{ "uniprot_canonical_ac": "C0HM83-1", "uniprot_ac": "C0HM83", "uniprot_id": "SHMOS_HUMAN", "mass": { "chemical_mass": 6637.0, "monoisotopic_mass": 6637.0 }, "refseq": {}, "gene_names": [], "protein_names": [ { "name": "Protein SHMOOSE", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "C0HM83" }, { "name": "Small human mitochondrial ORF over serine tRNA", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "C0HM83" } ], "function": [ { "annotation": "Increases neural cell metabolic activity and mitochondrial oxygen consumption rate.", "evidence": [ { "database": "UniProtKB", "id": "C0HM83", "url": "https://www.uniprot.org/uniprot/C0HM83#function" }, { "database": "PubMed", "id": "36127429", "url": "https://glygen.org/publication/PubMed/36127429" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "C0HM83", "url": "https://www.uniprot.org/uniprot/C0HM83" } ], "common_name": "Human" } ], "gene": [ { "name": "", "url": "https://www.uniprot.org/uniprot/C0HM83", "locus": {} } ], "crossref": [ { "id": "C0HM83", "url": "https://www.uniprot.org/uniprot/C0HM83", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "C0HM83-1", "url": "https://www.uniprot.org/uniprot/C0HM83-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MPPCLTTWLSQLLKDNSYPLVLGPKNFGATPNKSNNHAHYYNHPNPDFPNSPHPYHPR", "length": 58, "header": "sp|C0HM83-1|SHMOS_HUMAN Isoform 1 of Protein SHMOOSE OS=Homo sapiens OX=9606 GN= PE=1 SV=1 CANONICAL=C0HM83-1" }, "isoforms": [ { "isoform_ac": "C0HM83-1", "url": "", "sequence": { "sequence": "MPPCLTTWLSQLLKDNSYPLVLGPKNFGATPNKSNNHAHYYNHPNPDFPNSPHPYHPR", "length": 58, "header": "sp|C0HM83-1|SHMOS_HUMAN Isoform 1 of Protein SHMOOSE OS=Homo sapiens OX=9606 GN= PE=1 SV=1 CANONICAL=C0HM83-1" }, "locus": {} } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "Mitochondrial DNA variation in Alzheimer's disease reveals a unique microprotein called SHMOOSE.", "journal": "Molecular psychiatry", "date": "2022-09-21", "authors": "Miller Brendan, Kim Su-Jeong, Mehta Hemal H, Cao Kevin, Kumagai Hiroshi, Thumaty Neehar, Leelaprachakul Naphada, Braniff Regina Gonzalez, Jiao Henry, Vaughan Joan, Diedrich Jolene, Saghatelian Alan, Arpawong Thalida E, Crimmins Eileen M, Ertekin-Taner Nil\u00fcfer, Tubi Meral A, Hare Evan T, Braskie Meredith N, D\u00e9carie-Spain L\u00e9a, Kanoski Scott E, Grodstein Francine, Bennett David A, Zhao Lu, Toga Arthur W, Wan Junxiang, Yen Kelvin, Cohen Pinchas,", "evidence": [ { "database": "UniProtKB", "id": "C0HM83", "url": "https://www.uniprot.org/uniprot/C0HM83" } ], "reference": [ { "type": "PubMed", "id": "36127429", "url": "https://glygen.org/publication/PubMed/36127429" } ] }, { "title": "Sequence and organization of the human mitochondrial genome.", "journal": "Nature", "date": "1981", "authors": "Anderson S, Bankier AT, Barrell BG, de Bruijn MH, Coulson AR, Drouin J, Eperon IC, Nierlich DP, Roe BA, Sanger F, Schreier PH, Smith AJ, Staden R, Young IG", "evidence": [ { "database": "UniProtKB", "id": "C0HM83", "url": "https://www.uniprot.org/uniprot/C0HM83" } ], "reference": [ { "type": "PubMed", "id": "7219534", "url": "https://glygen.org/publication/PubMed/7219534" } ] } ], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "C0HM83", "url": "https://www.uniprot.org/uniprot/C0HM83" } ], "pmid": "" }, { "name": "mitochondrion", "id": "GO:0005739", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005739", "evidence": [ { "database": "UniProtKB", "id": "C0HM83", "url": "https://www.uniprot.org/uniprot/C0HM83" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 32, "end_pos": 34, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 32, "end_pos": 34 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }