{ "uniprot_canonical_ac": "C9JQL5-1", "uniprot_ac": "C9JQL5", "uniprot_id": "DSA2D_HUMAN", "mass": { "chemical_mass": 14796.0, "monoisotopic_mass": 14796.0 }, "refseq": {}, "gene_names": [], "protein_names": [ { "name": "Putative dispanin subfamily A member 2d", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "C9JQL5" }, { "name": "DSPA2d", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "C9JQL5" } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "C9JQL5", "url": "https://www.uniprot.org/uniprot/C9JQL5" } ], "common_name": "Human" } ], "gene": [ { "name": "", "url": "https://www.uniprot.org/uniprot/C9JQL5", "locus": {} } ], "crossref": [ { "id": "IPR007593", "url": "https://www.ebi.ac.uk/interpro/entry/IPR007593", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "NX_C9JQL5", "url": "https://www.nextprot.org/entry/NX_C9JQL5", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "C9JQL5", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=C9JQL5", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "PTHR13999", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR13999", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR13999:SF23", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR13999:SF23", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF04505", "url": "http://pfam.xfam.org/family/PF04505", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "C9JQL5", "url": "https://pharos.nih.gov/targets/C9JQL5", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "C9JQL5", "url": "https://www.uniprot.org/uniprot/C9JQL5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "C9JQL5-1", "url": "https://www.uniprot.org/uniprot/C9JQL5-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MNHTVQTFFSPVNSGQPPNYEMLKEEHKVAVLGVPHNPAPPTSTVIHIRSKTSVPHHVVWSLFNTLFMNPCCLGFIAFAYSVKSRDRKMVGNVTGAQAYASTTKCLNIWALILGILMTILLIIIPVLIFQAHR", "length": 133, "header": "sp|C9JQL5-1|DSA2D_HUMAN Isoform 1 of Putative dispanin subfamily A member 2d OS=Homo sapiens OX=9606 GN= PE=5 SV=1 CANONICAL=C9JQL5-1" }, "isoforms": [ { "isoform_ac": "C9JQL5-1", "url": "", "sequence": { "sequence": "MNHTVQTFFSPVNSGQPPNYEMLKEEHKVAVLGVPHNPAPPTSTVIHIRSKTSVPHHVVWSLFNTLFMNPCCLGFIAFAYSVKSRDRKMVGNVTGAQAYASTTKCLNIWALILGILMTILLIIIPVLIFQAHR", "length": 133, "header": "sp|C9JQL5-1|DSA2D_HUMAN Isoform 1 of Putative dispanin subfamily A member 2d OS=Homo sapiens OX=9606 GN= PE=5 SV=1 CANONICAL=C9JQL5-1" }, "locus": {} } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "evidence": [ { "id": "C9JQL5", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=C9JQL5" }, { "id": "28510447", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28510447" } ] } ], "phosphorylation": [], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "The dispanins: a novel gene family of ancient origin that contains 14 human members.", "journal": "PLoS ONE", "date": "2012", "authors": "Sallman Almen M, Bringeland N, Fredriksson R, Schioth HB", "evidence": [ { "database": "UniProtKB", "id": "C9JQL5", "url": "https://www.uniprot.org/uniprot/C9JQL5" } ], "reference": [ { "type": "PubMed", "id": "22363774", "url": "https://glygen.org/publication/PubMed/22363774" } ] }, { "title": "Synthesis of a Highly Azide-Reactive and Thermosensitive Biofunctional Reagent for Efficient Enrichment and Large-Scale Identification of O-GlcNAc Proteins by Mass Spectrometry.", "journal": "Analytical chemistry", "date": "2017", "authors": "Zhang W, Liu T, Dong H, Bai H, Tian F, Shi Z, Chen M, Wang J, Qin W, Qian X", "evidence": [ { "database": "O-GlcNAc Database", "id": "C9JQL5", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=C9JQL5" } ], "reference": [ { "type": "PubMed", "id": "28510447", "url": "https://glygen.org/publication/PubMed/28510447" } ] } ], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "C9JQL5", "url": "https://www.uniprot.org/uniprot/C9JQL5" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 7, "go_terms": [ { "name": "defense response to virus", "id": "GO:0051607", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051607", "evidence": [ { "database": "UniProtKB", "id": "C9JQL5", "url": "https://www.uniprot.org/uniprot/C9JQL5" } ], "pmid": "" }, { "name": "negative regulation of viral genome replication", "id": "GO:0045071", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045071", "evidence": [ { "database": "UniProtKB", "id": "C9JQL5", "url": "https://www.uniprot.org/uniprot/C9JQL5" } ], "pmid": "" }, { "name": "type I interferon-mediated signaling pathway", "id": "GO:0060337", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060337", "evidence": [ { "database": "UniProtKB", "id": "C9JQL5", "url": "https://www.uniprot.org/uniprot/C9JQL5" } ], "pmid": "" }, { "name": "response to type II interferon", "id": "GO:0034341", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034341", "evidence": [ { "database": "UniProtKB", "id": "C9JQL5", "url": "https://www.uniprot.org/uniprot/C9JQL5" } ], "pmid": "" }, { "name": "response to interferon-alpha", "id": "GO:0035455", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035455", "evidence": [ { "database": "UniProtKB", "id": "C9JQL5", "url": "https://www.uniprot.org/uniprot/C9JQL5" } ], "pmid": "" }, { "name": "response to interferon-beta", "id": "GO:0035456", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035456", "evidence": [ { "database": "UniProtKB", "id": "C9JQL5", "url": "https://www.uniprot.org/uniprot/C9JQL5" } ], "pmid": "" }, { "name": "negative regulation of viral entry into host cell", "id": "GO:0046597", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046597", "evidence": [ { "database": "UniProtKB", "id": "C9JQL5", "url": "https://www.uniprot.org/uniprot/C9JQL5" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 2, "end_pos": 4, "annotation": "n_glycosylation_sequon" }, { "start_pos": 92, "end_pos": 94, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 2, "end_pos": 4 }, { "start_pos": 92, "end_pos": 94 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }