{
    "uniprot_canonical_ac": "E9PQ42-1",
    "uniprot_ac": "E9PQ42",
    "uniprot_id": "E9PQ42_HUMAN",
    "mass": {
        "chemical_mass": 27969.0,
        "monoisotopic_mass": 27969.0
    },
    "refseq": {},
    "gene_names": [
        {
            "name": "LOC84773-CYHR1",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "https://www.uniprot.org/uniprot/E9PQ42",
            "id": "E9PQ42"
        }
    ],
    "protein_names": [
        {
            "name": "TRAF-type domain-containing protein",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "",
            "id": "E9PQ42"
        }
    ],
    "function": [],
    "disease": [],
    "snv": [],
    "mutagenesis": [],
    "expression_tissue": [],
    "expression_disease": [],
    "species": [
        {
            "name": "Homo sapiens",
            "taxid": 9606,
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "E9PQ42",
                    "url": "https://www.uniprot.org/uniprot/E9PQ42"
                }
            ],
            "common_name": "Human"
        }
    ],
    "gene": [
        {
            "name": "LOC84773-CYHR1",
            "url": "https://www.uniprot.org/uniprot/E9PQ42",
            "locus": {
                "chromosome": "8",
                "start_pos": 144449582,
                "end_pos": 144465430,
                "strand": "+",
                "evidence": [
                    {
                        "database": "Ensembl Gene",
                        "id": "ENSG00000291316",
                        "url": "https://www.ensembl.org/id/ENSG00000291316"
                    }
                ]
            }
        }
    ],
    "crossref": [
        {
            "id": "ENSG00000187954",
            "url": "https://bgee.org/?page=gene&gene_id=ENSG00000187954",
            "database": "Bgee",
            "categories": [
                "Gene Expression"
            ]
        },
        {
            "id": "IPR001293",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR001293",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR013083",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR013083",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR039338",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR039338",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR23059",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23059",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR23059:SF4",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23059:SF4",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "E9PQ42",
            "url": "https://www.uniprot.org/uniprot/E9PQ42",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "E9PQ42-1",
            "url": "https://www.uniprot.org/uniprot/E9PQ42-1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        }
    ],
    "sequence": {
        "sequence": "MAPKPGAEWSTALSHLVLGVVSLHAAVSTAECTNGHLMCAGCFIHLLADARLKEEQATCPNCRCEISKSLCCRNLAVEKAVSELPSECGFCLRQFPRSLLERHQKEECQDRVTQCKYKRIGCPWHGPFHELTVHEAACAHPTKTGSELMEILDGMDQSHRKEMQLYNSIFSLLSFEKIGYTEVQFRPYRTDDFITRLYYETPRFTVLNQTWVLKARVNDSERNPNLSCKRTLSFQLLLKSKVTAPL",
        "length": 246,
        "header": "tr|E9PQ42-1|E9PQ42_HUMAN Isoform 1 of TRAF-type domain-containing protein  OS=Homo sapiens OX=9606 GN=LOC84773-CYHR1 PE=4 SV=1 CANONICAL=E9PQ42-1"
    },
    "isoforms": [
        {
            "isoform_ac": "E9PQ42-1",
            "url": "",
            "sequence": {
                "sequence": "MAPKPGAEWSTALSHLVLGVVSLHAAVSTAECTNGHLMCAGCFIHLLADARLKEEQATCPNCRCEISKSLCCRNLAVEKAVSELPSECGFCLRQFPRSLLERHQKEECQDRVTQCKYKRIGCPWHGPFHELTVHEAACAHPTKTGSELMEILDGMDQSHRKEMQLYNSIFSLLSFEKIGYTEVQFRPYRTDDFITRLYYETPRFTVLNQTWVLKARVNDSERNPNLSCKRTLSFQLLLKSKVTAPL",
                "length": 246,
                "header": "tr|E9PQ42-1|E9PQ42_HUMAN Isoform 1 of TRAF-type domain-containing protein  OS=Homo sapiens OX=9606 GN=LOC84773-CYHR1 PE=4 SV=1 CANONICAL=E9PQ42-1"
            },
            "locus": {
                "chromosome": "8",
                "start_pos": 144464901,
                "end_pos": 144450577,
                "strand": "+",
                "evidence": [
                    {
                        "database": "Ensembl Transcript",
                        "id": "ENST00000526887.5",
                        "url": "https://www.ensembl.org/id/ENST00000526887.5"
                    },
                    {
                        "database": "Ensembl Peptide",
                        "id": "ENSP00000434470.1",
                        "url": "https://www.ensembl.org/id/ENSP00000434470.1"
                    }
                ]
            }
        }
    ],
    "glycosylation": [],
    "phosphorylation": [],
    "glycation": [],
    "keywords": [],
    "publication": [],
    "pathway": [],
    "orthologs": [],
    "go_annotation": {
        "categories": [
            {
                "name": "Molecular Function",
                "total": 1,
                "go_terms": [
                    {
                        "name": "zinc ion binding",
                        "id": "GO:0008270",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008270",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "E9PQ42",
                                "url": "https://www.uniprot.org/uniprot/E9PQ42"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            }
        ]
    },
    "pro_annotation": [],
    "site_annotation": [
        {
            "start_pos": 208,
            "end_pos": 210,
            "annotation": "n_glycosylation_sequon"
        },
        {
            "start_pos": 218,
            "end_pos": 220,
            "annotation": "n_glycosylation_sequon"
        },
        {
            "start_pos": 225,
            "end_pos": 227,
            "annotation": "n_glycosylation_sequon"
        }
    ],
    "ptm_annotation": [],
    "interactions": [],
    "reactions": [],
    "reaction_participants": [],
    "reaction_enzymes": [],
    "biomarkers": [],
    "synthesized_glycans": [],
    "cluster_types": [],
    "sequence_features": {
        "n_linked_sites": [],
        "o_linked_sites": [],
        "snv_sites": [],
        "glycation_sites": [],
        "phosphorylation_sites": [],
        "sequon_annotation_sites": [
            {
                "start_pos": 208,
                "end_pos": 210
            },
            {
                "start_pos": 218,
                "end_pos": 220
            },
            {
                "start_pos": 225,
                "end_pos": 227
            }
        ]
    },
    "section_stats": [
        {
            "table_id": "glycosylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported_with_glycan",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_predicted",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_automatic_literature_mining",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "phosphorylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_non_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "publication",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                }
            ],
            "sort_fields": []
        }
    ]
}