{ "uniprot_canonical_ac": "B0G180-1", "uniprot_ac": "B0G180", "uniprot_id": "SPCS3_DICDI", "mass": { "chemical_mass": 19672.0, "monoisotopic_mass": 19672.0 }, "refseq": { "ac": "XP_001733043", "name": "microsomal signal peptidase subunit", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_001733043" }, "gene_names": [ { "name": "spcs3", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/B0G180", "id": "B0G180" }, { "name": "DDB_G0290851", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/B0G180", "id": "B0G180" }, { "name": "spc3", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_001733043", "id": "XP_001733043" }, { "name": "spc3", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/B0G180", "id": "B0G180" } ], "protein_names": [ { "name": "Signal peptidase complex subunit 3", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "B0G180" }, { "name": "microsomal signal peptidase subunit", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_001733043", "id": "XP_001733043" }, { "name": "signal peptidase complex subunit 3", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_001733043", "id": "XP_001733043" } ], "function": [ { "annotation": "Essential component of the signal peptidase complex (SPC) which catalyzes the cleavage of N-terminal signal sequences from nascent proteins as they are translocated into the lumen of the endoplasmic reticulum (By similarity). Essential for the SPC catalytic activity, possibly by stabilizing and positioning the active center of the complex close to the lumenal surface (By similarity).", "evidence": [ { "database": "UniProtKB", "id": "B0G180", "url": "https://www.uniprot.org/uniprot/B0G180#function" }, { "database": "UniProtKB", "id": "P61009", "url": "https://www.uniprot.org/uniprot/P61009#function" }, { "database": "UniProtKB", "id": "Q12133", "url": "https://www.uniprot.org/uniprot/Q12133#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Dictyostelium discoideum", "taxid": 44689, "evidence": [ { "database": "UniProtKB", "id": "B0G180", "url": "https://www.uniprot.org/uniprot/B0G180" } ], "common_name": "Cellular slime molds" } ], "gene": [ { "name": "spcs3", "url": "https://www.uniprot.org/uniprot/B0G180", "locus": {} } ], "crossref": [ { "id": "DDB_G0290851", "url": "http://dictybase.org/gene/DDB_G0290851", "database": "dictyBase", "categories": [ "Organism-specific" ] }, { "id": "8627862", "url": "https://www.ncbi.nlm.nih.gov/gene/8627862", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR007653", "url": "https://www.ebi.ac.uk/interpro/entry/IPR007653", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "ddi:DDB_G0290851", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+ddi:DDB_G0290851", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "TFGCFVT", "url": "https://omabrowser.org/oma/group/TFGCFVT/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "PTHR12804", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12804", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR12804:SF0", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12804:SF0", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF04573", "url": "http://pfam.xfam.org/family/PF04573", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_B0G180", "url": "http://purl.obolibrary.org/obo/PR_B0G180", "database": "PRO", "categories": [ "Protein" ] }, { "id": "XP_001733043", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_001733043", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "B0G180", "url": "https://www.uniprot.org/uniprot/B0G180", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "B0G180-1", "url": "https://www.uniprot.org/uniprot/B0G180-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MHSLSQRANTIVCFGGIVLVGVLLLNVLSRAFFSDHVDVDIKLNEIHRFNTQRNFEYSFISIDLDANLEPLFNWNTKMLFLYVTAEYRTKQNVLSQVVVWDHILTEKSKANIHEKRLSKYPIINQGLGLKNNTIKLTFNYNVVPISGILTRHQVGTSEFKFPTTYMKEAY", "length": 170, "header": "sp|B0G180-1|SPCS3_DICDI Isoform 1 of Signal peptidase complex subunit 3 OS=Dictyostelium discoideum OX=44689 GN=spcs3 PE=3 SV=1 CANONICAL=B0G180-1" }, "isoforms": [ { "isoform_ac": "B0G180-1", "url": "", "sequence": { "sequence": "MHSLSQRANTIVCFGGIVLVGVLLLNVLSRAFFSDHVDVDIKLNEIHRFNTQRNFEYSFISIDLDANLEPLFNWNTKMLFLYVTAEYRTKQNVLSQVVVWDHILTEKSKANIHEKRLSKYPIINQGLGLKNNTIKLTFNYNVVPISGILTRHQVGTSEFKFPTTYMKEAY", "length": 170, "header": "sp|B0G180-1|SPCS3_DICDI Isoform 1 of Signal peptidase complex subunit 3 OS=Dictyostelium discoideum OX=44689 GN=spcs3 PE=3 SV=1 CANONICAL=B0G180-1" }, "locus": {} } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 131, "start_aa": "Asn", "end_pos": 131, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn131", "evidence": [ { "id": "B0G180", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B0G180#ptm_processing" } ] } ], "phosphorylation": [], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_predicted" ], "publication": [ { "title": "The genome of the social amoeba Dictyostelium discoideum.", "journal": "Nature", "date": "2005", "authors": "Eichinger L, Pachebat J A, Gl\u00f6ckner G, Rajandream M-A, Sucgang R, Berriman M, Song J, Olsen R, Szafranski K, Xu Q, Tunggal B, Kummerfeld S, Madera M, Konfortov B A, Rivero F, Bankier A T, Lehmann R, Hamlin N, Davies R, Gaudet P, Fey P, Pilcher K, Chen G, Saunders D, Sodergren E, Davis P, Kerhornou A, Nie X, Hall N, Anjard C, Hemphill L, Bason N, Farbrother P, Desany B, Just E, Morio T, Rost R, Churcher C, Cooper J, Haydock S, van Driessche N, Cronin A, Goodhead I, Muzny D, Mourier T, Pain A, Lu M, Harper D, Lindsay R, Hauser H, James K, Quiles M, Madan Babu M, Saito T, Buchrieser C, Wardroper A, Felder M, Thangavelu M, Johnson D, Knights A, Loulseged H, Mungall K, Oliver K, Price C, Quail M A, Urushihara H, Hernandez J, Rabbinowitsch E, Steffen D, Sanders M, Ma J, Kohara Y, Sharp S, Simmonds M, Spiegler S, Tivey A, Sugano S, White B, Walker D, Woodward J, Winckler T, Tanaka Y, Shaulsky G, Schleicher M, Weinstock G, Rosenthal A, Cox E C, Chisholm R L, Gibbs R, Loomis W F, Platzer M, Kay R R, Williams J, Dear P H, Noegel A A, Barrell B, Kuspa A", "evidence": [ { "database": "UniProtKB", "id": "B0G180", "url": "https://www.uniprot.org/uniprot/B0G180" } ], "reference": [ { "type": "PubMed", "id": "15875012", "url": "https://glygen.org/publication/PubMed/15875012" } ] } ], "pathway": [ { "id": "ddi:DDB_G0290851", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+ddi:DDB_G0290851", "resource": "KEGG Pathway" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 2, "go_terms": [ { "name": "protein targeting to ER", "id": "GO:0045047", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045047", "evidence": [ { "database": "UniProtKB", "id": "B0G180", "url": "https://www.uniprot.org/uniprot/B0G180" } ], "pmid": "" }, { "name": "signal peptide processing", "id": "GO:0006465", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006465", "evidence": [ { "database": "UniProtKB", "id": "B0G180", "url": "https://www.uniprot.org/uniprot/B0G180" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "signal peptidase complex", "id": "GO:0005787", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005787", "evidence": [ { "database": "UniProtKB", "id": "B0G180", "url": "https://www.uniprot.org/uniprot/B0G180" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 131, "end_pos": 133, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [ 131 ], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 131, "end_pos": 133 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 1 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 1 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }