{ "uniprot_canonical_ac": "C7G044-1", "uniprot_ac": "C7G044", "uniprot_id": "C7G044_DICDI", "mass": { "chemical_mass": 40670.0, "monoisotopic_mass": 40670.0 }, "refseq": { "ac": "XP_002649127", "name": "hypothetical protein", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_002649127" }, "gene_names": [ { "name": "DDB_G0295781", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/C7G044", "id": "C7G044" } ], "protein_names": [ { "name": "Glutamine amidotransferase type-2 domain-containing protein", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "C7G044" }, { "name": "hypothetical protein", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_002649127", "id": "XP_002649127" } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Dictyostelium discoideum", "taxid": 44689, "evidence": [ { "database": "UniProtKB", "id": "C7G044", "url": "https://www.uniprot.org/uniprot/C7G044" } ], "common_name": "Cellular slime molds" } ], "gene": [ { "name": "", "url": "https://www.uniprot.org/uniprot/C7G044", "locus": {} } ], "crossref": [ { "id": "cd01908", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd01908", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "DDB_G0295781", "url": "http://dictybase.org/gene/DDB_G0295781", "database": "dictyBase", "categories": [ "Organism-specific" ] }, { "id": "8625637", "url": "https://www.ncbi.nlm.nih.gov/gene/8625637", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR017932", "url": "https://www.ebi.ac.uk/interpro/entry/IPR017932", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR026869", "url": "https://www.ebi.ac.uk/interpro/entry/IPR026869", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR029055", "url": "https://www.ebi.ac.uk/interpro/entry/IPR029055", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "ddi:DDB_G0295781", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+ddi:DDB_G0295781", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "PAWSNIN", "url": "https://omabrowser.org/oma/group/PAWSNIN/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "PTHR43187", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR43187", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR43187:SF1", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR43187:SF1", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF13230", "url": "http://pfam.xfam.org/family/PF13230", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "XP_002649127", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_002649127", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "C7G044", "url": "https://www.uniprot.org/uniprot/C7G044", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "C7G044-1", "url": "https://www.uniprot.org/uniprot/C7G044-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MCRFIFYLGAPIRLSTIISEPSHSLLVQSLHSSCQSVSLNADGFGIAWYVPDITPIPGVFKDITPAWSNINLRQLARVTKSGCIAAHIRAASAGAIVNTNCHPFTFRNFSWMHNGCIPFYNHLKRDIYSMISDSAFELIKGTTDSELLFALFISNYEKEIGYKAEKAKTNGTVYYSTHCALEPEEKPYPSHVNNTEIIPKVLQETIFQIHELLLQYELKNGLLSNNTGSEGNVNGNNGSNGAGASNSCGGSGSSGNNSPTDLLMEGASLRQTNSCCKLNLAVTDGFTVVATRYVTGMPEAAHSLYWSRGSTIKFDDGHCQLGRSTDSSPHSKSYSESLVISSEPLASDFQCEPVPVNHIVIGNSSGYFSIEPIN", "length": 374, "header": "tr|C7G044-1|C7G044_DICDI Isoform 1 of Glutamine amidotransferase type-2 domain-containing protein OS=Dictyostelium discoideum OX=44689 GN= PE=4 SV=1 CANONICAL=C7G044-1" }, "isoforms": [ { "isoform_ac": "C7G044-1", "url": "", "sequence": { "sequence": "MCRFIFYLGAPIRLSTIISEPSHSLLVQSLHSSCQSVSLNADGFGIAWYVPDITPIPGVFKDITPAWSNINLRQLARVTKSGCIAAHIRAASAGAIVNTNCHPFTFRNFSWMHNGCIPFYNHLKRDIYSMISDSAFELIKGTTDSELLFALFISNYEKEIGYKAEKAKTNGTVYYSTHCALEPEEKPYPSHVNNTEIIPKVLQETIFQIHELLLQYELKNGLLSNNTGSEGNVNGNNGSNGAGASNSCGGSGSSGNNSPTDLLMEGASLRQTNSCCKLNLAVTDGFTVVATRYVTGMPEAAHSLYWSRGSTIKFDDGHCQLGRSTDSSPHSKSYSESLVISSEPLASDFQCEPVPVNHIVIGNSSGYFSIEPIN", "length": 374, "header": "tr|C7G044-1|C7G044_DICDI Isoform 1 of Glutamine amidotransferase type-2 domain-containing protein OS=Dictyostelium discoideum OX=44689 GN= PE=4 SV=1 CANONICAL=C7G044-1" }, "locus": {} } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "The genome of the social amoeba Dictyostelium discoideum.", "journal": "Nature", "date": "2005", "authors": "Eichinger L, Pachebat J A, Gl\u00f6ckner G, Rajandream M-A, Sucgang R, Berriman M, Song J, Olsen R, Szafranski K, Xu Q, Tunggal B, Kummerfeld S, Madera M, Konfortov B A, Rivero F, Bankier A T, Lehmann R, Hamlin N, Davies R, Gaudet P, Fey P, Pilcher K, Chen G, Saunders D, Sodergren E, Davis P, Kerhornou A, Nie X, Hall N, Anjard C, Hemphill L, Bason N, Farbrother P, Desany B, Just E, Morio T, Rost R, Churcher C, Cooper J, Haydock S, van Driessche N, Cronin A, Goodhead I, Muzny D, Mourier T, Pain A, Lu M, Harper D, Lindsay R, Hauser H, James K, Quiles M, Madan Babu M, Saito T, Buchrieser C, Wardroper A, Felder M, Thangavelu M, Johnson D, Knights A, Loulseged H, Mungall K, Oliver K, Price C, Quail M A, Urushihara H, Hernandez J, Rabbinowitsch E, Steffen D, Sanders M, Ma J, Kohara Y, Sharp S, Simmonds M, Spiegler S, Tivey A, Sugano S, White B, Walker D, Woodward J, Winckler T, Tanaka Y, Shaulsky G, Schleicher M, Weinstock G, Rosenthal A, Cox E C, Chisholm R L, Gibbs R, Loomis W F, Platzer M, Kay R R, Williams J, Dear P H, Noegel A A, Barrell B, Kuspa A", "evidence": [ { "database": "UniProtKB", "id": "C7G044", "url": "https://www.uniprot.org/uniprot/C7G044" } ], "reference": [ { "type": "PubMed", "id": "15875012", "url": "https://glygen.org/publication/PubMed/15875012" } ] } ], "pathway": [ { "id": "ddi:DDB_G0295781", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+ddi:DDB_G0295781", "resource": "KEGG Pathway" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "glutathione catabolic process", "id": "GO:0006751", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006751", "evidence": [ { "database": "UniProtKB", "id": "C7G044", "url": "https://www.uniprot.org/uniprot/C7G044" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "C7G044", "url": "https://www.uniprot.org/uniprot/C7G044" } ], "pmid": "" }, { "name": "glutathione hydrolase complex", "id": "GO:0061672", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0061672", "evidence": [ { "database": "UniProtKB", "id": "C7G044", "url": "https://www.uniprot.org/uniprot/C7G044" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "omega peptidase activity", "id": "GO:0008242", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008242", "evidence": [ { "database": "UniProtKB", "id": "C7G044", "url": "https://www.uniprot.org/uniprot/C7G044" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 108, "end_pos": 110, "annotation": "n_glycosylation_sequon" }, { "start_pos": 170, "end_pos": 172, "annotation": "n_glycosylation_sequon" }, { "start_pos": 193, "end_pos": 195, "annotation": "n_glycosylation_sequon" }, { "start_pos": 225, "end_pos": 227, "annotation": "n_glycosylation_sequon" }, { "start_pos": 237, "end_pos": 239, "annotation": "n_glycosylation_sequon" }, { "start_pos": 256, "end_pos": 258, "annotation": "n_glycosylation_sequon" }, { "start_pos": 363, "end_pos": 365, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 108, "end_pos": 110 }, { "start_pos": 170, "end_pos": 172 }, { "start_pos": 193, "end_pos": 195 }, { "start_pos": 225, "end_pos": 227 }, { "start_pos": 237, "end_pos": 239 }, { "start_pos": 256, "end_pos": 258 }, { "start_pos": 363, "end_pos": 365 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }