{ "uniprot_canonical_ac": "C0HM98-1", "uniprot_ac": "C0HM98", "uniprot_id": "DDUP_HUMAN", "mass": { "chemical_mass": 19739.0, "monoisotopic_mass": 19739.0 }, "refseq": {}, "gene_names": [ { "name": "CTBP1-DT", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/C0HM98", "id": "C0HM98" } ], "protein_names": [ { "name": "DNA damage up-regulated protein", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "C0HM98" }, { "name": "DDUP", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "C0HM98" } ], "function": [ { "annotation": "Promotes DNA damage repair through both homologous recombination repair (HRR) and post-replication repair (PRR) mechanisms (PubMed:35849344). Enhances the retention of DNA damage response protein RAD18 at sites of DNA damage (PubMed:35849344). This allows for HRR via association of RAD18 with RAD51C and for PRR via RAD18-mediated promotion of PCNA monoubiquitination (PubMed:35849344).", "evidence": [ { "database": "UniProtKB", "id": "C0HM98", "url": "https://www.uniprot.org/uniprot/C0HM98#function" }, { "database": "PubMed", "id": "35849344", "url": "https://glygen.org/publication/PubMed/35849344" } ] } ], "disease": [], "snv": [], "mutagenesis": [ { "start_pos": 174, "end_pos": 174, "sequence_org": "T", "sequence_mut": "A", "comment": "Abolishes DNA damage repair function as well as DDUP foci formation and enrichment of DDUP in chromatin upon DNA damage. Abolishes interaction with H2AX and RAD18.", "evidence": [ { "database": "UniProtKB", "id": "C0HM98", "url": "https://www.uniprot.org/uniprot/C0HM98" }, { "database": "PubMed", "id": "35849344", "url": "https://glygen.org/publication/PubMed/35849344" } ] }, { "start_pos": 174, "end_pos": 174, "sequence_org": "T", "sequence_mut": "D", "comment": "Does not affect interaction with H2AX or RAD18.", "evidence": [ { "database": "UniProtKB", "id": "C0HM98", "url": "https://www.uniprot.org/uniprot/C0HM98" }, { "database": "PubMed", "id": "35849344", "url": "https://glygen.org/publication/PubMed/35849344" } ] } ], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "C0HM98", "url": "https://www.uniprot.org/uniprot/C0HM98" } ], "common_name": "Human" } ], "gene": [ { "name": "CTBP1-DT", "url": "https://www.uniprot.org/uniprot/C0HM98", "locus": {} } ], "crossref": [ { "id": "28307", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=28307", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "C0HM98", "url": "https://www.uniprot.org/uniprot/C0HM98", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "C0HM98-1", "url": "https://www.uniprot.org/uniprot/C0HM98-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MWLVECTGRDLTGLSCLLSMDRQPRRRQHVAGCRDVPPPLPQGSWGQTSPRHSILCSKSGCDLLGGGEYNGETSGEEFLAPAWTCRAQQAATWLSVQQTSHKALGPAGGAAMSSKLSPEEQFLSRIHFLRTFMCSVAGAELPGIPQATENGEGCRPARDPASSPSSLSMASVYTQCSSAQLVSALS", "length": 186, "header": "sp|C0HM98-1|DDUP_HUMAN Isoform 1 of DNA damage up-regulated protein OS=Homo sapiens OX=9606 GN=CTBP1-DT PE=1 SV=1 CANONICAL=C0HM98-1" }, "isoforms": [ { "isoform_ac": "C0HM98-1", "url": "", "sequence": { "sequence": "MWLVECTGRDLTGLSCLLSMDRQPRRRQHVAGCRDVPPPLPQGSWGQTSPRHSILCSKSGCDLLGGGEYNGETSGEEFLAPAWTCRAQQAATWLSVQQTSHKALGPAGGAAMSSKLSPEEQFLSRIHFLRTFMCSVAGAELPGIPQATENGEGCRPARDPASSPSSLSMASVYTQCSSAQLVSALS", "length": 186, "header": "sp|C0HM98-1|DDUP_HUMAN Isoform 1 of DNA damage up-regulated protein OS=Homo sapiens OX=9606 GN=CTBP1-DT PE=1 SV=1 CANONICAL=C0HM98-1" }, "locus": {} } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "LncRNA CTBP1-DT-encoded microprotein DDUP sustains DNA damage response signalling to trigger dual DNA repair mechanisms.", "journal": "Nucleic acids research", "date": "2022-08-12", "authors": "Yu Ruyuan, Hu Yameng, Zhang Shuxia, Li Xincheng, Tang Miaoling, Yang Meisongzhu, Wu Xingui, Li Ziwen, Liao Xinyi, Xu Yingru, Li Man, Chen Suwen, Qian Wanying, Gong Li-Yun, Song Libing, Li Jun", "evidence": [ { "database": "UniProtKB", "id": "C0HM98", "url": "https://www.uniprot.org/uniprot/C0HM98" } ], "reference": [ { "type": "PubMed", "id": "35849344", "url": "https://glygen.org/publication/PubMed/35849344" } ] } ], "pathway": [], "orthologs": [], "go_annotation": {}, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [ { "annotation": "Phosphorylated in an ATR-dependent manner; phosphorylation is required for interaction with H2AX and RAD18 and for DDUP-mediated DNA damage repair.", "evidence": [ { "database": "UniProtKB", "id": "C0HM98", "url": "https://www.uniprot.org/uniprot/C0HM98" }, { "database": "PubMed", "id": "35849344", "url": "https://glygen.org/publication/PubMed/35849344" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }