{ "uniprot_canonical_ac": "F5H094-1", "uniprot_ac": "F5H094", "uniprot_id": "SO1BT_HUMAN", "mass": { "chemical_mass": 76346.0, "monoisotopic_mass": 76346.0 }, "refseq": {}, "gene_names": [ { "name": "SLCO1B3-SLCO1B7", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/F5H094", "id": "F5H094" } ], "protein_names": [ { "name": "SLCO1B3-SLCO1B7 readthrough transcript protein", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "F5H094" }, { "name": "LST-3TM12", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "F5H094" }, { "name": "Liver specific transporter-3 transmembrane 12", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "F5H094" }, { "name": "OATP1B3-1B7", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "F5H094" }, { "name": "Organic anion transporting polypeptide 1B3-1B7", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "F5H094" }, { "name": "SLCO1B3-SLCO1B7", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "F5H094" }, { "name": "Solute carrier organic anion transporter family member 1B3-1B7", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "F5H094" } ], "function": [ { "annotation": "Mediates the Na(+)-independent uptake of organic anions (PubMed:29248594). Transports the conjugated steroids 17-beta-glucuronosyl estradiol (17beta-estradiol 17-O-(beta-D-glucuronate) or E2G) and dehydroepiandrosterone 3-sulfate (DHEAS) at the smooth endoplasmic reticulum membrane (SER), granting access to metabolizing enzymes (PubMed:29248594, PubMed:31127008, PubMed:32818652). Contributes to the metabolism of bile acids such as taurocholate (cholyltaurine) and lithocholate, by functioning as a doorway between SER and cytosol, thereby decreasing their circulating levels and protecting the organism from their detergent properties (PubMed:31509437). Regulates access or exit of drugs to the SER lumen (PubMed:31127008).", "evidence": [ { "database": "UniProtKB", "id": "F5H094", "url": "https://www.uniprot.org/uniprot/F5H094#function" }, { "database": "PubMed", "id": "32818652", "url": "https://glygen.org/publication/PubMed/32818652" }, { "database": "PubMed", "id": "29248594", "url": "https://glygen.org/publication/PubMed/29248594" }, { "database": "PubMed", "id": "31127008", "url": "https://glygen.org/publication/PubMed/31127008" }, { "database": "PubMed", "id": "31509437", "url": "https://glygen.org/publication/PubMed/31509437" } ] } ], "disease": [], "snv": [ { "evidence": [ { "id": "rs150007972", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs150007972" }, { "id": "rs150007972", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs150007972" }, { "id": "rs150007972", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs150007972" }, { "id": "rs150007972", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs150007972#frequency_tab" }, { "id": "rs150007972", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs150007972" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 106, "end_pos": 106, "sequence_org": "T", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (TGS->NGS).", "chr_id": "12", "chr_pos": "20858529", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "0.000399", "site_lbl": "T106", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1245570764", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1245570764" }, { "id": "rs1245570764", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1245570764#frequency_tab" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 125, "end_pos": 125, "sequence_org": "K", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (KET->NET).", "chr_id": "12", "chr_pos": "21021476", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "K125", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1170404104", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1170404104" }, { "id": "rs1170404104", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1170404104" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 134, "end_pos": 134, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->DST).", "chr_id": "12", "chr_pos": "21021501", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N134", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1242722316", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1242722316" }, { "id": "rs1242722316", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1242722316" }, { "id": "rs755722744", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs755722744" }, { "id": "rs755722744", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs755722744" }, { "id": "rs755722744", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs755722744#frequency_tab" }, { "id": "rs755722744", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs755722744" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 136, "end_pos": 136, "sequence_org": "T", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->NSA).", "chr_id": "12", "chr_pos": "20861063", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T136", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs748865343", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs748865343" }, { "id": "rs748865343", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs748865343" }, { "id": "rs748865343", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs748865343#frequency_tab" }, { "id": "rs748865343", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs748865343" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 136, "end_pos": 136, "sequence_org": "T", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->NSK).", "chr_id": "12", "chr_pos": "21021508", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T136", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs778871287", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs778871287" }, { "id": "rs778871287", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs778871287" }, { "id": "rs778871287", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs778871287" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 140, "end_pos": 140, "sequence_org": "P", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NLP->NLT).", "chr_id": "12", "chr_pos": "21021519", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "P140", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs377224479", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs377224479" }, { "id": "rs377224479", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs377224479" }, { "id": "rs377224479", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs377224479#frequency_tab" }, { "id": "rs377224479", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs377224479" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 151, "end_pos": 151, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NRT->DRT).", "chr_id": "12", "chr_pos": "21021552", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N151", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs77922474", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs77922474" }, { "id": "rs77922474", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs77922474" }, { "id": "rs77922474", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs77922474" }, { "id": "rs1013088884", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1013088884" }, { "id": "rs1013088884", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1013088884#frequency_tab" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 151, "end_pos": 151, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NRT->SRT).", "chr_id": "12", "chr_pos": "20861109", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N151", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs781710106", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs781710106" }, { "id": "rs781710106", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs781710106" }, { "id": "rs781710106", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs781710106" }, { "id": "rs747516405", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs747516405" }, { "id": "rs747516405", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs747516405" }, { "id": "rs747516405", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs747516405" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 241, "end_pos": 241, "sequence_org": "D", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (DLS->NLS).", "chr_id": "12", "chr_pos": "20862848", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "D241", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs767730020", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs767730020" }, { "id": "rs767730020", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs767730020" }, { "id": "rs767730020", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs767730020#frequency_tab" }, { "id": "rs767730020", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs767730020" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 286, "end_pos": 286, "sequence_org": "P", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NKP->NKS).", "chr_id": "12", "chr_pos": "20875363", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "P286", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs767730020", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs767730020" }, { "id": "rs767730020", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs767730020" }, { "id": "rs767730020", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs767730020#frequency_tab" }, { "id": "rs767730020", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs767730020" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 286, "end_pos": 286, "sequence_org": "P", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NKP->NKT).", "chr_id": "12", "chr_pos": "20875363", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "P286", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs142873062", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs142873062" }, { "id": "rs142873062", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs142873062" }, { "id": "rs142873062", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs142873062" }, { "id": "rs142873062", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs142873062#frequency_tab" }, { "id": "rs142873062", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs142873062" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 291, "end_pos": 291, "sequence_org": "K", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (KVS->NVS).", "chr_id": "12", "chr_pos": "20875380", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "0.0002", "site_lbl": "K291", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs774137990", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs774137990" }, { "id": "rs774137990", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs774137990" }, { "id": "rs774137990", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs774137990" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 308, "end_pos": 308, "sequence_org": "I", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NQI->NQT).", "chr_id": "12", "chr_pos": "21043529", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "I308", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1356509251", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1356509251" }, { "id": "rs1356509251", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1356509251" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 439, "end_pos": 439, "sequence_org": "T", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (TLT->NLT).", "chr_id": "12", "chr_pos": "21048892", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T439", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs752015255", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs752015255" }, { "id": "rs752015255", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs752015255" }, { "id": "rs752015255", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs752015255" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 447, "end_pos": 447, "sequence_org": "P", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NSP->NSS).", "chr_id": "12", "chr_pos": "21052103", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "P447", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1865106191", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1865106191" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 49, "end_pos": 49, "sequence_org": "K", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (KIS->NIS).", "chr_id": "12", "chr_pos": "20855090", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "K49", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs751258776", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs751258776" }, { "id": "rs751258776", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs751258776" }, { "id": "rs751258776", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs751258776" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 505, "end_pos": 505, "sequence_org": "S", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCS->NCN).", "chr_id": "12", "chr_pos": "20883434", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S505", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1387222495", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1387222495" }, { "id": "rs1387222495", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1387222495#frequency_tab" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 518, "end_pos": 518, "sequence_org": "S", "sequence_mut": "L", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NYS->NYL).", "chr_id": "12", "chr_pos": "21054507", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S518", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1410549391", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1410549391" }, { "id": "rs1410549391", "database": "NCI-TCGA", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1410549391" }, { "id": "rs1410549391", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1410549391" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 596, "end_pos": 596, "sequence_org": "D", "sequence_mut": "N", "comment": "Somatic mutation passed 1 out of 1 filters: n-glyco-sequon-gain (DTT->NTT).", "chr_id": "12", "chr_pos": "20901388", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "D596", "keywords": [ "ebi", "somatic" ] }, { "evidence": [ { "id": "rs754088334", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs754088334" }, { "id": "rs754088334", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs754088334" }, { "id": "rs754088334", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs754088334#frequency_tab" }, { "id": "rs754088334", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs754088334" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 607, "end_pos": 607, "sequence_org": "C", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NSC->NSS).", "chr_id": "12", "chr_pos": "20901422", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "C607", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1221969813", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1221969813" }, { "id": "rs1221969813", "database": "NCI-TCGA", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1221969813" }, { "id": "rs1221969813", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1221969813#frequency_tab" }, { "id": "rs1221969813", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1221969813" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 60, "end_pos": 60, "sequence_org": "D", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (DIS->NIS).", "chr_id": "12", "chr_pos": "20855121", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "D60", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1428074479", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1428074479" }, { "id": "rs1428074479", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1428074479#frequency_tab" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 617, "end_pos": 617, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->DST).", "chr_id": "12", "chr_pos": "20901451", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N617", "keywords": [ "ebi", "germline" ] } ], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "F5H094", "url": "https://www.uniprot.org/uniprot/F5H094" } ], "common_name": "Human" } ], "gene": [ { "name": "SLCO1B3-SLCO1B7", "url": "https://www.uniprot.org/uniprot/F5H094", "locus": { "chromosome": "12", "start_pos": 21090245, "end_pos": 20815674, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000257046", "url": "https://www.ensembl.org/id/ENSG00000257046" } ] } } ], "crossref": [ { "id": "ENSG00000257046", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000257046", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "SLCO1B3-SLCO1B7", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=SLCO1B3-SLCO1B7", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "54403", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=54403", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "IPR002350", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002350", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR004156", "url": "https://www.ebi.ac.uk/interpro/entry/IPR004156", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR020846", "url": "https://www.ebi.ac.uk/interpro/entry/IPR020846", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036058", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036058", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036259", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036259", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "MVYWIFT", "url": "https://omabrowser.org/oma/group/MVYWIFT/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "2874223at2759", "url": "http://www.orthodb.org/?query=2874223at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR11388", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11388", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11388:SF154", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11388:SF154", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF03137", "url": "http://pfam.xfam.org/family/PF03137", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF07648", "url": "http://pfam.xfam.org/family/PF07648", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "71703", "url": "https://www.rhea-db.org/rhea/71703", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "71839", "url": "https://www.rhea-db.org/rhea/71839", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "72691", "url": "https://www.rhea-db.org/rhea/72691", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "73139", "url": "https://www.rhea-db.org/rhea/73139", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "A0A0A6YYJ9", "url": "https://www.uniprot.org/uniprot/A0A0A6YYJ9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0A6YYJ9-1", "url": "https://www.uniprot.org/uniprot/A0A0A6YYJ9-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F5H094", "url": "https://www.uniprot.org/uniprot/F5H094", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F5H094-1", "url": "https://www.uniprot.org/uniprot/F5H094-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MDQHQHLNKTAESASSEKKKTRRCNGFKMFLAALSFSYIAKALGGIIMKISITQIERRFDISSSLAGLIDGSFEIGNLLVIVFVSYFGSKLHRPKLIGIGCLLMGTGSILTSLPHFFMGYYRYSKETNIDPSENSTSNLPNCLINQMLSLNRTPSEIIERGCVKESGSHMWIYVFMGNMLRGIGETPIVPLGISYIDDFAKEGHSSLYLGTVNVMGMTGLVFAFMLGSLFAKMYVDIGYVDLSTIRITPKDSRWVGAWWLGFLVSGIVSIISSIPFFFLPLNPNKPQKERKVSLFLHVLKTNDKRNQIANLTNRRKYITKNVTGFFQSLKSILTNPLYVIFVIFTLLHMSSYIASLTYIIKMVEQQYGWSASKTNFLLGVLALPAVAIGMFSGGYIIKKFKLSLVGLAKLAFCSATVHLLSQVLYFFLICESKSVAGLTLTYDGNSPVRSHVDVPLSYCNSECNCDESQWEPVCGNNGITYLSPCLAGCKSSSGNKEPIVFYNCSCVEVIGLQNKNYSAHLGECPRDDACTRKSYVYFVIQVLDAFLCAVGLTSYSVLVIRIVQPELKALAIGFHSMIMRSLGGILVPIYFGALIDTTCMKWSTNSCGARGACRIYNSTYLGRAFFGLKVALIFPVLVLLTVFIFVVRKKSHGKDTKVLENERQVMDEANLEFLNDSEHFVPSAEEQ", "length": 687, "header": "sp|F5H094-1|SO1BT_HUMAN Isoform 1 of SLCO1B3-SLCO1B7 readthrough transcript protein OS=Homo sapiens OX=9606 GN=SLCO1B3-SLCO1B7 PE=1 SV=1 CANONICAL=F5H094-1" }, "isoforms": [ { "isoform_ac": "A0A0A6YYJ9-1", "url": "", "sequence": { "sequence": "MDQHQHLNKTAESASSEKKKTRRCNGFKMFLAALSFSYIAKALGGIIMKISITQIERRFDISSSLAGLIDGSFEIGNLLVIVFVSYFGSKLHRPKLIGIGCLLMGTGSILTSLPHFFMGYYRYSKETHINPSENSTSSLSTCLINQTLSFNGTSPEIVEKDCVKESGSHMWIYVFMGNMLRGIGETPIVPLGISYIDDFAKEGHSSLYLGSLNAIGMIGPVIGFALGSLFAKMYVDIGYVDLSTIRITPKDSRWVGAWWLGFLVSGLFSIISSIPFFFLPKNPNKPQKERKISLSLHVLKTNDDRNQTANLTNQGKNVTKNVTGFFQSLKSILTNPLYVIFLLLTLLQVSSFIGSFTYVFKYMEQQYGQSASHANFLLGIITIPTVATGMFLGGFIIKKFKLSLVGIAKFSFLTSMISFLFQLLYFPLICESKSVAGLTLTYDGNNSVASHVDVPLSYCNSECNCDESQWEPVCGNNGITYLSPCLAGCKSSSGIKKHTVFYNCSCVEVTGLQNRNYSAHLGECPRDNTCTRKFFIYVAIQVINSLFSATGGTTFILLTVKIVQPELKALAMGFQSMVIRTLGGILAPIYFGALIDKTCMKWSTNSCGAQGACRIYNSVFFGIVQPELKALAIGFHSMIMRSLGGILVPIYFGALIDTTCMKWSTNSCGARGACRIYNSTYLGRAFFGLKVALIFPVLVLLTVFIFVVRKKSHGKDTKVLENERQVMDEANLEFLNDSEHFVPSAEEQ", "length": 748, "header": "tr|A0A0A6YYJ9-1|SO1BT_HUMAN Computationally mapped isoform of SLCO1B3-SLCO1B7 readthrough transcript protein OS=Homo sapiens OX=9606 GN=SLCO1B3-SLCO1B7 PE=1 SV=1 CANONICAL=F5H094-1" }, "locus": { "chromosome": "12", "start_pos": 21090103, "end_pos": 20815739, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000540229", "url": "https://www.ensembl.org/id/ENST00000540229" }, { "database": "Ensembl Peptide", "id": "ENSP00000441269", "url": "https://www.ensembl.org/id/ENSP00000441269" } ] } }, { "isoform_ac": "F5H094-1", "url": "", "sequence": { "sequence": "MDQHQHLNKTAESASSEKKKTRRCNGFKMFLAALSFSYIAKALGGIIMKISITQIERRFDISSSLAGLIDGSFEIGNLLVIVFVSYFGSKLHRPKLIGIGCLLMGTGSILTSLPHFFMGYYRYSKETNIDPSENSTSNLPNCLINQMLSLNRTPSEIIERGCVKESGSHMWIYVFMGNMLRGIGETPIVPLGISYIDDFAKEGHSSLYLGTVNVMGMTGLVFAFMLGSLFAKMYVDIGYVDLSTIRITPKDSRWVGAWWLGFLVSGIVSIISSIPFFFLPLNPNKPQKERKVSLFLHVLKTNDKRNQIANLTNRRKYITKNVTGFFQSLKSILTNPLYVIFVIFTLLHMSSYIASLTYIIKMVEQQYGWSASKTNFLLGVLALPAVAIGMFSGGYIIKKFKLSLVGLAKLAFCSATVHLLSQVLYFFLICESKSVAGLTLTYDGNSPVRSHVDVPLSYCNSECNCDESQWEPVCGNNGITYLSPCLAGCKSSSGNKEPIVFYNCSCVEVIGLQNKNYSAHLGECPRDDACTRKSYVYFVIQVLDAFLCAVGLTSYSVLVIRIVQPELKALAIGFHSMIMRSLGGILVPIYFGALIDTTCMKWSTNSCGARGACRIYNSTYLGRAFFGLKVALIFPVLVLLTVFIFVVRKKSHGKDTKVLENERQVMDEANLEFLNDSEHFVPSAEEQ", "length": 687, "header": "sp|F5H094-1|SO1BT_HUMAN Isoform 1 of SLCO1B3-SLCO1B7 readthrough transcript protein OS=Homo sapiens OX=9606 GN=SLCO1B3-SLCO1B7 PE=1 SV=1 CANONICAL=F5H094-1" }, "locus": { "chromosome": "12", "start_pos": 21090103, "end_pos": 20815739, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000381541.7", "url": "https://www.ensembl.org/id/ENST00000381541.7" }, { "database": "Ensembl Peptide", "id": "ENSP00000370952.3", "url": "https://www.ensembl.org/id/ENSP00000370952.3" } ] } } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 134, "start_aa": "Asn", "end_pos": 134, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn134", "evidence": [ { "id": "F5H094", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F5H094#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 151, "start_aa": "Asn", "end_pos": 151, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn151", "evidence": [ { "id": "F5H094", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F5H094#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 503, "start_aa": "Asn", "end_pos": 503, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn503", "evidence": [ { "id": "F5H094", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F5H094#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 516, "start_aa": "Asn", "end_pos": 516, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn516", "evidence": [ { "id": "F5H094", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F5H094#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 617, "start_aa": "Asn", "end_pos": 617, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn617", "evidence": [ { "id": "F5H094", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F5H094#ptm_processing" } ] } ], "phosphorylation": [], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_predicted" ], "publication": [ { "title": "LST-3TM12 is a member of the OATP1B family and a functional transporter.", "journal": "Biochemical pharmacology", "date": "2018", "authors": "Malagnino V, Hussner J, Seibert I, Stolzenburg A, Sager CP, Meyer Zu Schwabedissen HE", "evidence": [ { "database": "UniProtKB", "id": "F5H094", "url": "https://www.uniprot.org/uniprot/F5H094" } ], "reference": [ { "type": "PubMed", "id": "29248594", "url": "https://glygen.org/publication/PubMed/29248594" } ] }, { "title": "OATP1B3-1B7 (LST-3TM12) Is a Drug Transporter That Affects Endoplasmic Reticulum Access and the Metabolism of Ezetimibe.", "journal": "Molecular pharmacology", "date": "2019", "authors": "Malagnino V, Duthaler U, Seibert I, Krahenbuhl S, Meyer Zu Schwabedissen HE", "evidence": [ { "database": "UniProtKB", "id": "F5H094", "url": "https://www.uniprot.org/uniprot/F5H094" } ], "reference": [ { "type": "PubMed", "id": "31127008", "url": "https://glygen.org/publication/PubMed/31127008" } ] }, { "title": "OATP1B3-1B7, a novel organic anion transporting polypeptide, is modulated by FXR ligands and transports bile acids.", "journal": "American journal of physiology. Gastrointestinal and liver physiology", "date": "2019-12-01", "authors": "Malagnino Vanessa, Hussner Janine, Issa Ali, Midzic Angela, Meyer Zu Schwabedissen Henriette E", "evidence": [ { "database": "UniProtKB", "id": "F5H094", "url": "https://www.uniprot.org/uniprot/F5H094" } ], "reference": [ { "type": "PubMed", "id": "31509437", "url": "https://glygen.org/publication/PubMed/31509437" } ] }, { "title": "Genetic variants of SLCO1B7 are of relevance for the transport function of OATP1B3-1B7.", "journal": "Pharmacological research", "date": "2020-11", "authors": "Meyer Zu Schwabedissen Henriette E, Seibert Isabell, Grube Markus, Alter Claudio L, Siegmund Werner, Hussner Janine", "evidence": [ { "database": "UniProtKB", "id": "F5H094", "url": "https://www.uniprot.org/uniprot/F5H094" } ], "reference": [ { "type": "PubMed", "id": "32818652", "url": "https://glygen.org/publication/PubMed/32818652" } ] } ], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "F5H094", "url": "https://www.uniprot.org/uniprot/F5H094" } ], "pmid": "" }, { "name": "smooth endoplasmic reticulum membrane", "id": "GO:0030868", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030868", "evidence": [ { "database": "UniProtKB", "id": "F5H094", "url": "https://www.uniprot.org/uniprot/F5H094" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 2, "go_terms": [ { "name": "monoatomic ion transport", "id": "GO:0006811", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006811", "evidence": [ { "database": "UniProtKB", "id": "F5H094", "url": "https://www.uniprot.org/uniprot/F5H094" } ], "pmid": "" }, { "name": "lipid transport", "id": "GO:0006869", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006869", "evidence": [ { "database": "UniProtKB", "id": "F5H094", "url": "https://www.uniprot.org/uniprot/F5H094" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "transmembrane transporter activity", "id": "GO:0022857", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0022857", "evidence": [ { "database": "UniProtKB", "id": "F5H094", "url": "https://www.uniprot.org/uniprot/F5H094" } ], "pmid": "" }, { "name": "serine-type endopeptidase inhibitor activity", "id": "GO:0004867", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004867", "evidence": [ { "database": "UniProtKB", "id": "F5H094", "url": "https://www.uniprot.org/uniprot/F5H094" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 134, "end_pos": 136, "annotation": "n_glycosylation_sequon" }, { "start_pos": 151, "end_pos": 153, "annotation": "n_glycosylation_sequon" }, { "start_pos": 310, "end_pos": 312, "annotation": "n_glycosylation_sequon" }, { "start_pos": 321, "end_pos": 323, "annotation": "n_glycosylation_sequon" }, { "start_pos": 503, "end_pos": 505, "annotation": "n_glycosylation_sequon" }, { "start_pos": 516, "end_pos": 518, "annotation": "n_glycosylation_sequon" }, { "start_pos": 617, "end_pos": 619, "annotation": "n_glycosylation_sequon" }, { "start_pos": 675, "end_pos": 677, "annotation": "n_glycosylation_sequon" }, { "start_pos": 8, "end_pos": 10, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "71703", "name": "", "equation": "taurocholate(out) = taurocholate(in)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "71703", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/71703" } ] }, { "id": "71839", "name": "", "equation": "dehydroepiandrosterone 3-sulfate(out) = dehydroepiandrosterone 3-sulfate(in)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "71839", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/71839" } ] }, { "id": "72691", "name": "", "equation": "17beta-estradiol 17-O-(beta-D-glucuronate)(out) = 17beta-estradiol 17-O-(beta-D-glucuronate)(in)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "72691", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/72691" } ] }, { "id": "73139", "name": "", "equation": "lithocholate(out) = lithocholate(in)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "73139", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/73139" } ] } ], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" } ], "sequence_features": { "n_linked_sites": [ 134, 151, 503, 516, 617 ], "o_linked_sites": [], "snv_sites": [ 49, 60, 106, 125, 134, 136, 140, 151, 241, 286, 291, 308, 439, 447, 505, 518, 596, 607, 617 ], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 134, "end_pos": 136 }, { "start_pos": 151, "end_pos": 153 }, { "start_pos": 310, "end_pos": 312 }, { "start_pos": 321, "end_pos": 323 }, { "start_pos": 503, "end_pos": 505 }, { "start_pos": 516, "end_pos": 518 }, { "start_pos": 617, "end_pos": 619 }, { "start_pos": 675, "end_pos": 677 }, { "start_pos": 8, "end_pos": 10 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 5 }, { "field": "total_sites", "count": 5 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 5 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 5 }, { "field": "total_sites", "count": 5 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 5 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 22 }, { "field": "total_sites", "count": 19 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 22 }, { "field": "total_sites", "count": 19 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }