{
    "uniprot_canonical_ac": "C0HM01-1",
    "uniprot_ac": "C0HM01",
    "uniprot_id": "RBRP_HUMAN",
    "mass": {
        "chemical_mass": 8407.0,
        "monoisotopic_mass": 8407.0
    },
    "refseq": {},
    "gene_names": [
        {
            "name": "SEPTIN14P20",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "https://www.uniprot.org/uniprot/C0HM01",
            "id": "C0HM01"
        },
        {
            "name": "C20orf69",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "https://www.uniprot.org/uniprot/C0HM01",
            "id": "C0HM01"
        },
        {
            "name": "LINC00266-1",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "https://www.uniprot.org/uniprot/C0HM01",
            "id": "C0HM01"
        }
    ],
    "protein_names": [
        {
            "name": "Putative RNA-binding regulatory peptide",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "",
            "id": "C0HM01"
        },
        {
            "name": "RBRP",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "C0HM01"
        },
        {
            "name": "Septin 14 pseudogene 20",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "C0HM01"
        }
    ],
    "function": [
        {
            "annotation": "Enhances binding of IGF2BP1 to N6-methyladenosine (m6A)-containing mRNAs, thereby contributing to increased mRNA stability (PubMed:32245947). Also increases the interaction of IGF2BP1 with RNA stabilizers ELAVL1/HUR, MATR3 and PABPC1, and increases the interaction of RNA stabilizers ELAVL1/HUR, MATR3 and PABPC1 with m6A-containing mRNAs (PubMed:32245947). Contributes to MYC stability by enhancing binding of IGF2BP1 to m6A-containing MYC mRNAs and increasing recruitment of RNA stabilizing proteins to m6A-containing MYC mRNAs (PubMed:32245947).",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "C0HM01",
                    "url": "https://www.uniprot.org/uniprot/C0HM01#function"
                },
                {
                    "database": "PubMed",
                    "id": "32245947",
                    "url": "https://glygen.org/publication/PubMed/32245947"
                }
            ]
        }
    ],
    "disease": [],
    "snv": [],
    "mutagenesis": [
        {
            "start_pos": 19,
            "end_pos": 19,
            "sequence_org": "G",
            "sequence_mut": "A",
            "comment": "Abolishes binding to IGF2BP1 and does not increase binding of IGF2BP1 to m6A-containing RNAs or to RNA stabilizers ELAVL1/HUR, MATR3 or PABPC1.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "C0HM01",
                    "url": "https://www.uniprot.org/uniprot/C0HM01"
                },
                {
                    "database": "PubMed",
                    "id": "32245947",
                    "url": "https://glygen.org/publication/PubMed/32245947"
                }
            ]
        },
        {
            "start_pos": 63,
            "end_pos": 63,
            "sequence_org": "G",
            "sequence_mut": "A",
            "comment": "No effect on binding to IGF2BP1.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "C0HM01",
                    "url": "https://www.uniprot.org/uniprot/C0HM01"
                },
                {
                    "database": "PubMed",
                    "id": "32245947",
                    "url": "https://glygen.org/publication/PubMed/32245947"
                }
            ]
        }
    ],
    "expression_tissue": [],
    "expression_disease": [],
    "species": [
        {
            "name": "Homo sapiens",
            "taxid": 9606,
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "C0HM01",
                    "url": "https://www.uniprot.org/uniprot/C0HM01"
                }
            ],
            "common_name": "Human"
        }
    ],
    "gene": [
        {
            "name": "SEPTIN14P20",
            "url": "https://www.uniprot.org/uniprot/C0HM01",
            "locus": {}
        }
    ],
    "crossref": [
        {
            "id": "SEPTIN14P20",
            "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=SEPTIN14P20",
            "database": "GeneCards",
            "categories": [
                "Gene Annotation",
                "Organism-specific"
            ]
        },
        {
            "id": "51706",
            "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=51706",
            "database": "HGNC",
            "categories": [
                "Organism-specific"
            ]
        },
        {
            "id": "C0HM01",
            "url": "https://www.uniprot.org/uniprot/C0HM01",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "C0HM01-1",
            "url": "https://www.uniprot.org/uniprot/C0HM01-1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        }
    ],
    "sequence": {
        "sequence": "MIQQEEIRKLEEEKKQLEGEIIDFYKMKAASEALQTQLSTDTKKDKHPDPYEFLLLRKIKHPGFNEELSPC",
        "length": 71,
        "header": "sp|C0HM01-1|RBRP_HUMAN Isoform 1 of Putative RNA-binding regulatory peptide  OS=Homo sapiens OX=9606 GN=SEPTIN14P20 PE=5 SV=1 CANONICAL=C0HM01-1"
    },
    "isoforms": [
        {
            "isoform_ac": "C0HM01-1",
            "url": "",
            "sequence": {
                "sequence": "MIQQEEIRKLEEEKKQLEGEIIDFYKMKAASEALQTQLSTDTKKDKHPDPYEFLLLRKIKHPGFNEELSPC",
                "length": 71,
                "header": "sp|C0HM01-1|RBRP_HUMAN Isoform 1 of Putative RNA-binding regulatory peptide  OS=Homo sapiens OX=9606 GN=SEPTIN14P20 PE=5 SV=1 CANONICAL=C0HM01-1"
            },
            "locus": {}
        }
    ],
    "glycosylation": [],
    "phosphorylation": [],
    "glycation": [],
    "keywords": [],
    "publication": [
        {
            "title": "An oncopeptide regulates m(6)A recognition by the m(6)A reader IGF2BP1 and tumorigenesis.",
            "journal": "Nature communications",
            "date": "2020",
            "authors": "Zhu S, Wang JZ, Chen, He YT, Meng N, Chen M, Lu RX, Chen XH, Zhang XL, Yan GR",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "C0HM01",
                    "url": "https://www.uniprot.org/uniprot/C0HM01"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "32245947",
                    "url": "https://glygen.org/publication/PubMed/32245947"
                }
            ]
        }
    ],
    "pathway": [],
    "orthologs": [],
    "go_annotation": {
        "categories": [
            {
                "name": "Biological Process",
                "total": 2,
                "go_terms": [
                    {
                        "name": "mRNA stabilization",
                        "id": "GO:0048255",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048255",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "C0HM01",
                                "url": "https://www.uniprot.org/uniprot/C0HM01"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "positive regulation of mRNA binding",
                        "id": "GO:1902416",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1902416",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "C0HM01",
                                "url": "https://www.uniprot.org/uniprot/C0HM01"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            }
        ]
    },
    "pro_annotation": [],
    "site_annotation": [],
    "ptm_annotation": [],
    "interactions": [],
    "reactions": [],
    "reaction_participants": [],
    "reaction_enzymes": [],
    "biomarkers": [],
    "synthesized_glycans": [],
    "cluster_types": [],
    "sequence_features": {
        "n_linked_sites": [],
        "o_linked_sites": [],
        "snv_sites": [],
        "glycation_sites": [],
        "phosphorylation_sites": [],
        "sequon_annotation_sites": []
    },
    "section_stats": [
        {
            "table_id": "glycosylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported_with_glycan",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_predicted",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_automatic_literature_mining",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "phosphorylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_non_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "publication",
            "table_stats": [
                {
                    "field": "total",
                    "count": 1
                }
            ],
            "sort_fields": [
                "title",
                "journal",
                "date",
                "authors"
            ]
        }
    ]
}