{ "uniprot_canonical_ac": "B0L3A2-1", "uniprot_ac": "B0L3A2", "uniprot_id": "DESPR_HUMAN", "mass": { "chemical_mass": 9677.0, "monoisotopic_mass": 9677.0 }, "refseq": {}, "gene_names": [ { "name": "FBXW7-AS1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/B0L3A2", "id": "B0L3A2" }, { "name": "DEAR", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/B0L3A2", "id": "B0L3A2" }, { "name": "DEspR", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/B0L3A2", "id": "B0L3A2" } ], "protein_names": [ { "name": "Dual endothelin-1/VEGF signal peptide receptor", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "B0L3A2" }, { "name": "DEspR protein", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "B0L3A2" }, { "name": "Dual endothelin-1/VEGFsp receptor", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "B0L3A2" }, { "name": "FBXW7 antisense RNA 1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "B0L3A2" } ], "function": [ { "annotation": "Dual receptor for both endothelin-1 and the signal sequence of vascular endothelial growth factor A (PubMed:17446437, PubMed:24465725). Does not act as a receptor for angiotensin-2 (PubMed:17446437). Does not bind the VEGFA mature protein (By similarity). May play a role in angiogenesis with a significant role in cardiovascular and neural development (By similarity).", "evidence": [ { "database": "UniProtKB", "id": "B0L3A2", "url": "https://www.uniprot.org/uniprot/B0L3A2#function" }, { "database": "PubMed", "id": "17446437", "url": "https://glygen.org/publication/PubMed/17446437" }, { "database": "UniProtKB", "id": "Q2QKR2", "url": "https://www.uniprot.org/uniprot/Q2QKR2#function" }, { "database": "PubMed", "id": "24465725", "url": "https://glygen.org/publication/PubMed/24465725" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "B0L3A2", "url": "https://www.uniprot.org/uniprot/B0L3A2" } ], "common_name": "Human" } ], "gene": [ { "name": "FBXW7-AS1", "url": "https://www.uniprot.org/uniprot/B0L3A2", "locus": {} } ], "crossref": [ { "id": "FBXW7-AS1", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=FBXW7-AS1", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "52397", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=52397", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "NX_B0L3A2", "url": "https://www.nextprot.org/entry/NX_B0L3A2", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "PR_B0L3A2", "url": "http://purl.obolibrary.org/obo/PR_B0L3A2", "database": "PRO", "categories": [ "Protein" ] }, { "id": "B0L3A2", "url": "https://www.uniprot.org/uniprot/B0L3A2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "B0L3A2-1", "url": "https://www.uniprot.org/uniprot/B0L3A2-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MTMFKGSNEMKSRWNWGSITCIICFTCVGSQLSMSSSKASNFSGPLQLYQRELEIFIVLTDVPNYRLIKENSHLHTTIVDQGRTV", "length": 85, "header": "sp|B0L3A2-1|DESPR_HUMAN Isoform 1 of Dual endothelin-1/VEGF signal peptide receptor OS=Homo sapiens OX=9606 GN=FBXW7-AS1 PE=1 SV=1 CANONICAL=B0L3A2-1" }, "isoforms": [ { "isoform_ac": "B0L3A2-1", "url": "", "sequence": { "sequence": "MTMFKGSNEMKSRWNWGSITCIICFTCVGSQLSMSSSKASNFSGPLQLYQRELEIFIVLTDVPNYRLIKENSHLHTTIVDQGRTV", "length": 85, "header": "sp|B0L3A2-1|DESPR_HUMAN Isoform 1 of Dual endothelin-1/VEGF signal peptide receptor OS=Homo sapiens OX=9606 GN=FBXW7-AS1 PE=1 SV=1 CANONICAL=B0L3A2-1" }, "locus": {} } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "Association of ATP1A1 and dear single-nucleotide polymorphism haplotypes with essential hypertension: sex-specific and haplotype-specific effects.", "journal": "Circulation research", "date": "2007-05-25", "authors": "Glorioso Nicola, Herrera Victoria L M, Bagamasbad Pia, Filigheddu Fabiana, Troffa Chiara, Argiolas Giuseppe, Bulla Emanuela, Decano Julius L, Ruiz-Opazo Nelson", "evidence": [ { "database": "UniProtKB", "id": "B0L3A2", "url": "https://www.uniprot.org/uniprot/B0L3A2" } ], "reference": [ { "type": "PubMed", "id": "17446437", "url": "https://glygen.org/publication/PubMed/17446437" } ] }, { "title": "DEspR roles in tumor vasculo-angiogenesis, invasiveness, CSC-survival and anoikis resistance: a 'common receptor coordinator' paradigm.", "journal": "PloS one", "date": "2014", "authors": "Herrera Victoria L, Decano Julius L, Tan Glaiza A, Moran Ann M, Pasion Khristine A, Matsubara Yuichi, Ruiz-Opazo Nelson", "evidence": [ { "database": "UniProtKB", "id": "B0L3A2", "url": "https://www.uniprot.org/uniprot/B0L3A2" } ], "reference": [ { "type": "PubMed", "id": "24465725", "url": "https://glygen.org/publication/PubMed/24465725" } ] }, { "title": "Confirmation of translatability and functionality certifies the dual endothelin1/VEGFsp receptor (DEspR) protein.", "journal": "BMC molecular biology", "date": "2016", "authors": "Herrera VL, Steffen M, Moran AM, Tan GA, Pasion KA, Rivera K, Pappin DJ, Ruiz-Opazo N", "evidence": [ { "database": "UniProtKB", "id": "B0L3A2", "url": "https://www.uniprot.org/uniprot/B0L3A2" } ], "reference": [ { "type": "PubMed", "id": "27301377", "url": "https://glygen.org/publication/PubMed/27301377" } ] }, { "title": "Humanized anti-DEspR IgG4S228P antibody increases overall survival in a pancreatic cancer stem cell-xenograft peritoneal carcinomatosis ratnu/nu model.", "journal": "BMC Cancer", "date": "2021", "authors": "Gromisch Christopher M, Tan Glaiza L A, Pasion Khristine Amber, Moran Ann-Marie, Gromisch Matthew S, Grinstaff Mark W, Carr Francis J, Herrera Victoria L M, Ruiz-Opazo Nelson", "evidence": [ { "database": "UniProtKB", "id": "B0L3A2", "url": "https://www.uniprot.org/uniprot/B0L3A2" } ], "reference": [ { "type": "PubMed", "id": "33853558", "url": "https://glygen.org/publication/PubMed/33853558" } ] } ], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "endothelin receptor activity", "id": "GO:0004962", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004962", "evidence": [ { "database": "UniProtKB", "id": "B0L3A2", "url": "https://www.uniprot.org/uniprot/B0L3A2" } ], "pmid": "" }, { "name": "vascular endothelial growth factor binding", "id": "GO:0038085", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0038085", "evidence": [ { "database": "UniProtKB", "id": "B0L3A2", "url": "https://www.uniprot.org/uniprot/B0L3A2" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 2, "go_terms": [ { "name": "endothelin receptor signaling pathway", "id": "GO:0086100", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0086100", "evidence": [ { "database": "UniProtKB", "id": "B0L3A2", "url": "https://www.uniprot.org/uniprot/B0L3A2" } ], "pmid": "" }, { "name": "vascular endothelial growth factor signaling pathway", "id": "GO:0038084", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0038084", "evidence": [ { "database": "UniProtKB", "id": "B0L3A2", "url": "https://www.uniprot.org/uniprot/B0L3A2" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "B0L3A2", "url": "https://www.uniprot.org/uniprot/B0L3A2" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 41, "end_pos": 43, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "N-glycosylated.", "evidence": [ { "database": "UniProtKB", "id": "B0L3A2", "url": "https://www.uniprot.org/uniprot/B0L3A2" }, { "database": "PubMed", "id": "27301377", "url": "https://glygen.org/publication/PubMed/27301377" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 41, "end_pos": 43 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }