{ "uniprot_canonical_ac": "O00182-1", "uniprot_ac": "O00182", "uniprot_id": "LEG9_HUMAN", "mass": { "chemical_mass": 39518.0, "monoisotopic_mass": 39518.0 }, "refseq": { "ac": "NP_001317092", "name": "galectin-9 isoform 3", "summary": "The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. The protein encoded by this gene is an S-type lectin. It is overexpressed in Hodgkin's disease tissue and might participate in the interaction between the H&RS cells with their surrounding cells and might thus play a role in the pathogenesis of this disease and/or its associated immunodeficiency. Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jul 2008].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001317092" }, "gene_names": [ { "name": "LGALS9", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/O00182", "id": "O00182" }, { "name": "HUAT; LGALS9A", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001317092", "id": "NP_001317092" }, { "name": "LGALS9", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001317092", "id": "NP_001317092" } ], "protein_names": [ { "name": "Galectin-9", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "O00182" }, { "name": "Ecalectin", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O00182" }, { "name": "Gal-9", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O00182" }, { "name": "Tumor antigen HOM-HD-21", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O00182" }, { "name": "ecalectin; urate transporter/channel protein; gal-9; tumor antigen HOM-HD-21; lectin, galactoside-binding, soluble, 9", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001317092", "id": "NP_001317092" }, { "name": "galectin-9 isoform 3", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001317092", "id": "NP_001317092" } ], "function": [ { "annotation": "Activated Tim-3/Galectin-9 participated in the development of multiple myeloma by negatively regulating CD4 T cells.", "evidence": [ { "database": "RefSeq", "id": "NP_001317092", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001317092" }, { "database": "PubMed", "id": "38108336", "url": "https://glygen.org/publication/PubMed/38108336" } ] }, { "annotation": "Acts as an eosinophil chemoattractant (PubMed:9642261). It also inhibits angiogenesis (PubMed:24333696). Suppresses IFNG production by natural killer cells (By similarity).", "evidence": [ { "database": "UniProtKB", "id": "O00182", "url": "https://www.uniprot.org/uniprot/O00182#function" }, { "database": "PubMed", "id": "9642261", "url": "https://glygen.org/publication/PubMed/9642261" }, { "database": "PubMed", "id": "24333696", "url": "https://glygen.org/publication/PubMed/24333696" }, { "database": "UniProtKB", "id": "O08573", "url": "https://www.uniprot.org/uniprot/O08573#function" } ] }, { "annotation": "Binds galactosides (PubMed:18005988). Has high affinity for the Forssman pentasaccharide (PubMed:18005988). Ligand for HAVCR2/TIM3 (PubMed:16286920). Binding to HAVCR2 induces T-helper type 1 lymphocyte (Th1) death (PubMed:16286920). Also stimulates bactericidal activity in infected macrophages by causing macrophage activation and IL1B secretion which restricts intracellular bacterial growth (By similarity). Ligand for P4HB; the interaction retains P4HB at the cell surface of Th2 T-helper cells, increasing disulfide reductase activity at the plasma membrane, altering the plasma membrane redox state and enhancing cell migration (PubMed:21670307). Ligand for CD44; the interaction enhances binding of SMAD3 to the FOXP3 promoter, leading to up-regulation of FOXP3 expression and increased induced regulatory T (iTreg) cell stability and suppressive function (By similarity). Promotes ability of mesenchymal stromal cells to suppress T-cell proliferation (PubMed:23817958). Expands regulatory T-cells and induces cytotoxic T-cell apoptosis following virus infection (PubMed:20209097). Activates ERK1/2 phosphorylation inducing cytokine (IL-6, IL-8, IL-12) and chemokine (CCL2) production in mast and dendritic cells (PubMed:24465902, PubMed:16116184). Inhibits degranulation and induces apoptosis of mast cells (PubMed:24465902). Induces maturation and migration of dendritic cells (PubMed:25754930, PubMed:16116184). Inhibits natural killer (NK) cell function (PubMed:23408620). Can transform NK cell phenotype from peripheral to decidual during pregnancy (PubMed:25578313). Astrocyte derived galectin-9 enhances microglial TNF production (By similarity). May play a role in thymocyte-epithelial interactions relevant to the biology of the thymus. May provide the molecular basis for urate flux across cell membranes, allowing urate that is formed during purine metabolism to efflux from cells and serving as an electrogenic transporter that plays an important role in renal and gastrointestinal urate excretion (By similarity). Highly selective to the anion urate (By similarity).", "evidence": [ { "database": "UniProtKB", "id": "O00182", "url": "https://www.uniprot.org/uniprot/O00182#function" }, { "database": "PubMed", "id": "21670307", "url": "https://glygen.org/publication/PubMed/21670307" }, { "database": "PubMed", "id": "25578313", "url": "https://glygen.org/publication/PubMed/25578313" }, { "database": "PubMed", "id": "24465902", "url": "https://glygen.org/publication/PubMed/24465902" }, { "database": "PubMed", "id": "18005988", "url": "https://glygen.org/publication/PubMed/18005988" }, { "database": "PubMed", "id": "16286920", "url": "https://glygen.org/publication/PubMed/16286920" }, { "database": "PubMed", "id": "20209097", "url": "https://glygen.org/publication/PubMed/20209097" }, { "database": "PubMed", "id": "16116184", "url": "https://glygen.org/publication/PubMed/16116184" }, { "database": "PubMed", "id": "18977853", "url": "https://glygen.org/publication/PubMed/18977853" }, { "database": "UniProtKB", "id": "O08573", "url": "https://www.uniprot.org/uniprot/O08573#function" }, { "database": "PubMed", "id": "23817958", "url": "https://glygen.org/publication/PubMed/23817958" }, { "database": "PubMed", "id": "25754930", "url": "https://glygen.org/publication/PubMed/25754930" }, { "database": "UniProtKB", "id": "P97840", "url": "https://www.uniprot.org/uniprot/P97840#function" }, { "database": "PubMed", "id": "23408620", "url": "https://glygen.org/publication/PubMed/23408620" } ] }, { "annotation": "Ecalectin is a novel eosinophil-activating factor", "evidence": [ { "database": "RefSeq", "id": "NP_001317092", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001317092" }, { "database": "PubMed", "id": "11823532", "url": "https://glygen.org/publication/PubMed/11823532" } ] }, { "annotation": "Evaluation of the Relationship Between miRNA-22-3p and Gal-9 Levels in Glioblastoma.", "evidence": [ { "database": "RefSeq", "id": "NP_001317092", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001317092" }, { "database": "PubMed", "id": "37905655", "url": "https://glygen.org/publication/PubMed/37905655" } ] }, { "annotation": "IFN-gamma-induced production of galectin-9 by endothelial cells may play an important role in immune responses by regulating interactions between vascular wall & eosinophils. In situ endothelium from inflammatory diseases expressed galectin-9.", "evidence": [ { "database": "RefSeq", "id": "NP_001317092", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001317092" }, { "database": "PubMed", "id": "12223516", "url": "https://glygen.org/publication/PubMed/12223516" } ] }, { "annotation": "Knockdown of Galectin-9 alleviates rheumatoid arthritis through suppressing TNF-alpha-induced activation of fibroblast-like synoviocytes.", "evidence": [ { "database": "RefSeq", "id": "NP_001317092", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001317092" }, { "database": "PubMed", "id": "38141929", "url": "https://glygen.org/publication/PubMed/38141929" } ] }, { "annotation": "Overexpression of galectin 9 is associated with cell aggregation and apoptosis of melanoma cells", "evidence": [ { "database": "RefSeq", "id": "NP_001317092", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001317092" }, { "database": "PubMed", "id": "12115481", "url": "https://glygen.org/publication/PubMed/12115481" } ] }, { "annotation": "TIM-3/Gal-9 interaction affects glucose and lipid metabolism in acute myeloid leukemia cell lines. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_001317092", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001317092" }, { "database": "PubMed", "id": "38022614", "url": "https://glygen.org/publication/PubMed/38022614" } ] }, { "annotation": "The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. The protein encoded by this gene is an S-type lectin. It is overexpressed in Hodgkin's disease tissue and might participate in the interaction between the H&RS cells with their surrounding cells and might thus play a role in the pathogenesis of this disease and/or its associated immunodeficiency. Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jul 2008].", "evidence": [ { "database": "RefSeq", "id": "NP_001317092", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001317092" } ] }, { "annotation": "[Significance of Tim-3 and Its Ligand Galectin-9 in Th1/Th2 Imbalance in Patients with Multiple Myeloma].", "evidence": [ { "database": "RefSeq", "id": "NP_001317092", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001317092" }, { "database": "PubMed", "id": "38071058", "url": "https://glygen.org/publication/PubMed/38071058" } ] } ], "disease": [], "snv": [ { "evidence": [ { "id": "O00182", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O00182" } ], "glycoeffect": [], "start_pos": 65, "end_pos": 65, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "R", "sequence_mut": "W", "comment": "Somatic mutation passed 1 out of 6 filters: num. of cancers (3).", "chr_id": "17", "chr_pos": "27640633", "ref_nt": "C", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "R65", "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] }, { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] }, { "disease_id": "DOID:1319", "recommended_name": { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "brain cancer", "description": "A central nervous system cancer that is characterized by the growth of abnormal cells in the tissues of the brain." }, "synonyms": [ { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "BT - Brain tumour", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "adult brain tumor", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "adult malignant brain neoplasm", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "brain neoplasm", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "brain neoplasm, adult", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant brain tumour", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant primary brain neoplasm", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant primary brain tumor", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant tumor of Brain", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant tumor of adult brain", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "neoplasm of brain", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "primary brain neoplasm", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "primary brain tumor", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "primary malignant neoplasm of brain", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "tumor of the Brain", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] } ], "mutagenesis": [], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "71.44", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000168961", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000168961" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "85.11", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000168961", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000168961" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "93.57", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000168961", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000168961" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "78.14", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000168961", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000168961" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "95.84", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000168961", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000168961" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "98.93", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000168961", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000168961" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "93.32", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000168961", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000168961" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "81.85", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000168961", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000168961" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "85.02", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000168961", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000168961" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "81.53", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000168961", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000168961" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "82.66", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000168961", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000168961" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "88.2", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000168961", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000168961" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "90.05", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000168961", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000168961" } ] } ], "expression_disease": [ { "significant": "No", "trend": "down", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "O00182", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O00182" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "No", "trend": "down", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "O00182", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O00182" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "O00182", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O00182" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "O00182", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O00182" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "O00182", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O00182" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "O00182", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O00182" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "O00182", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O00182" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "O00182", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O00182" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "O00182", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O00182" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "O00182", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O00182" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "O00182", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O00182" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "O00182", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O00182" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O00182", "url": "https://www.uniprot.org/uniprot/O00182" } ], "common_name": "Human" } ], "gene": [ { "name": "LGALS9", "url": "https://www.uniprot.org/uniprot/O00182", "locus": { "chromosome": "17", "start_pos": 27649560, "end_pos": 27629798, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000168961", "url": "https://www.ensembl.org/id/ENSG00000168961" } ] } } ], "crossref": [ { "id": "ENSG00000168961", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000168961", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "O00182", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O00182", "database": "BioMuta", "categories": [ "Variation" ] }, { "id": "cd00070", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00070", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "CHEMBL5474", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL5474", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "LGALS9", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=LGALS9", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "3965", "url": "https://www.ncbi.nlm.nih.gov/gene/3965", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "6570", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=6570", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "O00182", "url": "https://www.ebi.ac.uk/intact/interactors/id:O00182*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR001079", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001079", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013320", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013320", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR044156", "url": "https://www.ebi.ac.uk/interpro/entry/IPR044156", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:3965", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:3965", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "601879", "url": "http://www.omim.org/entry/601879", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_O00182", "url": "https://www.nextprot.org/entry/NX_O00182", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "HCRELWL", "url": "https://omabrowser.org/oma/group/HCRELWL/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "4125409at2759", "url": "http://www.orthodb.org/?query=4125409at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR11346", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11346", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11346:SF15", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11346:SF15", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11346:SF170", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11346:SF170", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "2EAK", "url": "https://www.rcsb.org/structure/2EAK", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2EAL", "url": "https://www.rcsb.org/structure/2EAL", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2YY1", "url": "https://www.rcsb.org/structure/2YY1", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2ZHK", "url": "https://www.rcsb.org/structure/2ZHK", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2ZHL", "url": "https://www.rcsb.org/structure/2ZHL", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2ZHM", "url": "https://www.rcsb.org/structure/2ZHM", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2ZHN", "url": "https://www.rcsb.org/structure/2ZHN", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3LSD", "url": "https://www.rcsb.org/structure/3LSD", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3LSE", "url": "https://www.rcsb.org/structure/3LSE", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3NV1", "url": "https://www.rcsb.org/structure/3NV1", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3NV2", "url": "https://www.rcsb.org/structure/3NV2", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3NV3", "url": "https://www.rcsb.org/structure/3NV3", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3NV4", "url": "https://www.rcsb.org/structure/3NV4", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3WLU", "url": "https://www.rcsb.org/structure/3WLU", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3WV6", "url": "https://www.rcsb.org/structure/3WV6", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00337", "url": "http://pfam.xfam.org/family/PF00337", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "O00182", "url": "https://pharos.nih.gov/targets/O00182", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_O00182", "url": "http://purl.obolibrary.org/obo/PR_O00182", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-451927", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-451927", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001317092", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001317092", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "J3KS82", "url": "https://www.uniprot.org/uniprot/J3KS82", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "J3KS82-1", "url": "https://www.uniprot.org/uniprot/J3KS82-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "J3KSA0", "url": "https://www.uniprot.org/uniprot/J3KSA0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "J3KSA0-1", "url": "https://www.uniprot.org/uniprot/J3KSA0-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "J3QKK6", "url": "https://www.uniprot.org/uniprot/J3QKK6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "J3QKK6-1", "url": "https://www.uniprot.org/uniprot/J3QKK6-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "J3QS92", "url": "https://www.uniprot.org/uniprot/J3QS92", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "J3QS92-1", "url": "https://www.uniprot.org/uniprot/J3QS92-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "K7EPS0", "url": "https://www.uniprot.org/uniprot/K7EPS0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "K7EPS0-1", "url": "https://www.uniprot.org/uniprot/K7EPS0-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O00182", "url": "https://www.uniprot.org/uniprot/O00182", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O00182-1", "url": "https://www.uniprot.org/uniprot/O00182-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O00182-2", "url": "https://www.uniprot.org/uniprot/O00182-2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O00182-3", "url": "https://www.uniprot.org/uniprot/O00182-3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O00182-4", "url": "https://www.uniprot.org/uniprot/O00182-4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O00182-5", "url": "https://www.uniprot.org/uniprot/O00182-5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O00182-6", "url": "https://www.uniprot.org/uniprot/O00182-6", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MAFSGSQAPYLSPAVPFSGTIQGGLQDGLQITVNGTVLSSSGTRFAVNFQTGFSGNDIAFHFNPRFEDGGYVVCNTRQNGSWGPEERKTHMPFQKGMPFDLCFLVQSSDFKVMVNGILFVQYFHRVPFHRVDTISVNGSVQLSYISFQNPRTVPVQPAFSTVPFSQPVCFPPRPRGRRQKPPGVWPANPAPITQTVIHTVQSAPGQMFSTPAIPPMMYPHPAYPMPFITTILGGLYPSKSILLSGTVLPSAQRFHINLCSGNHIAFHLNPRFDENAVVRNTQIDNSWGSEERSLPRKMPFVRGQSFSVWILCEAHCLKVAVDGQHLFEYYHRLRNLPTINRLEVGGDIQLTHVQT", "length": 355, "header": "sp|O00182-1|LEG9_HUMAN Isoform 1 of Galectin-9 OS=Homo sapiens OX=9606 GN=LGALS9 PE=1 SV=2 CANONICAL=O00182-1" }, "isoforms": [ { "isoform_ac": "J3KS82-1", "url": "", "sequence": { "sequence": "MAFSGSQAPYLSPAVPFSGTIQGGLQDGLQITVNGTVLSSSGTRFAVNFQTGFSGNDIAFHFNPRFEDGGYVVCNTRQNGSWGPEERKTHMPFQKGMPFDLCFLVQSSDFKVMVNGILFVQYFHRVPFHRVDTISVNGSVQLSYISFQPMPFITTILGGLYPSKSILLSGTVLPS", "length": 175, "header": "tr|J3KS82-1|J3KS82_HUMAN Computationally mapped isoform of Galectin OS=Homo sapiens OX=9606 GN=LGALS9 PE=1 SV=1 CANONICAL=O00182-1" }, "locus": { "chromosome": "17", "start_pos": 27647110, "end_pos": 27631266, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000577392.5", "url": "https://www.ensembl.org/id/ENST00000577392.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000462359.1", "url": "https://www.ensembl.org/id/ENSP00000462359.1" } ] } }, { "isoform_ac": "J3KSA0-1", "url": "", "sequence": { "sequence": "XFDLCFLVQSSDFKVMVNGILFVQYFHRVPFHRVDTISVNGSVQLSYISFQTQTVIHTVQSAPGQMFSTPAIPPMMYPHPAYPMPFITTILGGLYPSKSILLSGTVLPSAQRCGSCVKLTASRWPWMVSTCLNTTIA", "length": 137, "header": "tr|J3KSA0-1|LEG9_HUMAN Computationally mapped isoform of Galectin-9 OS=Homo sapiens OX=9606 GN=LGALS9 PE=1 SV=1 CANONICAL=O00182-1" }, "locus": { "chromosome": "17", "start_pos": 27648913, "end_pos": 27640734, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000581710.5", "url": "https://www.ensembl.org/id/ENST00000581710.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000462382.1", "url": "https://www.ensembl.org/id/ENSP00000462382.1" } ] } }, { "isoform_ac": "J3QKK6-1", "url": "", "sequence": { "sequence": "MAFSGSQAPYLSPAVPFSGTIQGGLQDGLQITVNGTVLSSSGTRWRVRGVQHEAERKLGARGEEDTHAFPEGDAL", "length": 75, "header": "tr|J3QKK6-1|J3QKK6_HUMAN Computationally mapped isoform of Galectin 9 OS=Homo sapiens OX=9606 GN=LGALS9 PE=1 SV=1 CANONICAL=O00182-1" }, "locus": { "chromosome": "17", "start_pos": 27640736, "end_pos": 27631266, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000467111.5", "url": "https://www.ensembl.org/id/ENST00000467111.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000462668.1", "url": "https://www.ensembl.org/id/ENSP00000462668.1" } ] } }, { "isoform_ac": "J3QS92-1", "url": "", "sequence": { "sequence": "PVQPAFSTVPFSQPVCFPPRPRGRRQKTQTVIHTVQSAPGQMFSTPAIPPMMYPHPAYPMPFITTILGGLYPSKSILLSGTVLPSAQRFHINLCSGNHIAFHLNPRFDENAVVRNTQIDNSWGSE", "length": 125, "header": "tr|J3QS92-1|LEG9_HUMAN Computationally mapped isoform of Galectin-9 OS=Homo sapiens OX=9606 GN=LGALS9 PE=1 SV=1 CANONICAL=O00182-1" }, "locus": { "chromosome": "17", "start_pos": 27647381, "end_pos": 27643540, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000578944.1", "url": "https://www.ensembl.org/id/ENST00000578944.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000464581.1", "url": "https://www.ensembl.org/id/ENSP00000464581.1" } ] } }, { "isoform_ac": "K7EPS0-1", "url": "", "sequence": { "sequence": "MPFQKGMPFDLCFLVQSSDFKVMVNGILFVQYFHRVPFHRVDTISVNGSVQLSYISFQNPRTVPVQPAFSTVPFSQPVCFPPRPRGRRQKPPGVWPANPAPITQTVIHTVQSAPG", "length": 115, "header": "tr|K7EPS0-1|K7EPS0_HUMAN Computationally mapped isoform of Galectin OS=Homo sapiens OX=9606 GN=LGALS9 PE=1 SV=1 CANONICAL=O00182-1" }, "locus": { "chromosome": "17", "start_pos": 27645899, "end_pos": 27640711, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000584661.5", "url": "https://www.ensembl.org/id/ENST00000584661.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000467505.1", "url": "https://www.ensembl.org/id/ENSP00000467505.1" } ] } }, { "isoform_ac": "O00182-1", "url": "", "sequence": { "sequence": "MAFSGSQAPYLSPAVPFSGTIQGGLQDGLQITVNGTVLSSSGTRFAVNFQTGFSGNDIAFHFNPRFEDGGYVVCNTRQNGSWGPEERKTHMPFQKGMPFDLCFLVQSSDFKVMVNGILFVQYFHRVPFHRVDTISVNGSVQLSYISFQNPRTVPVQPAFSTVPFSQPVCFPPRPRGRRQKPPGVWPANPAPITQTVIHTVQSAPGQMFSTPAIPPMMYPHPAYPMPFITTILGGLYPSKSILLSGTVLPSAQRFHINLCSGNHIAFHLNPRFDENAVVRNTQIDNSWGSEERSLPRKMPFVRGQSFSVWILCEAHCLKVAVDGQHLFEYYHRLRNLPTINRLEVGGDIQLTHVQT", "length": 355, "header": "sp|O00182-1|LEG9_HUMAN Isoform 1 of Galectin-9 OS=Homo sapiens OX=9606 GN=LGALS9 PE=1 SV=2 CANONICAL=O00182-1" }, "locus": { "chromosome": "17", "start_pos": 27648979, "end_pos": 27631266, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000395473.7", "url": "https://www.ensembl.org/id/ENST00000395473.7" }, { "database": "Ensembl Peptide", "id": "ENSP00000378856.2", "url": "https://www.ensembl.org/id/ENSP00000378856.2" } ] } }, { "isoform_ac": "O00182-2", "url": "", "sequence": { "sequence": "MAFSGSQAPYLSPAVPFSGTIQGGLQDGLQITVNGTVLSSSGTRFAVNFQTGFSGNDIAFHFNPRFEDGGYVVCNTRQNGSWGPEERKTHMPFQKGMPFDLCFLVQSSDFKVMVNGILFVQYFHRVPFHRVDTISVNGSVQLSYISFQPPGVWPANPAPITQTVIHTVQSAPGQMFSTPAIPPMMYPHPAYPMPFITTILGGLYPSKSILLSGTVLPSAQRFHINLCSGNHIAFHLNPRFDENAVVRNTQIDNSWGSEERSLPRKMPFVRGQSFSVWILCEAHCLKVAVDGQHLFEYYHRLRNLPTINRLEVGGDIQLTHVQT", "length": 323, "header": "sp|O00182-2|LEG9_HUMAN Isoform 2 of Galectin-9 OS=Homo sapiens OX=9606 GN=LGALS9 PE=1 SV=2 CANONICAL=O00182-1" }, "locus": { "chromosome": "17", "start_pos": 27648979, "end_pos": 27631266, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000302228.9", "url": "https://www.ensembl.org/id/ENST00000302228.9" }, { "database": "Ensembl Peptide", "id": "ENSP00000306228.5", "url": "https://www.ensembl.org/id/ENSP00000306228.5" } ] } }, { "isoform_ac": "O00182-3", "url": "", "sequence": { "sequence": "MAFSGSQAPYLSPAVPFSGTIQGGLQDGLQITVNGTVLSSSGTRFAVNFQTGFSGNDIAFHFNPRFEDGGYVVCNTRQNGSWGPEERKTHMPFQKGMPFDLCFLVQSSDFKVMVNGILFVQYFHRVPFHRVDTISVNGSVQLSYISFQTQTVIHTVQSAPGQMFSTPAIPPMMYPHPAYPMPFITTILGGLYPSKSILLSGTVLPSAQRFHINLCSGNHIAFHLNPRFDENAVVRNTQIDNSWGSEERSLPRKMPFVRGQSFSVWILCEAHCLKVAVDGQHLFEYYHRLRNLPTINRLEVGGDIQLTHVQT", "length": 311, "header": "sp|O00182-3|LEG9_HUMAN Isoform 3 of Galectin-9 OS=Homo sapiens OX=9606 GN=LGALS9 PE=1 SV=2 CANONICAL=O00182-1" }, "locus": {} }, { "isoform_ac": "O00182-4", "url": "", "sequence": { "sequence": "MAFSGSQAPYLSPAVPFSGTIQGGLQDGLQITVNGTVLSSSGTRFAVNFQTGFSGNDIAFHFNPRFEDGGYVVCNTRQNGSWGPEERKTHMPFQKGMPFDLCFLVQSSDFKVMVNGILFVQYFHRVPFHRVDTISVNGSVQLSYISFQPPGVWPANPAPITQTVIHTVQSAPGQMFSTPAIPPMMYPHPAYPMPFITTILGGLYPSKSILLSGTVLPSAQRCGSCVKLTASRWPWMVSTCLNTTIA", "length": 246, "header": "sp|O00182-4|LEG9_HUMAN Isoform 4 of Galectin-9 OS=Homo sapiens OX=9606 GN=LGALS9 PE=1 SV=2 CANONICAL=O00182-1" }, "locus": { "chromosome": "17", "start_pos": 27648911, "end_pos": 27631266, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000313648.10", "url": "https://www.ensembl.org/id/ENST00000313648.10" }, { "database": "Ensembl Peptide", "id": "ENSP00000318214.6", "url": "https://www.ensembl.org/id/ENSP00000318214.6" } ] } }, { "isoform_ac": "O00182-5", "url": "", "sequence": { "sequence": "MAFSGSQAPYLSPAVPFSGTIQGGLQDGLQITVNGTVLSSSGTRFAVNFQTGFSGNDIAFHFNPRFEDGGYVVCNTRQNGSWGPEERKTHMPFQKGMPFDLCFLVQSSDFKVMVNGILFVQYFHRVPFHRVDTISVNGSVQLSYISFQTQTVIHTVQSAPGQMFSTPAIPPMMYPHPAYPMPFITTILGGLYPSKSILLSGTVLPSAQRCGSCVKLTASRWPWMVSTCLNTTIA", "length": 234, "header": "sp|O00182-5|LEG9_HUMAN Isoform 5 of Galectin-9 OS=Homo sapiens OX=9606 GN=LGALS9 PE=1 SV=2 CANONICAL=O00182-1" }, "locus": {} }, { "isoform_ac": "O00182-6", "url": "", "sequence": { "sequence": "MAFSGSQAPYLSPAVPFSGTIQGGLQDGLQITVNGTVLSSSGTRFAVNFQTGFSGNDIAFHFNPRFEDGGYVVCNTRQNGSWGPEERKTHMPFQKGMPFDLCFLVQSSDFKVMVNGILFVQYFHRVPFHRVDTISVNGSVQLSYISFQNPRTVPVQPAFSTVPFSQPVCFPPRPRGRRQKTQTVIHTVQSAPGQMFSTPAIPPMMYPHPAYPMPFITTILGGLYPSKSILLSGTVLPSAQRFHINLCSGNHIAFHLNPRFDENAVVRNTQIDNSWGSEERSLPRKMPFVRGQSFSVWILCEAHCLKVAVDGQHLFEYYHRLRNLPTINRLEVGGDIQLTHVQT", "length": 343, "header": "sp|O00182-6|LEG9_HUMAN Isoform 6 of Galectin-9 OS=Homo sapiens OX=9606 GN=LGALS9 PE=1 SV=2 CANONICAL=O00182-1" }, "locus": {} } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "Biological activities of ecalectin: a novel eosinophil-activating factor.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2002", "authors": "Matsumoto R, Hirashima M, Kita H, Gleich GJ", "evidence": [ { "database": "RefSeq", "id": "NP_001317092", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001317092" } ], "reference": [ { "type": "PubMed", "id": "11823532", "url": "https://glygen.org/publication/PubMed/11823532" } ] }, { "title": "Possible role of galectin-9 in cell aggregation and apoptosis of human melanoma cell lines and its clinical significance.", "journal": "International journal of cancer", "date": "2002", "authors": "Kageshita T, Kashio Y, Yamauchi A, Seki M, Abedin MJ, Nishi N, Shoji H, Nakamura T, Ono T, Hirashima M", "evidence": [ { "database": "RefSeq", "id": "NP_001317092", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001317092" } ], "reference": [ { "type": "PubMed", "id": "12115481", "url": "https://glygen.org/publication/PubMed/12115481" } ] }, { "title": "Interferon-gamma stimulates the expression of galectin-9 in cultured human endothelial cells.", "journal": "Journal of leukocyte biology", "date": "2002", "authors": "Imaizumi T, Kumagai M, Sasaki N, Kurotaki H, Mori F, Seki M, Nishi N, Fujimoto K, Tanji K, Shibata T, Tamo W, Matsumiya T, Yoshida H, Cui XF, Takanashi S, Hanada K, Okumura K, Yagihashi S, Wakabayashi K, Nakamura T, Hirashima M, Satoh K", "evidence": [ { "database": "RefSeq", "id": "NP_001317092", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001317092" } ], "reference": [ { "type": "PubMed", "id": "12223516", "url": "https://glygen.org/publication/PubMed/12223516" } ] }, { "title": "Tim-3 inhibits T helper type 1-mediated auto- and alloimmune responses and promotes immunological tolerance.", "journal": "Nature immunology", "date": "2003", "authors": "Sanchez-Fueyo A, Tian J, Picarella D, Domenig C, Zheng XX, Sabatos CA, Manlongat N, Bender O, Kamradt T, Kuchroo VK, Gutierrez-Ramos JC, Coyle AJ, Strom TB", "evidence": [ { "database": "Reactome", "id": "R-HSA-451927", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-451927" } ], "reference": [ { "type": "PubMed", "id": "14556005", "url": "https://glygen.org/publication/PubMed/14556005" } ] }, { "title": "Galectin-9 induces maturation of human monocyte-derived dendritic cells.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2005-09-01", "authors": "Dai Shu-Yan, Nakagawa Ryusuke, Itoh Aiko, Murakami Hiromoto, Kashio Yumiko, Abe Hiroko, Katoh Shigeki, Kontani Keiichi, Kihara Minoru, Zhang Shu-Lan, Hata Toshiyuki, Nakamura Takanori, Yamauchi Akira, Hirashima Mitsuomi", "evidence": [ { "database": "UniProtKB", "id": "O00182", "url": "https://www.uniprot.org/uniprot/O00182" } ], "reference": [ { "type": "PubMed", "id": "16116184", "url": "https://glygen.org/publication/PubMed/16116184" } ] }, { "title": "The Tim-3 ligand galectin-9 negatively regulates T helper type 1 immunity.", "journal": "Nature immunology", "date": "2005", "authors": "Zhu C, Anderson AC, Schubart A, Xiong H, Imitola J, Khoury SJ, Zheng XX, Strom TB, Kuchroo VK", "evidence": [ { "database": "UniProtKB", "id": "O00182", "url": "https://www.uniprot.org/uniprot/O00182" }, { "database": "Reactome", "id": "R-HSA-451927", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-451927" } ], "reference": [ { "type": "PubMed", "id": "16286920", "url": "https://glygen.org/publication/PubMed/16286920" } ] }, { "title": "Structural analysis of the human galectin-9 N-terminal carbohydrate recognition domain reveals unexpected properties that differ from the mouse orthologue.", "journal": "Journal of molecular biology", "date": "2008-01-04", "authors": "Nagae Masamichi, Nishi Nozomu, Nakamura-Tsuruta Sachiko, Hirabayashi Jun, Wakatsuki Soichi, Kato Ryuichi", "evidence": [ { "database": "UniProtKB", "id": "O00182", "url": "https://www.uniprot.org/uniprot/O00182" } ], "reference": [ { "type": "PubMed", "id": "18005988", "url": "https://glygen.org/publication/PubMed/18005988" } ] }, { "title": "Structural analysis of the recognition mechanism of poly-N-acetyllactosamine by the human galectin-9 N-terminal carbohydrate recognition domain.", "journal": "Glycobiology", "date": "2009-02", "authors": "Nagae Masamichi, Nishi Nozomu, Murata Takeomi, Usui Taichi, Nakamura Takanori, Wakatsuki Soichi, Kato Ryuichi", "evidence": [ { "database": "UniProtKB", "id": "O00182", "url": "https://www.uniprot.org/uniprot/O00182" } ], "reference": [ { "type": "PubMed", "id": "18977853", "url": "https://glygen.org/publication/PubMed/18977853" } ] }, { "title": "A crucial role for Kupffer cell-derived galectin-9 in regulation of T cell immunity in hepatitis C infection.", "journal": "PloS one", "date": "2010-03-04", "authors": "Mengshol John A, Golden-Mason Lucy, Arikawa Tomohiro, Smith Maxwell, Niki Toshiro, McWilliams Ryan, Randall Jessica A, McMahan Rachel, Zimmerman Michael A, Rangachari Manu, Dobrinskikh Evgenia, Busson Pierre, Polyak Stephen J, Hirashima Mitsuomi, Rosen Hugo R", "evidence": [ { "database": "UniProtKB", "id": "O00182", "url": "https://www.uniprot.org/uniprot/O00182" } ], "reference": [ { "type": "PubMed", "id": "20209097", "url": "https://glygen.org/publication/PubMed/20209097" } ] }, { "title": "X-ray structures of human galectin-9 C-terminal domain in complexes with a biantennary oligosaccharide and sialyllactose.", "journal": "J. Biol. Chem.", "date": "2010", "authors": "Yoshida Hiromi, Teraoka Misa, Nishi Nozomu, Nakakita Shin-ichi, Nakamura Takanori, Hirashima Mitsuomi, Kamitori Shigehiro", "evidence": [ { "database": "UniProtKB", "id": "O00182", "url": "https://www.uniprot.org/uniprot/O00182" } ], "reference": [ { "type": "PubMed", "id": "20861009", "url": "https://glygen.org/publication/PubMed/20861009" } ] }, { "title": "Galectin-9 binding to cell surface protein disulfide isomerase regulates the redox environment to enhance T-cell migration and HIV entry.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2011-06-28", "authors": "Bi Shuguang, Hong Patrick W, Lee Benhur, Baum Linda G", "evidence": [ { "database": "UniProtKB", "id": "O00182", "url": "https://www.uniprot.org/uniprot/O00182" } ], "reference": [ { "type": "PubMed", "id": "21670307", "url": "https://glygen.org/publication/PubMed/21670307" } ] }, { "title": "Profiling Lgals9 splice variant expression at the fetal-maternal interface: implications in normal and pathological human pregnancy.", "journal": "Biol. Reprod.", "date": "2013", "authors": "Heusschen Roy, Freitag Nancy, Tirado-Gonz\u00e1lez Irene, Barrientos Gabriela, Moschansky Petra, Mu\u00f1oz-Fern\u00e1ndez Raquel, Leno-Dur\u00e1n Ester, Klapp Burghard F, Thijssen Victor L J L, Blois Sandra M", "evidence": [ { "database": "UniProtKB", "id": "O00182", "url": "https://www.uniprot.org/uniprot/O00182" } ], "reference": [ { "type": "PubMed", "id": "23242525", "url": "https://glygen.org/publication/PubMed/23242525" } ] }, { "title": "Galectin-9 functionally impairs natural killer cells in humans and mice.", "journal": "Journal of virology", "date": "2013-05", "authors": "Golden-Mason Lucy, McMahan Rachel H, Strong Michael, Reisdorph Richard, Mahaffey Spencer, Palmer Brent E, Cheng Linling, Kulesza Caroline, Hirashima Mitsuomi, Niki Toshiro, Rosen Hugo R", "evidence": [ { "database": "UniProtKB", "id": "O00182", "url": "https://www.uniprot.org/uniprot/O00182" } ], "reference": [ { "type": "PubMed", "id": "23408620", "url": "https://glygen.org/publication/PubMed/23408620" } ] }, { "title": "Proinflammatory stimuli induce galectin-9 in human mesenchymal stromal cells to suppress T-cell proliferation.", "journal": "European journal of immunology", "date": "2013", "authors": "Gieseke F, Kruchen A, Tzaribachev N, Bentzien F, Dominici M, Muller I", "evidence": [ { "database": "UniProtKB", "id": "O00182", "url": "https://www.uniprot.org/uniprot/O00182" } ], "reference": [ { "type": "PubMed", "id": "23817958", "url": "https://glygen.org/publication/PubMed/23817958" } ] }, { "title": "Endothelial LGALS9 splice variant expression in endothelial cell biology and angiogenesis.", "journal": "Biochimica et biophysica acta", "date": "2014-02", "authors": "Heusschen Roy, Schulkens Iris A, van Beijnum Judy, Griffioen Arjan W, Thijssen Victor L", "evidence": [ { "database": "UniProtKB", "id": "O00182", "url": "https://www.uniprot.org/uniprot/O00182" } ], "reference": [ { "type": "PubMed", "id": "24333696", "url": "https://glygen.org/publication/PubMed/24333696" } ] }, { "title": "Galectin-9 enhances cytokine secretion, but suppresses survival and degranulation, in human mast cell line.", "journal": "PloS one", "date": "2014", "authors": "Kojima Reiji, Ohno Tatsukuni, Iikura Motoyasu, Niki Toshiro, Hirashima Mitsuomi, Iwaya Keichi, Tsuda Hitoshi, Nonoyama Shigeaki, Matsuda Akio, Saito Hirohisa, Matsumoto Kenji, Nakae Susumu", "evidence": [ { "database": "UniProtKB", "id": "O00182", "url": "https://www.uniprot.org/uniprot/O00182" } ], "reference": [ { "type": "PubMed", "id": "24465902", "url": "https://glygen.org/publication/PubMed/24465902" } ] }, { "title": "Galectin-9 is rapidly released during acute HIV-1 infection and remains sustained at high levels despite viral suppression even in elite controllers.", "journal": "AIDS Res. Hum. Retroviruses", "date": "2014", "authors": "Tandon Ravi, Chew Glen M, Byron Mary M, Borrow Persephone, Niki Toshiro, Hirashima Mitsuomi, Barbour Jason D, Norris Philip J, Lanteri Marion C, Martin Jeffrey N, Deeks Steven G, Ndhlovu Lishomwa C", "evidence": [ { "database": "UniProtKB", "id": "O00182", "url": "https://www.uniprot.org/uniprot/O00182" } ], "reference": [ { "type": "PubMed", "id": "24786365", "url": "https://glygen.org/publication/PubMed/24786365" } ] }, { "title": "The Galectin-9/Tim-3 pathway is involved in the regulation of NK cell function at the maternal-fetal interface in early pregnancy.", "journal": "Cellular & molecular immunology", "date": "2016", "authors": "Li YH, Zhou WH, Tao Y, Wang SC, Jiang YL, Zhang D, Piao HL, Fu Q, Li DJ, Du MR", "evidence": [ { "database": "UniProtKB", "id": "O00182", "url": "https://www.uniprot.org/uniprot/O00182" } ], "reference": [ { "type": "PubMed", "id": "25578313", "url": "https://glygen.org/publication/PubMed/25578313" } ] }, { "title": "Up-regulation of galectin-9 induces cell migration in human dendritic cells infected with dengue virus.", "journal": "Journal of cellular and molecular medicine", "date": "2015", "authors": "Hsu YL, Wang MY, Ho LJ, Huang CY, Lai JH", "evidence": [ { "database": "UniProtKB", "id": "O00182", "url": "https://www.uniprot.org/uniprot/O00182" } ], "reference": [ { "type": "PubMed", "id": "25754930", "url": "https://glygen.org/publication/PubMed/25754930" } ] }, { "title": "Evaluation of the Relationship Between miRNA-22-3p and Gal-9 Levels in Glioblastoma.", "journal": "In vivo (Athens, Greece)", "date": "2023", "authors": "Barut Zerrin, Akdeniz Fatma Tuba", "evidence": [ { "database": "RefSeq", "id": "NP_001317092", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001317092" } ], "reference": [ { "type": "PubMed", "id": "37905655", "url": "https://glygen.org/publication/PubMed/37905655" } ] }, { "title": "TIM-3/Gal-9 interaction affects glucose and lipid metabolism in acute myeloid leukemia cell lines.", "journal": "Frontiers in immunology", "date": "2023", "authors": "Rezaei Mahnaz, Ghanadian Mustafa, Ghezelbash Behrooz, Shokouhi Abolfazl, Bazhin Alexandr V, Zamyatnin Andrey A, Ganjalikhani-Hakemi Mazdak", "evidence": [ { "database": "RefSeq", "id": "NP_001317092", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001317092" } ], "reference": [ { "type": "PubMed", "id": "38022614", "url": "https://glygen.org/publication/PubMed/38022614" } ] }, { "title": "[Significance of Tim-3 and Its Ligand Galectin-9 in Th1/Th2 Imbalance in Patients with Multiple Myeloma].", "journal": "Zhongguo shi yan xue ye xue za zhi", "date": "2023-12", "authors": "Zhang Rui, Chen Shuang, Luo Ting-Ting, Qu Jian-Hua", "evidence": [ { "database": "RefSeq", "id": "NP_001317092", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001317092" } ], "reference": [ { "type": "PubMed", "id": "38071058", "url": "https://glygen.org/publication/PubMed/38071058" } ] }, { "title": "Activated Tim-3/Galectin-9 participated in the development of multiple myeloma by negatively regulating CD4 T cells.", "journal": "Hematology (Amsterdam, Netherlands)", "date": "2024-12", "authors": "Zhang Rui, Chen Shuang, Luo Tingting, Guo Sha, Qu Jianhua", "evidence": [ { "database": "RefSeq", "id": "NP_001317092", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001317092" } ], "reference": [ { "type": "PubMed", "id": "38108336", "url": "https://glygen.org/publication/PubMed/38108336" } ] }, { "title": "Knockdown of Galectin-9 alleviates rheumatoid arthritis through suppressing TNF-\u03b1-induced activation of fibroblast-like synoviocytes.", "journal": "Biochemical pharmacology", "date": "2023-12-21", "authors": "Jia Qian, Che Qincheng, Zhang Xiaoyu, Chen Jie, Ren Chunfeng, Wu Yunpeng, Liang Weiqiang, Zhang Xiaojie, Li Yanshan, Li Zunzhong, Zhang Zhenchun, Shu Qiang", "evidence": [ { "database": "RefSeq", "id": "NP_001317092", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001317092" } ], "reference": [ { "type": "PubMed", "id": "38141929", "url": "https://glygen.org/publication/PubMed/38141929" } ] }, { "title": "Molecular definition of a novel human galectin which is immunogenic in patients with Hodgkin's disease.", "journal": "J. Biol. Chem.", "date": "1997", "authors": "Tureci O, Schmitt H, Fadle N, Pfreundschuh M, Sahin U", "evidence": [ { "database": "UniProtKB", "id": "O00182", "url": "https://www.uniprot.org/uniprot/O00182" } ], "reference": [ { "type": "PubMed", "id": "9045665", "url": "https://glygen.org/publication/PubMed/9045665" } ] }, { "title": "Human ecalectin, a variant of human galectin-9, is a novel eosinophil chemoattractant produced by T lymphocytes.", "journal": "The Journal of biological chemistry", "date": "1998-07-03", "authors": "Matsumoto R, Matsumoto H, Seki M, Hata M, Asano Y, Kanegasaki S, Stevens R L, Hirashima M", "evidence": [ { "database": "UniProtKB", "id": "O00182", "url": "https://www.uniprot.org/uniprot/O00182" } ], "reference": [ { "type": "PubMed", "id": "9642261", "url": "https://glygen.org/publication/PubMed/9642261" } ] } ], "pathway": [ { "id": "hsa:3965", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:3965", "resource": "KEGG Pathway" }, { "id": "R-HSA-451927", "name": "Interleukin-2 family signaling", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-451927", "resource": "Reactome", "description": "Interleukin-2 family signaling" } ], "orthologs": [ { "uniprot_canonical_ac": "O08573-1", "protein_name": "Galectin-9", "gene_name": "Lgals9", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MALFSAQSPYINPIIPFTGPIQGGLQEGLQVTLQGTTKSFAQRFVVNFQNSFNGNDIAFHFNPRFEEGGYVVCNTKQNGQWGPEERKMQMPFQKGMPFELCFLVQRSEFKVMVNKKFFVQYQHRVPYHLVDTIAVSGCLKLSFITFQNSAAPVQHVFSTLQFSQPVQFPRTPKGRKQKTQNFRPAHQAPMAQTTIHMVHSTPGQMFSTPGIPPVVYPTPAYTIPFYTPIPNGLYPSKSIMISGNVLPDATRFHINLRCGGDIAFHLNPRFNENAVVRNTQINNSWGQEERSLLGRMPFSRGQSFSVWIICEGHCFKVAVNGQHMCEYYHRLKNLQDINTLEVAGDIQLTHVQT", "length": 353 }, "evidence": [ { "id": "45918651", "url": "http://www.informatics.jax.org/homology/45918651", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "P47967-1", "protein_name": "Galectin-5", "gene_name": "Lgals5", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MSSFSTQTPYPNLAVPFFTSIPNGLYPSKSIVISGVVLSDAKRFQINLRCGGDIAFHLNPRFDENAVVRNTQINNSWGPEERSLPGSMPFSRGQRFSVWILCEGHCFKVAVDGQHICEYSHRLMNLPDINTLEVAGDIQLTHVET", "length": 145 }, "evidence": [ { "id": "45918651", "url": "http://www.informatics.jax.org/homology/45918651", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "P97840-1", "protein_name": "Galectin-9", "gene_name": "Lgals9", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MAFFSTQPPYMNPVIPFTGIIQGGLQNGLQITLQGTVHPFPNRIAVNFQTGFSGNDIAFHFNPRFEEGGYVVCNTKQNGKWGPEERKMQMPFQKGMPFELCFLVQRSEFKVMVNKNFFVQYSHRVPYHLVDTISVSGCLHLSFINFQNSTAAPVQPVFSTMQFSQPVQFPRMPKGRKQRTQGFQPALQAPVAQTIIHTVHSIPGQMLSTPGIPPMAYPTPAYTIPFFTSIPNGFYPSKSINISGVVLPDAKRFHINLRCGGDIAFHLNPRFNEKVVVRNTQINNSWGPEERSLPGRMPFNRGQSFSVWILCEGHCFKVAVDGQHICEYYHRLKNLPDINTLEVAGDIQLTHVQT", "length": 354 }, "evidence": [ { "id": "45918651", "url": "http://www.informatics.jax.org/homology/45918651", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q3B8N2-1", "protein_name": "Galectin-9B", "gene_name": "LGALS9B", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MAFSGSQAPYLSPAVPFSGTIQGGLQDGFQITVNGAVLSSSGTRFAVDFQTGFSGNDIAFHFNPRFEDGGYVVCNTRQKGRWGPEERKMHMPFQKGMPFDLCFLVQSSDFKVMVNGSLFVQYFHRVPFHRVDTISVNGSVQLSYISFQNPRTVPVQPAFSTVPFSQPVCFPPRPRGRRQKPPSVRPANPAPITQTVIHTVQSASGQMFSQTPAIPPMMYPHPAYPMPFITTIPGGLYPSKSIILSGTVLPSAQRFHINLCSGSHIAFHMNPRFDENAVVRNTQINNSWGSEERSLPRKMPFVRGQSFSVWILCEAHCLKVAVDGQHVFEYYHRLRNLPTINKLEVGGDIQLTHVQT", "length": 356 }, "evidence": [ { "id": "45918651", "url": "http://www.informatics.jax.org/homology/45918651", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q6DKI2-1", "protein_name": "Galectin-9C", "gene_name": "LGALS9C", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MAFSGCQAPYLSPAVPFSGTIQGGLQDGFQITVNGAVLSCSGTRFAVDFQTGFSGNDIAFHFNPRFEDGGYVVCNTRQKGTWGPEERKMHMPFQKGMPFDLCFLVQSSDFKVMVNGSLFVQYFHRVPFHRVDTISVNGSVQLSYISFQNPRAVPVQPAFSTVPFSQPVCFPPRPRGRRQKPPSVRPANPAPITQTVIHTVQSASGQMFSQTPAIPPMMYPHPAYPMPFITTIPGGLYPSKSIILSGTVLPSAQRFHINLCSGSHIAFHMNPRFDENAVVRNTQINNSWGSEERSLPRKMPFVRGQSFSVWILCEAHCLKVAVDGQHVFEYYHRLRNLPTINKLEVGGDIQLTHVQT", "length": 356 }, "evidence": [ { "id": "45918651", "url": "http://www.informatics.jax.org/homology/45918651", "database": "MGI" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 44, "go_terms": [ { "name": "positive regulation of interleukin-13 production", "id": "GO:0032736", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032736", "evidence": [ { "database": "UniProtKB", "id": "O00182", "url": "https://www.uniprot.org/uniprot/O00182" } ], "pmid": "" }, { "name": "positive regulation of dendritic cell differentiation", "id": "GO:2001200", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2001200", "evidence": [ { "database": "UniProtKB", "id": "O00182", "url": "https://www.uniprot.org/uniprot/O00182" } ], "pmid": "" }, { "name": "positive regulation of CD4-positive, CD25-positive, alpha-beta regulatory T cell differentiation involved in immune response", "id": "GO:0032834", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032834", "evidence": [ { "database": "UniProtKB", "id": "O00182", "url": "https://www.uniprot.org/uniprot/O00182" } ], "pmid": "" }, { "name": "positive regulation of cysteine-type endopeptidase activity involved in apoptotic signaling pathway", "id": "GO:2001269", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2001269", "evidence": [ { "database": "UniProtKB", "id": "O00182", "url": "https://www.uniprot.org/uniprot/O00182" } ], "pmid": "" }, { "name": "chemotaxis", "id": "GO:0006935", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006935", "evidence": [ { "database": "UniProtKB", "id": "O00182", "url": "https://www.uniprot.org/uniprot/O00182" } ], "pmid": "" }, { "name": "inflammatory response", "id": "GO:0006954", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006954", "evidence": [ { "database": "UniProtKB", "id": "O00182", "url": "https://www.uniprot.org/uniprot/O00182" } ], "pmid": "" }, { "name": "positive regulation of gene expression", "id": "GO:0010628", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010628", "evidence": [ { "database": "UniProtKB", "id": "O00182", "url": "https://www.uniprot.org/uniprot/O00182" } ], "pmid": "" }, { "name": "negative regulation of gene expression", "id": "GO:0010629", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010629", "evidence": [ { "database": "UniProtKB", "id": "O00182", "url": "https://www.uniprot.org/uniprot/O00182" } ], "pmid": "" }, { "name": "response to lipopolysaccharide", "id": "GO:0032496", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032496", "evidence": [ { "database": "UniProtKB", "id": "O00182", "url": "https://www.uniprot.org/uniprot/O00182" } ], "pmid": "" }, { "name": "positive regulation of NF-kappaB transcription factor activity", "id": "GO:0051092", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051092", "evidence": [ { "database": "UniProtKB", "id": "O00182", "url": "https://www.uniprot.org/uniprot/O00182" } ], "pmid": "" }, { "name": "positive regulation of ERK1 and ERK2 cascade", "id": "GO:0070374", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070374", "evidence": [ { "database": "UniProtKB", "id": "O00182", "url": "https://www.uniprot.org/uniprot/O00182" } ], "pmid": "" }, { "name": "positive regulation of non-canonical NF-kappaB signal transduction", "id": "GO:1901224", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1901224", "evidence": [ { "database": "UniProtKB", "id": "O00182", "url": "https://www.uniprot.org/uniprot/O00182" } ], "pmid": "" }, { "name": "negative regulation of type II interferon production", "id": "GO:0032689", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032689", "evidence": [ { "database": "UniProtKB", "id": "O00182", "url": "https://www.uniprot.org/uniprot/O00182" } ], "pmid": "" }, { "name": "negative regulation of tumor necrosis factor production", "id": "GO:0032720", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032720", "evidence": [ { "database": "UniProtKB", "id": "O00182", "url": "https://www.uniprot.org/uniprot/O00182" } ], "pmid": "" }, { "name": "positive regulation of interleukin-6 production", "id": "GO:0032755", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032755", "evidence": [ { "database": "UniProtKB", "id": "O00182", "url": "https://www.uniprot.org/uniprot/O00182" } ], "pmid": "" }, { "name": "female pregnancy", "id": "GO:0007565", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007565", "evidence": [ { "database": "UniProtKB", "id": "O00182", "url": "https://www.uniprot.org/uniprot/O00182" } ], "pmid": "" }, { "name": "positive regulation of canonical NF-kappaB signal transduction", "id": "GO:0043123", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043123", "evidence": [ { "database": "UniProtKB", "id": "O00182", "url": "https://www.uniprot.org/uniprot/O00182" } ], "pmid": "" }, { "name": "positive regulation of viral entry into host cell", "id": "GO:0046598", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046598", "evidence": [ { "database": "UniProtKB", "id": "O00182", "url": "https://www.uniprot.org/uniprot/O00182" } ], "pmid": "" }, { "name": "maternal process involved in female pregnancy", "id": "GO:0060135", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060135", "evidence": [ { "database": "UniProtKB", "id": "O00182", "url": "https://www.uniprot.org/uniprot/O00182" } ], "pmid": "" }, { "name": "positive regulation of transforming growth factor beta production", "id": "GO:0071636", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071636", "evidence": [ { "database": "UniProtKB", "id": "O00182", "url": "https://www.uniprot.org/uniprot/O00182" } ], "pmid": "" }, { "name": "ERK1 and ERK2 cascade", "id": "GO:0070371", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070371", "evidence": [ { "database": "UniProtKB", "id": "O00182", "url": "https://www.uniprot.org/uniprot/O00182" } ], "pmid": "" }, { "name": "positive regulation of tumor necrosis factor production", "id": "GO:0032760", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032760", "evidence": [ { "database": "UniProtKB", "id": "O00182", "url": "https://www.uniprot.org/uniprot/O00182" } ], "pmid": "" }, { "name": "positive regulation of type II interferon production", "id": "GO:0032729", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032729", "evidence": [ { "database": "UniProtKB", "id": "O00182", "url": "https://www.uniprot.org/uniprot/O00182" } ], "pmid": "" }, { "name": "positive regulation of interleukin-8 production", "id": "GO:0032757", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032757", "evidence": [ { "database": "UniProtKB", "id": "O00182", "url": "https://www.uniprot.org/uniprot/O00182" } ], "pmid": "" }, { "name": "response to interleukin-1", "id": "GO:0070555", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070555", "evidence": [ { "database": "UniProtKB", "id": "O00182", "url": "https://www.uniprot.org/uniprot/O00182" } ], "pmid": "" }, { "name": "positive regulation of monocyte chemotactic protein-1 production", "id": "GO:0071639", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071639", "evidence": [ { "database": "UniProtKB", "id": "O00182", "url": "https://www.uniprot.org/uniprot/O00182" } ], "pmid": "" }, { "name": "cellular response to type II interferon", "id": "GO:0071346", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071346", "evidence": [ { "database": "UniProtKB", "id": "O00182", "url": "https://www.uniprot.org/uniprot/O00182" } ], "pmid": "" }, { "name": "positive regulation of interleukin-1 beta production", "id": "GO:0032731", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032731", "evidence": [ { "database": "UniProtKB", "id": "O00182", "url": "https://www.uniprot.org/uniprot/O00182" } ], "pmid": "" }, { "name": "negative regulation of natural killer cell mediated cytotoxicity", "id": "GO:0045953", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045953", "evidence": [ { "database": "UniProtKB", "id": "O00182", "url": "https://www.uniprot.org/uniprot/O00182" } ], "pmid": "" }, { "name": "cellular response to virus", "id": "GO:0098586", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0098586", "evidence": [ { "database": "UniProtKB", "id": "O00182", "url": "https://www.uniprot.org/uniprot/O00182" } ], "pmid": "" }, { "name": "negative regulation of CD4-positive, alpha-beta T cell proliferation", "id": "GO:2000562", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000562", "evidence": [ { "database": "UniProtKB", "id": "O00182", "url": "https://www.uniprot.org/uniprot/O00182" } ], "pmid": "" }, { "name": "negative regulation of activated T cell proliferation", "id": "GO:0046007", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046007", "evidence": [ { "database": "UniProtKB", "id": "O00182", "url": "https://www.uniprot.org/uniprot/O00182" } ], "pmid": "" }, { "name": "positive regulation of interleukin-10 production", "id": "GO:0032733", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032733", "evidence": [ { "database": "UniProtKB", "id": "O00182", "url": "https://www.uniprot.org/uniprot/O00182" } ], "pmid": "" }, { "name": "positive regulation of T cell activation via T cell receptor contact with antigen bound to MHC molecule on antigen presenting cell", "id": "GO:2001190", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2001190", "evidence": [ { "database": "UniProtKB", "id": "O00182", "url": "https://www.uniprot.org/uniprot/O00182" } ], "pmid": "" }, { "name": "positive regulation of dendritic cell chemotaxis", "id": "GO:2000510", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000510", "evidence": [ { "database": "UniProtKB", "id": "O00182", "url": "https://www.uniprot.org/uniprot/O00182" } ], "pmid": "" }, { "name": "positive regulation of interleukin-4 production", "id": "GO:0032753", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032753", "evidence": [ { "database": "UniProtKB", "id": "O00182", "url": "https://www.uniprot.org/uniprot/O00182" } ], "pmid": "" }, { "name": "positive regulation of interleukin-12 production", "id": "GO:0032735", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032735", "evidence": [ { "database": "UniProtKB", "id": "O00182", "url": "https://www.uniprot.org/uniprot/O00182" } ], "pmid": "" }, { "name": "positive regulation of CD4-positive, alpha-beta T cell proliferation", "id": "GO:2000563", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000563", "evidence": [ { "database": "UniProtKB", "id": "O00182", "url": "https://www.uniprot.org/uniprot/O00182" } ], "pmid": "" }, { "name": "negative regulation of mast cell degranulation", "id": "GO:0043305", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043305", "evidence": [ { "database": "UniProtKB", "id": "O00182", "url": "https://www.uniprot.org/uniprot/O00182" } ], "pmid": "" }, { "name": "p38MAPK cascade", "id": "GO:0038066", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0038066", "evidence": [ { "database": "UniProtKB", "id": "O00182", "url": "https://www.uniprot.org/uniprot/O00182" } ], "pmid": "" }, { "name": "positive regulation of activated T cell autonomous cell death", "id": "GO:0070241", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070241", "evidence": [ { "database": "UniProtKB", "id": "O00182", "url": "https://www.uniprot.org/uniprot/O00182" } ], "pmid": "" }, { "name": "positive regulation of dendritic cell apoptotic process", "id": "GO:2000670", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000670", "evidence": [ { "database": "UniProtKB", "id": "O00182", "url": "https://www.uniprot.org/uniprot/O00182" } ], "pmid": "" }, { "name": "negative regulation of chemokine production", "id": "GO:0032682", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032682", "evidence": [ { "database": "UniProtKB", "id": "O00182", "url": "https://www.uniprot.org/uniprot/O00182" } ], "pmid": "" }, { "name": "natural killer cell tolerance induction", "id": "GO:0002519", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002519", "evidence": [ { "database": "UniProtKB", "id": "O00182", "url": "https://www.uniprot.org/uniprot/O00182" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 5, "go_terms": [ { "name": "extracellular space", "id": "GO:0005615", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005615", "evidence": [ { "database": "UniProtKB", "id": "O00182", "url": "https://www.uniprot.org/uniprot/O00182" } ], "pmid": "" }, { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "O00182", "url": "https://www.uniprot.org/uniprot/O00182" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "O00182", "url": "https://www.uniprot.org/uniprot/O00182" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "O00182", "url": "https://www.uniprot.org/uniprot/O00182" } ], "pmid": "" }, { "name": "collagen-containing extracellular matrix", "id": "GO:0062023", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0062023", "evidence": [ { "database": "UniProtKB", "id": "O00182", "url": "https://www.uniprot.org/uniprot/O00182" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 5, "go_terms": [ { "name": "enzyme binding", "id": "GO:0019899", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019899", "evidence": [ { "database": "UniProtKB", "id": "O00182", "url": "https://www.uniprot.org/uniprot/O00182" } ], "pmid": "" }, { "name": "carbohydrate binding", "id": "GO:0030246", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030246", "evidence": [ { "database": "UniProtKB", "id": "O00182", "url": "https://www.uniprot.org/uniprot/O00182" } ], "pmid": "" }, { "name": "galactoside binding", "id": "GO:0016936", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016936", "evidence": [ { "database": "UniProtKB", "id": "O00182", "url": "https://www.uniprot.org/uniprot/O00182" } ], "pmid": "" }, { "name": "galactose binding", "id": "GO:0005534", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005534", "evidence": [ { "database": "UniProtKB", "id": "O00182", "url": "https://www.uniprot.org/uniprot/O00182" } ], "pmid": "" }, { "name": "disaccharide binding", "id": "GO:0048030", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048030", "evidence": [ { "database": "UniProtKB", "id": "O00182", "url": "https://www.uniprot.org/uniprot/O00182" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 137, "end_pos": 139, "annotation": "n_glycosylation_sequon" }, { "start_pos": 34, "end_pos": 36, "annotation": "n_glycosylation_sequon" }, { "start_pos": 79, "end_pos": 81, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [ 65 ], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 137, "end_pos": 139 }, { "start_pos": 34, "end_pos": 36 }, { "start_pos": 79, "end_pos": 81 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "subjects_tested", "subjects_positive", "frequency", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "subjects_tested", "subjects_positive", "frequency", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 26 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }