{ "uniprot_canonical_ac": "C0HLZ6-1", "uniprot_ac": "C0HLZ6", "uniprot_id": "HAS3P_HUMAN", "mass": { "chemical_mass": 5567.0, "monoisotopic_mass": 5567.0 }, "refseq": {}, "gene_names": [ { "name": "HOXB-AS3", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/C0HLZ6", "id": "C0HLZ6" } ], "protein_names": [ { "name": "HOXB-AS3 peptide", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "C0HLZ6" } ], "function": [ { "annotation": "Blocks the binding of HNRNPA1 to the intronic sequences flanking exon 9 of the PKM gene by competitively binding to the HNRNPA1 RGG-box motif (PubMed:28985503). This inhibits inclusion of exon 9 and promotes inclusion of exon 10, suppressing formation of the PKM M2 isoform and promoting production of the M1 isoform (PubMed:28985503). Also suppresses HNRNPA1-mediated processing of microRNA 18a (miR-18a) (PubMed:28985503). Promotes MYC stability through interaction with IGF2BP2 (PubMed:34457052).", "evidence": [ { "database": "UniProtKB", "id": "C0HLZ6", "url": "https://www.uniprot.org/uniprot/C0HLZ6#function" }, { "database": "PubMed", "id": "34457052", "url": "https://glygen.org/publication/PubMed/34457052" }, { "database": "PubMed", "id": "28985503", "url": "https://glygen.org/publication/PubMed/28985503" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "C0HLZ6", "url": "https://www.uniprot.org/uniprot/C0HLZ6" } ], "common_name": "Human" } ], "gene": [ { "name": "HOXB-AS3", "url": "https://www.uniprot.org/uniprot/C0HLZ6", "locus": {} } ], "crossref": [ { "id": "HOXB-AS3", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=HOXB-AS3", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "40283", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=40283", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "PR_C0HLZ6", "url": "http://purl.obolibrary.org/obo/PR_C0HLZ6", "database": "PRO", "categories": [ "Protein" ] }, { "id": "C0HLZ6", "url": "https://www.uniprot.org/uniprot/C0HLZ6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "C0HLZ6-1", "url": "https://www.uniprot.org/uniprot/C0HLZ6-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MPVLPGTQRYPHQRRRFQAAGGGAESGKRGSEEAPGVAWSGSESGRDAATPAW", "length": 53, "header": "sp|C0HLZ6-1|HAS3P_HUMAN Isoform 1 of HOXB-AS3 peptide OS=Homo sapiens OX=9606 GN=HOXB-AS3 PE=1 SV=1 CANONICAL=C0HLZ6-1" }, "isoforms": [ { "isoform_ac": "C0HLZ6-1", "url": "", "sequence": { "sequence": "MPVLPGTQRYPHQRRRFQAAGGGAESGKRGSEEAPGVAWSGSESGRDAATPAW", "length": 53, "header": "sp|C0HLZ6-1|HAS3P_HUMAN Isoform 1 of HOXB-AS3 peptide OS=Homo sapiens OX=9606 GN=HOXB-AS3 PE=1 SV=1 CANONICAL=C0HLZ6-1" }, "locus": {} } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "A Peptide Encoded by a Putative lncRNA HOXB-AS3 Suppresses Colon Cancer Growth.", "journal": "Molecular cell", "date": "2017", "authors": "Huang JZ, Chen M, Chen D, Gao XC, Zhu S, Huang H, Hu M, Zhu H, Yan GR", "evidence": [ { "database": "UniProtKB", "id": "C0HLZ6", "url": "https://www.uniprot.org/uniprot/C0HLZ6" } ], "reference": [ { "type": "PubMed", "id": "28985503", "url": "https://glygen.org/publication/PubMed/28985503" } ] }, { "title": "A micro-peptide encoded by HOXB-AS3 promotes the proliferation and viability of oral squamous cell carcinoma cell lines by directly binding with IGF2BP2 to stabilize c-Myc.", "journal": "Oncology letters", "date": "2021-10", "authors": "Leng Fei, Miu Yan-Yu, Zhang Yi, Luo Hao, Lu Xiao-Li, Cheng Hui, Zheng Zhi-Guo", "evidence": [ { "database": "UniProtKB", "id": "C0HLZ6", "url": "https://www.uniprot.org/uniprot/C0HLZ6" } ], "reference": [ { "type": "PubMed", "id": "34457052", "url": "https://glygen.org/publication/PubMed/34457052" } ] } ], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 5, "go_terms": [ { "name": "mRNA processing", "id": "GO:0006397", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006397", "evidence": [ { "database": "UniProtKB", "id": "C0HLZ6", "url": "https://www.uniprot.org/uniprot/C0HLZ6" } ], "pmid": "" }, { "name": "protein stabilization", "id": "GO:0050821", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050821", "evidence": [ { "database": "UniProtKB", "id": "C0HLZ6", "url": "https://www.uniprot.org/uniprot/C0HLZ6" } ], "pmid": "" }, { "name": "RNA splicing", "id": "GO:0008380", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008380", "evidence": [ { "database": "UniProtKB", "id": "C0HLZ6", "url": "https://www.uniprot.org/uniprot/C0HLZ6" } ], "pmid": "" }, { "name": "regulation of RNA splicing", "id": "GO:0043484", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043484", "evidence": [ { "database": "UniProtKB", "id": "C0HLZ6", "url": "https://www.uniprot.org/uniprot/C0HLZ6" } ], "pmid": "" }, { "name": "negative regulation of pre-miRNA processing", "id": "GO:2000632", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000632", "evidence": [ { "database": "UniProtKB", "id": "C0HLZ6", "url": "https://www.uniprot.org/uniprot/C0HLZ6" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }