/PubMed/8314844" } ] }, { "title": "Identification and characterization of a new member of the TNF family that induces apoptosis.", "journal": "Immunity", "date": "1995", "authors": "Wiley SR, Schooley K, Smolak PJ, Din WS, Huang CP, Nicholl JK, Sutherland GR, Smith TD, Rauch C, Smith CA, et al.", "evidence": [ { "database": "Reactome", "id": "R-HSA-75158", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75158" } ], "reference": [ { "type": "PubMed", "id": "8777713", "url": "https://glygen.org/publication/PubMed/8777713" } ] }, { "title": "An endothelial receptor for oxidized low-density lipoprotein.", "journal": "Nature", "date": "1997", "authors": "Sawamura T, Kume N, Aoyama T, Moriwaki H, Hoshikawa H, Aiba Y, Tanaka T, Miwa S, Katsura Y, Kita T, Masaki T", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "9052782", "url": "https://glygen.org/publication/PubMed/9052782" } ] }, { "title": "The receptor for the cytotoxic ligand TRAIL.", "journal": "Science", "date": "1997", "authors": "Pan G, O'Rourke K, Chinnaiyan AM, Gentz R, Ebner R, Ni J, Dixit VM", "evidence": [ { "database": "UniProtKB", "id": "O00220", "url": "https://www.uniprot.org/uniprot/O00220" }, { "database": "Reactome", "id": "R-HSA-75158", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75158" } ], "reference": [ { "type": "PubMed", "id": "9082980", "url": "https://glygen.org/publication/PubMed/9082980" } ] }, { "title": "Differential recognition of members of the carcinoembryonic antigen family by Opa variants of Neisseria gonorrhoeae.", "journal": "Infection and immunity", "date": "1997", "authors": "Bos MP, Grunert F, Belland RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "9169774", "url": "https://glygen.org/publication/PubMed/9169774" } ] }, { "title": "An antagonist decoy receptor and a death domain-containing receptor for TRAIL.", "journal": "Science (New York, N.Y.)", "date": "1997", "authors": "Pan G, Ni J, Wei YF, Yu G, Gentz R, Dixit VM", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "9242610", "url": "https://glygen.org/publication/PubMed/9242610" } ] }, { "title": "A novel association of Fc receptor gamma-chain with glycoprotein VI and their co-expression as a collagen receptor in human platelets.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Tsuji M, Ezumi Y, Arai M, Takayama H", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "9295288", "url": "https://glygen.org/publication/PubMed/9295288" } ] }, { "title": "TRAIL-R2: a novel apoptosis-mediating receptor for TRAIL.", "journal": "The EMBO journal", "date": "1997", "authors": "Walczak H, Degli-Esposti MA, Johnson RS, Smolak PJ, Waugh JY, Boiani N, Timour MS, Gerhart MJ, Schooley KA, Smith CA, Goodwin RG, Rauch CT", "evidence": [ { "database": "Reactome", "id": "R-HSA-75158", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75158" } ], "reference": [ { "type": "PubMed", "id": "9311998", "url": "https://glygen.org/publication/PubMed/9311998" } ] }, { "title": "KILLER/DR5 is a DNA damage-inducible p53-regulated death receptor gene.", "journal": "Nature genetics", "date": "1997", "authors": "Wu GS, Burns TF, McDonald ER 3rd, Jiang W, Meng R, Krantz ID, Kao G, Gan DD, Zhou JY, Muschel R, Hamilton SR, Spinner NB, Markowitz S, Wu G, el-Deiry WS", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803211", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803211" } ], "reference": [ { "type": "PubMed", "id": "9326928", "url": "https://glygen.org/publication/PubMed/9326928" } ] }, { "title": "Epithelial cell adhesion molecule (Ep-CAM) modulates cell-cell interactions mediated by classic cadherins.", "journal": "The Journal of cell biology", "date": "1997", "authors": "Litvinov SV, Balzar M, Winter MJ, Bakker HA, Briaire-de Bruijn IH, Prins F, Fleuren GJ, Warnaar SO", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "9382878", "url": "https://glygen.org/publication/PubMed/9382878" } ] }, { "title": "Death receptor 5, a new member of the TNFR family, and DR4 induce FADD-dependent apoptosis and activate the NF-kappaB pathway.", "journal": "Immunity", "date": "1997-12", "authors": "Chaudhary P M, Eby M, Jasmin A, Bookwalter A, Murray J, Hood L", "evidence": [ { "database": "UniProtKB", "id": "O00220", "url": "https://www.uniprot.org/uniprot/O00220" } ], "reference": [ { "type": "PubMed", "id": "9430227", "url": "https://glygen.org/publication/PubMed/9430227" } ] }, { "title": "Identification of the lectin-like receptor for oxidized low-density lipoprotein in human macrophages and its potential role as a scavenger receptor.", "journal": "The Biochemical journal", "date": "1998", "authors": "Yoshida H, Kondratenko N, Green S, Steinberg D, Quehenberger O", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "9693095", "url": "https://glygen.org/publication/PubMed/9693095" } ] }, { "title": "Death receptors: signaling and modulation.", "journal": "Science (New York, N.Y.)", "date": "1998", "authors": "Ashkenazi A, Dixit VM", "evidence": [ { "database": "Reactome", "id": "R-HSA-69416", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69416" } ], "reference": [ { "type": "PubMed", "id": "9721089", "url": "https://glygen.org/publication/PubMed/9721089" } ] }, { "title": "Ligand specificity of LOX-1, a novel endothelial receptor for oxidized low density lipoprotein.", "journal": "Arteriosclerosis, thrombosis, and vascular biology", "date": "1998", "authors": "Moriwaki H, Kume N, Sawamura T, Aoyama T, Hoshikawa H, Ochi H, Nishi E, Masaki T, Kita T", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "9763524", "url": "https://glygen.org/publication/PubMed/9763524" } ] }, { "title": "The role of c-FLIP in modulation of CD95-induced apoptosis.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Scaffidi C, Schmitz I, Krammer PH, Peter ME", "evidence": [ { "database": "Reactome", "id": "R-HSA-3371378", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3371378" } ], "reference": [ { "type": "PubMed", "id": "9880531", "url": "https://glygen.org/publication/PubMed/9880531" } ] } ], "pathway": [ { "id": "hsa:8797", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:8797", "resource": "KEGG Pathway" }, { "id": "R-HSA-140534", "name": "Caspase activation via Death Receptors in the presence of ligand", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140534", "resource": "Reactome", "description": "Caspase activation via Death Receptors in the presence of ligand" }, { "id": "R-HSA-202733", "name": "Cell surface interactions at the vascular wall", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733", "resource": "Reactome", "description": "Cell surface interactions at the vascular wall" }, { "id": "R-HSA-3371378", "name": "Regulation by c-FLIP", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3371378", "resource": "Reactome", "description": "Regulation by c-FLIP" }, { "id": "R-HSA-5213460", "name": "RIPK1-mediated regulated necrosis", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5213460", "resource": "Reactome", "description": "RIPK1-mediated regulated necrosis" }, { "id": "R-HSA-5218900", "name": "CASP8 activity is inhibited", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5218900", "resource": "Reactome", "description": "CASP8 activity is inhibited" }, { "id": "R-HSA-6803211", "name": "TP53 Regulates Transcription of Death Receptors and Ligands", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803211", "resource": "Reactome", "description": "TP53 Regulates Transcription of Death Receptors and Ligands" }, { "id": "R-HSA-69416", "name": "Dimerization of procaspase-8", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69416", "resource": "Reactome", "description": "Dimerization of procaspase-8" }, { "id": "R-HSA-75158", "name": "TRAIL signaling", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75158", "resource": "Reactome", "description": "TRAIL signaling" } ], "orthologs": [ { "uniprot_canonical_ac": "A0A0G2JZE1-1", "protein_name": "TNF receptor superfamily member 10b", "gene_name": "Tnfrsf10b", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MLQAFLLLSFFVPVTAKLAQDRPADLQRLKQSPLECPAGQYLSKEDGSCKACIDGENYTSGPNVLPSCLSCRVCKEDKVIKSRCVKARNTECECKPGSFEDKDSTEICQTCSNCTDGEDEVIPCTPKANRKCVPKNTQIPQHNLGLIIGLLASVISVVLFVAVIWKTKAWESVCLFMTRVYPGCEQDHENTVGLSLLDAQTSRKTNGSHHNTEPDRTQSSPLGRKLLVLANGNNPADALKLIFERCSTEVPFNSWDRLMRHMGLTDNQIQMVRAETQVPCEVLYQMLLKWLYQTGLGASINHLLGALEAVGERCALEEIEDYAVKSGKFVYQNTTA", "length": 336 }, "evidence": [ { "id": "O00220", "url": "https://omabrowser.org/oma/group/O00220/", "database": "OMA" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "O14763-1", "protein_name": "Tumor necrosis factor receptor superfamily member 10B", "gene_name": "TNFRSF10B", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MEQRGQNAPAASGARKRHGPGPREARGARPGPRVPKTLVLVVAAVLLLVSAESALITQQDLAPQQRAAPQQKRSSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVHKESGTKHSGEVPAVEETVTSSPGTPASPCSLSGIIIGVTVAAVVLIVAVFVCKSLLWKKVLPYLKGICSGGGGDPERVDRSSQRPGAEDNVLNEIVSILQPTQVPEQEMEVQEPAEPTGVNMLSPGESEHLLEPAEAERSQRRRLLVPANEGDPTETLRQCFDDFADLVPFDSWEPLMRKLGLMDNEIKVAKAEAAGHRDTLYTMLIKWVNKTGRDASVHTLLDALETLGERLAKQKIEDHLLSSGKFMYLEGNADSAMS", "length": 440 }, "evidence": [ { "id": "45917976", "url": "http://www.informatics.jax.org/homology/45917976", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "O14798-1", "protein_name": "Tumor necrosis factor receptor superfamily member 10C", "gene_name": "TNFRSF10C", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MARIPKTLKFVVVIVAVLLPVLAYSATTARQEEVPQQTVAPQQQRHSFKGEECPAGSHRSEHTGACNPCTEGVDYTNASNNEPSCFPCTVCKSDQKHKSSCTMTRDTVCQCKEGTFRNENSPEMCRKCSRCPSGEVQVSNCTSWDDIQCVEEFGANATVETPAAEETMNTSPGTPAPAAEETMNTSPGTPAPAAEETMTTSPGTPAPAAEETMTTSPGTPAPAAEETMITSPGTPASSHYLSCTIVGIIVLIVLLIVFV", "length": 259 }, "evidence": [ { "id": "45917976", "url": "http://www.informatics.jax.org/homology/45917976", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q9QZM4-1", "protein_name": "Tumor necrosis factor receptor superfamily member 10B", "gene_name": "Tnfrsf10b", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MEPPGPSTPTASAAARADHYTPGLRPLPKRRLLYSFALLLAVLQAVFVPVTANPAHNRPAGLQRPEESPSRGPCLAGQYLSEGNCKPCREGIDYTSHSNHSLDSCILCTVCKEDKVVETRCNITTNTVCRCKPGTFEDKDSPEICQSCSNCTDGEEELTSCTPRENRKCVSKTAWASWHKLGLWIGLLVPVVLLIGALLVWKTGAWRQWLLCIKRGCERDPESANSVHSSLLDRQTSSTTNDSNHNTEPGKTQKTGKKLLVPVNGNDSADDLKFIFEYCSDIVPFDSWNRLMRQLGLTDNQIQMVKAETLVTREALYQMLLKWRHQTGRSASINHLLDALEAVEERDAMEKIEDYAVKSGRFTYQNAAAQPETGPGGSQCV", "length": 381 }, "evidence": [ { "id": "45917976", "url": "http://www.informatics.jax.org/homology/45917976", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q9UBN6-1", "protein_name": "Tumor necrosis factor receptor superfamily member 10D", "gene_name": "TNFRSF10D", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MGLWGQSVPTASSARAGRYPGARTASGTRPWLLDPKILKFVVFIVAVLLPVRVDSATIPRQDEVPQQTVAPQQQRRSLKEEECPAGSHRSEYTGACNPCTEGVDYTIASNNLPSCLLCTVCKSGQTNKSSCTTTRDTVCQCEKGSFQDKNSPEMCRTCRTGCPRGMVKVSNCTPRSDIKCKNESAASSTGKTPAAEETVTTILGMLASPYHYLIIIVVLVIILAVVVVGFSCRKKFISYLKGICSGGGGGPERVHRVLFRRRSCPSRVPGAEDNARNETLSNRYLQPTQVSEQEIQGQELAELTGVTVELPEEPQRLLEQAEAEGCQRRRLLVPVNDADSADISTLLDASATLEEGHAKETIQDQLVGSEKLFYEEDEAGSATSCL", "length": 386 }, "evidence": [ { "id": "45917976", "url": "http://www.informatics.jax.org/homology/45917976", "database": "MGI" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 6, "go_terms": [ { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "O00220", "url": "https://www.uniprot.org/uniprot/O00220" } ], "pmid": "" }, { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "O00220", "url": "https://www.uniprot.org/uniprot/O00220" } ], "pmid": "" }, { "name": "Golgi apparatus", "id": "GO:0005794", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005794", "evidence": [ { "database": "UniProtKB", "id": "O00220", "url": "https://www.uniprot.org/uniprot/O00220" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "O00220", "url": "https://www.uniprot.org/uniprot/O00220" } ], "pmid": "" }, { "name": "cell surface", "id": "GO:0009986", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009986", "evidence": [ { "database": "UniProtKB", "id": "O00220", "url": "https://www.uniprot.org/uniprot/O00220" } ], "pmid": "" }, { "name": "membrane raft", "id": "GO:0045121", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045121", "evidence": [ { "database": "UniProtKB", "id": "O00220", "url": "https://www.uniprot.org/uniprot/O00220" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 8, "go_terms": [ { "name": "TRAIL-activated apoptotic signaling pathway", "id": "GO:0036462", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0036462", "evidence": [ { "database": "UniProtKB", "id": "O00220", "url": "https://www.uniprot.org/uniprot/O00220" } ], "pmid": "" }, { "name": "signal transduction", "id": "GO:0007165", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007165", "evidence": [ { "database": "UniProtKB", "id": "O00220", "url": "https://www.uniprot.org/uniprot/O00220" } ], "pmid": "" }, { "name": "positive regulation of apoptotic process", "id": "GO:0043065", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043065", "evidence": [ { "database": "UniProtKB", "id": "O00220", "url": "https://www.uniprot.org/uniprot/O00220" } ], "pmid": "" }, { "name": "apoptotic process", "id": "GO:0006915", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006915", "evidence": [ { "database": "UniProtKB", "id": "O00220", "url": "https://www.uniprot.org/uniprot/O00220" } ], "pmid": "" }, { "name": "extrinsic apoptotic signaling pathway", "id": "GO:0097191", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0097191", "evidence": [ { "database": "UniProtKB", "id": "O00220", "url": "https://www.uniprot.org/uniprot/O00220" } ], "pmid": "" }, { "name": "cellular response to mechanical stimulus", "id": "GO:0071260", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071260", "evidence": [ { "database": "UniProtKB", "id": "O00220", "url": "https://www.uniprot.org/uniprot/O00220" } ], "pmid": "" }, { "name": "extrinsic apoptotic signaling pathway via death domain receptors", "id": "GO:0008625", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008625", "evidence": [ { "database": "UniProtKB", "id": "O00220", "url": "https://www.uniprot.org/uniprot/O00220" } ], "pmid": "" }, { "name": "activation of NF-kappaB-inducing kinase activity", "id": "GO:0007250", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007250", "evidence": [ { "database": "UniProtKB", "id": "O00220", "url": "https://www.uniprot.org/uniprot/O00220" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 5, "go_terms": [ { "name": "TRAIL binding", "id": "GO:0045569", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045569", "evidence": [ { "database": "UniProtKB", "id": "O00220", "url": "https://www.uniprot.org/uniprot/O00220" } ], "pmid": "" }, { "name": "protease binding", "id": "GO:0002020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002020", "evidence": [ { "database": "UniProtKB", "id": "O00220", "url": "https://www.uniprot.org/uniprot/O00220" } ], "pmid": "" }, { "name": "identical protein binding", "id": "GO:0042802", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042802", "evidence": [ { "database": "UniProtKB", "id": "O00220", "url": "https://www.uniprot.org/uniprot/O00220" } ], "pmid": "" }, { "name": "signaling receptor activity", "id": "GO:0038023", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0038023", "evidence": [ { "database": "UniProtKB", "id": "O00220", "url": "https://www.uniprot.org/uniprot/O00220" } ], "pmid": "" }, { "name": "death receptor activity", "id": "GO:0005035", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005035", "evidence": [ { "database": "UniProtKB", "id": "O00220", "url": "https://www.uniprot.org/uniprot/O00220" } ], "pmid": "" } ] } ] }, "pro_annotation": [ { "name": "tumor necrosis factor receptor superfamily member 10A O-glycosylated 1 (human)", "definition": "A tumor necrosis factor receptor superfamily member 10A (human) that has been O-glycosylated at the residue equivalent to Ser-126 of the amino acid sequence represented by UniProtKB:O00220-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:O00220-1, Ser-126, MOD:00002~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000050628", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000050628" } ] } ], "site_annotation": [ { "start_pos": 156, "end_pos": 158, "annotation": "n_glycosylation_sequon" }, { "start_pos": 417, "end_pos": 419, "annotation": "n_glycosylation_sequon" }, { "start_pos": 422, "end_pos": 424, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "Palmitoylated (PubMed:19090789). Palmitoylation of TNFRSF10A is required for its association with lipid rafts, oligomerization and function in TRAIL-induced cell death (PubMed:19090789). Palmitoylated by ZDHHC3 (Probable).", "evidence": [ { "database": "UniProtKB", "id": "O00220", "url": "https://www.uniprot.org/uniprot/O00220" }, { "database": "PubMed", "id": "22240897", "url": "https://glygen.org/publication/PubMed/22240897" }, { "database": "PubMed", "id": "19090789", "url": "https://glygen.org/publication/PubMed/19090789" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.oma", "label": "OMA Homologs" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "sequence_features": { "n_linked_sites": [ 156, 159, 160 ], "o_linked_sites": [ 113, 117, 120, 126, 424 ], "snv_sites": [ 25, 115, 126, 156, 198, 199, 201, 264, 299, 424 ], "glycation_sites": [], "phosphorylation_sites": [ 83, 424, 461, 463, 466 ], "sequon_annotation_sites": [ { "start_pos": 156, "end_pos": 158 }, { "start_pos": 417, "end_pos": 419 }, { "start_pos": 422, "end_pos": 424 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 8 }, { "field": "total_sites", "count": 8 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 3 }, { "field": "o_linked_glycans", "count": 3 }, { "field": "o_linked_glycan_sites", "count": 5 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 3 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 5 }, { "field": "total_sites", "count": 5 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 3 }, { "field": "o_linked_glycan_sites", "count": 5 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 5 }, { "field": "total_sites", "count": 5 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 14 }, { "field": "total_sites", "count": 10 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 12 }, { "field": "total_sites", "count": 9 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 147 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }