{ "uniprot_canonical_ac": "L0R819-1", "uniprot_ac": "L0R819", "uniprot_id": "ASURF_HUMAN", "mass": { "chemical_mass": 11250.0, "monoisotopic_mass": 11250.0 }, "refseq": {}, "gene_names": [ { "name": "ASDURF", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/L0R819", "id": "L0R819" } ], "protein_names": [ { "name": "ASNSD1 upstream open reading frame protein", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "L0R819" }, { "name": "ASNSD1 small/short open reading frame-encoded polypeptide", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "L0R819" }, { "name": "ASNSD1-SEP", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "L0R819" } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "L0R819", "url": "https://www.uniprot.org/uniprot/L0R819" } ], "common_name": "Human" } ], "gene": [ { "name": "ASDURF", "url": "https://www.uniprot.org/uniprot/L0R819", "locus": { "chromosome": "2", "start_pos": 189666437, "end_pos": 189661452, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000286053", "url": "https://www.ensembl.org/id/ENSG00000286053" } ] } } ], "crossref": [ { "id": "ENSG00000286053", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000286053", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "ASDURF", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=ASDURF", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "53619", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=53619", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "L0R819", "url": "https://www.ebi.ac.uk/intact/interactors/id:L0R819*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR009053", "url": "https://www.ebi.ac.uk/interpro/entry/IPR009053", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "619740", "url": "http://www.omim.org/entry/619740", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_L0R819", "url": "https://www.nextprot.org/entry/NX_L0R819", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "TEMLSQC", "url": "https://omabrowser.org/oma/group/TEMLSQC/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "168254at2759", "url": "http://www.orthodb.org/?query=168254at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "L0R819", "url": "https://pharos.nih.gov/targets/L0R819", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "L0R819", "url": "https://www.uniprot.org/uniprot/L0R819", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "L0R819-1", "url": "https://www.uniprot.org/uniprot/L0R819-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "U3KQ49", "url": "https://www.uniprot.org/uniprot/U3KQ49", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "U3KQ49-1", "url": "https://www.uniprot.org/uniprot/U3KQ49-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "U3KQE3", "url": "https://www.uniprot.org/uniprot/U3KQE3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "U3KQE3-1", "url": "https://www.uniprot.org/uniprot/U3KQE3-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "U3KQP6", "url": "https://www.uniprot.org/uniprot/U3KQP6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "U3KQP6-1", "url": "https://www.uniprot.org/uniprot/U3KQP6-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MPSRGTRPEDSSVLIPTDNSTPHKEDLSSKIKEQKIVVDELSNLKKNRKVYRQQQNSNIFFLADRTEMLSESKNILDELKKEYQEIENLDKTKIKK", "length": 96, "header": "sp|L0R819-1|ASURF_HUMAN Isoform 1 of ASNSD1 upstream open reading frame protein OS=Homo sapiens OX=9606 GN=ASDURF PE=1 SV=1 CANONICAL=L0R819-1" }, "isoforms": [ { "isoform_ac": "L0R819-1", "url": "", "sequence": { "sequence": "MPSRGTRPEDSSVLIPTDNSTPHKEDLSSKIKEQKIVVDELSNLKKNRKVYRQQQNSNIFFLADRTEMLSESKNILDELKKEYQEIENLDKTKIKK", "length": 96, "header": "sp|L0R819-1|ASURF_HUMAN Isoform 1 of ASNSD1 upstream open reading frame protein OS=Homo sapiens OX=9606 GN=ASDURF PE=1 SV=1 CANONICAL=L0R819-1" }, "locus": { "chromosome": "2", "start_pos": 189666108, "end_pos": 189661521, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000607829.6", "url": "https://www.ensembl.org/id/ENST00000607829.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000475224.1", "url": "https://www.ensembl.org/id/ENSP00000475224.1" } ] } }, { "isoform_ac": "U3KQ49-1", "url": "", "sequence": { "sequence": "MPSRGTRPEDSSVLIPTDNSTPHKEDLSSKIKEQKIVVDELSNLKKNRTEQKCCLRARIYWMN", "length": 63, "header": "tr|U3KQ49-1|ASURF_HUMAN Computationally mapped isoform of ASNSD1 upstream open reading frame protein OS=Homo sapiens OX=9606 GN=ASDURF PE=1 SV=1 CANONICAL=L0R819-1" }, "locus": { "chromosome": "2", "start_pos": 189666055, "end_pos": 189661521, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000607690.1", "url": "https://www.ensembl.org/id/ENST00000607690.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000475546.1", "url": "https://www.ensembl.org/id/ENSP00000475546.1" } ] } }, { "isoform_ac": "U3KQE3-1", "url": "", "sequence": { "sequence": "MPSRGTRPEDSSVLIPTDNSTPHKEDLSSKTEQKCCLRARIYWMN", "length": 45, "header": "tr|U3KQE3-1|ASURF_HUMAN Computationally mapped isoform of ASNSD1 upstream open reading frame protein OS=Homo sapiens OX=9606 GN=ASDURF PE=1 SV=1 CANONICAL=L0R819-1" }, "locus": { "chromosome": "2", "start_pos": 189666055, "end_pos": 189661521, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000607535.5", "url": "https://www.ensembl.org/id/ENST00000607535.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000475805.1", "url": "https://www.ensembl.org/id/ENSP00000475805.1" } ] } }, { "isoform_ac": "U3KQP6-1", "url": "", "sequence": { "sequence": "MPSRGTRPEDSSVLIPTDNSTPHKEDLSSKIKEQKIVVDELSNLKKNRPKLCFPESI", "length": 57, "header": "tr|U3KQP6-1|ASURF_HUMAN Computationally mapped isoform of ASNSD1 upstream open reading frame protein OS=Homo sapiens OX=9606 GN=ASDURF PE=1 SV=1 CANONICAL=L0R819-1" }, "locus": { "chromosome": "2", "start_pos": 189665383, "end_pos": 189661521, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000605941.5", "url": "https://www.ensembl.org/id/ENST00000605941.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000476099.1", "url": "https://www.ensembl.org/id/ENSP00000476099.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "Peptidomic discovery of short open reading frame-encoded peptides in human cells.", "journal": "Nat. Chem. Biol.", "date": "2013", "authors": "Slavoff SA, Mitchell AJ, Schwaid AG, Cabili MN, Ma J, Levin JZ, Karger AD, Budnik BA, Rinn JL, Saghatelian A", "evidence": [ { "database": "UniProtKB", "id": "L0R819", "url": "https://www.uniprot.org/uniprot/L0R819" } ], "reference": [ { "type": "PubMed", "id": "23160002", "url": "https://glygen.org/publication/PubMed/23160002" } ] }, { "title": "Direct detection of alternative open reading frames translation products in human significantly expands the proteome.", "journal": "PLoS ONE", "date": "2013", "authors": "Vanderperre Beno\u00eet, Lucier Jean-Fran\u00e7ois, Bissonnette Cyntia, Motard Julie, Tremblay Guillaume, Vanderperre Sol\u00e8ne, Wisztorski Maxence, Salzet Michel, Boisvert Fran\u00e7ois-Michel, Roucou Xavier", "evidence": [ { "database": "UniProtKB", "id": "L0R819", "url": "https://www.uniprot.org/uniprot/L0R819" } ], "reference": [ { "type": "PubMed", "id": "23950983", "url": "https://glygen.org/publication/PubMed/23950983" } ] }, { "title": "Identification and characterization of sORF-encoded polypeptides.", "journal": "Crit. Rev. Biochem. Mol. Biol.", "date": "2015", "authors": "Chu Qian, Ma Jiao, Saghatelian Alan", "evidence": [ { "database": "UniProtKB", "id": "L0R819", "url": "https://www.uniprot.org/uniprot/L0R819" } ], "reference": [ { "type": "PubMed", "id": "25857697", "url": "https://glygen.org/publication/PubMed/25857697" } ] }, { "title": "Upstream ORF-Encoded ASDURF Is a Novel Prefoldin-like Subunit of the PAQosome.", "journal": "J. Proteome Res.", "date": "2020", "authors": "Cloutier Philippe, Poitras Christian, Faubert Denis, Bouchard Annie, Blanchette Mathieu, Gauthier Marie-Soleil, Coulombe Benoit", "evidence": [ { "database": "UniProtKB", "id": "L0R819", "url": "https://www.uniprot.org/uniprot/L0R819" } ], "reference": [ { "type": "PubMed", "id": "31738558", "url": "https://glygen.org/publication/PubMed/31738558" } ] } ], "pathway": [], "orthologs": [ { "uniprot_canonical_ac": "A0A494BB10-1", "protein_name": "Predicted gene, 50478", "gene_name": "Gm50478", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MPSSGVHADGRAAPGPPHTSTAHAESLSSKIKEQKIIVDELSNLKKNRRVYKQQQNSNIFFLEDRTKIFSESKNTLDELKKEYQALETSETTKVKTQST", "length": 99 }, "evidence": [ { "id": "L0R819", "url": "https://omabrowser.org/oma/group/L0R819/", "database": "OMA" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "A0A8I6GL92-1", "protein_name": "Uncharacterized protein", "gene_name": "ENSRNOG00000065791", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MPSGGVHSRDSAAPGPTHTSTVYAKALGSKITEQKIIVDELSNLKKNRKVYKQQQNSHIFFLEDRIKMFSESKNTLDKLRKDYQALENSETLGRE", "length": 95 }, "evidence": [ { "id": "L0R819", "url": "https://omabrowser.org/oma/group/L0R819/", "database": "OMA" } ], "common_name": "Rat" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "L0R819", "url": "https://www.uniprot.org/uniprot/L0R819" } ], "pmid": "" }, { "name": "RPAP3/R2TP/prefoldin-like complex", "id": "GO:1990062", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1990062", "evidence": [ { "database": "UniProtKB", "id": "L0R819", "url": "https://www.uniprot.org/uniprot/L0R819" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "protein stabilization", "id": "GO:0050821", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050821", "evidence": [ { "database": "UniProtKB", "id": "L0R819", "url": "https://www.uniprot.org/uniprot/L0R819" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 19, "end_pos": 21, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 19, "end_pos": 21 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }