{ "uniprot_canonical_ac": "B0G133-1", "uniprot_ac": "B0G133", "uniprot_id": "B0G133_DICDI", "mass": { "chemical_mass": 16951.0, "monoisotopic_mass": 16951.0 }, "refseq": { "ac": "XP_001732996", "name": "AhpC/TSA family protein", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_001732996" }, "gene_names": [ { "name": "DDB_G0279949", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/B0G133", "id": "B0G133" } ], "protein_names": [ { "name": "thioredoxin-dependent peroxiredoxin", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "B0G133" }, { "name": "1.11.1.24", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "B0G133" }, { "name": "AhpC/TSA family protein", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_001732996", "id": "XP_001732996" }, { "name": "Thioredoxin peroxidase", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "B0G133" }, { "name": "Thioredoxin-dependent peroxiredoxin Q", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "B0G133" } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Dictyostelium discoideum", "taxid": 44689, "evidence": [ { "database": "UniProtKB", "id": "B0G133", "url": "https://www.uniprot.org/uniprot/B0G133" } ], "common_name": "Cellular slime molds" } ], "gene": [ { "name": "", "url": "https://www.uniprot.org/uniprot/B0G133", "locus": {} } ], "crossref": [ { "id": "cd03017", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd03017", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "DDB_G0279949", "url": "http://dictybase.org/gene/DDB_G0279949", "database": "dictyBase", "categories": [ "Organism-specific" ] }, { "id": "8622302", "url": "https://www.ncbi.nlm.nih.gov/gene/8622302", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR000866", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000866", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013766", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013766", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR024706", "url": "https://www.ebi.ac.uk/interpro/entry/IPR024706", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036249", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036249", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "ddi:DDB_G0279949", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+ddi:DDB_G0279949", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "REYNAVY", "url": "https://omabrowser.org/oma/group/REYNAVY/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "PTHR42801", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR42801", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR42801:SF4", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR42801:SF4", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00578", "url": "http://pfam.xfam.org/family/PF00578", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "XP_001732996", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_001732996", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "62620", "url": "https://www.rhea-db.org/rhea/62620", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "B0G133", "url": "https://www.uniprot.org/uniprot/B0G133", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "B0G133-1", "url": "https://www.uniprot.org/uniprot/B0G133-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MGIMKIGEIAPEFTLPNKDGKLFNLKDFAGKPLVIFFYPNNIGWVCTREVCYFRDSYEKFIEMGAEVPGNSPNTMDNHKKFHAAHRVNYTILSDKNGAIGKLYGVNGLLPGRVTFVIDKNGKIALNHHTSWLSHSSHIENSLSVIELLNSQ", "length": 151, "header": "tr|B0G133-1|B0G133_DICDI Isoform 1 of thioredoxin-dependent peroxiredoxin OS=Dictyostelium discoideum OX=44689 GN= PE=3 SV=1 CANONICAL=B0G133-1" }, "isoforms": [ { "isoform_ac": "B0G133-1", "url": "", "sequence": { "sequence": "MGIMKIGEIAPEFTLPNKDGKLFNLKDFAGKPLVIFFYPNNIGWVCTREVCYFRDSYEKFIEMGAEVPGNSPNTMDNHKKFHAAHRVNYTILSDKNGAIGKLYGVNGLLPGRVTFVIDKNGKIALNHHTSWLSHSSHIENSLSVIELLNSQ", "length": 151, "header": "tr|B0G133-1|B0G133_DICDI Isoform 1 of thioredoxin-dependent peroxiredoxin OS=Dictyostelium discoideum OX=44689 GN= PE=3 SV=1 CANONICAL=B0G133-1" }, "locus": {} } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme" ], "publication": [ { "title": "The genome of the social amoeba Dictyostelium discoideum.", "journal": "Nature", "date": "2005", "authors": "Eichinger L, Pachebat J A, Gl\u00f6ckner G, Rajandream M-A, Sucgang R, Berriman M, Song J, Olsen R, Szafranski K, Xu Q, Tunggal B, Kummerfeld S, Madera M, Konfortov B A, Rivero F, Bankier A T, Lehmann R, Hamlin N, Davies R, Gaudet P, Fey P, Pilcher K, Chen G, Saunders D, Sodergren E, Davis P, Kerhornou A, Nie X, Hall N, Anjard C, Hemphill L, Bason N, Farbrother P, Desany B, Just E, Morio T, Rost R, Churcher C, Cooper J, Haydock S, van Driessche N, Cronin A, Goodhead I, Muzny D, Mourier T, Pain A, Lu M, Harper D, Lindsay R, Hauser H, James K, Quiles M, Madan Babu M, Saito T, Buchrieser C, Wardroper A, Felder M, Thangavelu M, Johnson D, Knights A, Loulseged H, Mungall K, Oliver K, Price C, Quail M A, Urushihara H, Hernandez J, Rabbinowitsch E, Steffen D, Sanders M, Ma J, Kohara Y, Sharp S, Simmonds M, Spiegler S, Tivey A, Sugano S, White B, Walker D, Woodward J, Winckler T, Tanaka Y, Shaulsky G, Schleicher M, Weinstock G, Rosenthal A, Cox E C, Chisholm R L, Gibbs R, Loomis W F, Platzer M, Kay R R, Williams J, Dear P H, Noegel A A, Barrell B, Kuspa A", "evidence": [ { "database": "UniProtKB", "id": "B0G133", "url": "https://www.uniprot.org/uniprot/B0G133" } ], "reference": [ { "type": "PubMed", "id": "15875012", "url": "https://glygen.org/publication/PubMed/15875012" } ] } ], "pathway": [ { "id": "ddi:DDB_G0279949", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+ddi:DDB_G0279949", "resource": "KEGG Pathway" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "B0G133", "url": "https://www.uniprot.org/uniprot/B0G133" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 2, "go_terms": [ { "name": "cellular response to oxidative stress", "id": "GO:0034599", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034599", "evidence": [ { "database": "UniProtKB", "id": "B0G133", "url": "https://www.uniprot.org/uniprot/B0G133" } ], "pmid": "" }, { "name": "cell redox homeostasis", "id": "GO:0045454", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045454", "evidence": [ { "database": "UniProtKB", "id": "B0G133", "url": "https://www.uniprot.org/uniprot/B0G133" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "thioredoxin peroxidase activity", "id": "GO:0008379", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008379", "evidence": [ { "database": "UniProtKB", "id": "B0G133", "url": "https://www.uniprot.org/uniprot/B0G133" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 88, "end_pos": 90, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "62620", "name": "", "equation": "[thioredoxin]-dithiol + a hydroperoxide = [thioredoxin]-disulfide + an alcohol + H2O", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q63716-1", "Q9R063-1", "Q9Z0V5-1", "Q9Z0V6-1", "P35704-1", "A0A0G2K3Z9-1", "A0A8I6AAF3-1", "A0A8I6ALP6-1", "A0A8I5Y2B8-1", "Q06830-1", "Q13162-1", "P30048-1", "P30044-1", "P32119-1", "P20108-1", "Q61171-1", "O08807-1", "P35700-1", "P99029-1", "P40553-1", "P40581-1", "P34760-1", "P36014-1", "P38013-1", "P38143-1", "Q04120-1", "Q54SE2-1", "B0G133-1", "Q54NG4-1", "Q54W09-1", "Q54W30-1", "Q552Z0-1", "Q559T9-1", "Q55E48-1", "Q55EE4-1", "Q55EF1-1", "Q55FA7-1", "Q555L5-1", "Q9V3P0-1", "Q960M4-1", "Q9VEJ0-1", "Q9V3Q4-1", "Q9VUM4-1" ], "evidence": [ { "id": "62620", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/62620" } ] } ], "reaction_participants": [], "reaction_enzymes": [ { "uniprot_ac": "A0A0G2K3Z9", "gene_name": "Prdx1l1", "activity": [ { "ec_number": "1.11.1.24", "activity": "[thioredoxin]-dithiol + a hydroperoxide = [thioredoxin]-disulfide + an alcohol + H2O.", "evidence": [ { "id": "A0A0G2K3Z9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2K3Z9" } ] }, { "ec_number": "1.11.1.24", "activity": "", "evidence": [ { "id": "A0A0G2K3Z9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2K3Z9" } ] } ] }, { "uniprot_ac": "A0A8I5Y2B8", "gene_name": "ENSRNOG00000062500", "activity": [ { "ec_number": "1.11.1.24", "activity": "[thioredoxin]-dithiol + a hydroperoxide = [thioredoxin]-disulfide + an alcohol + H2O.", "evidence": [ { "id": "A0A8I5Y2B8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I5Y2B8" } ] }, { "ec_number": "1.11.1.24", "activity": "", "evidence": [ { "id": "A0A8I5Y2B8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I5Y2B8" } ] } ] }, { "uniprot_ac": "A0A8I6AAF3", "gene_name": "ENSRNOG00000063007", "activity": [ { "ec_number": "1.11.1.24", "activity": "[thioredoxin]-dithiol + a hydroperoxide = [thioredoxin]-disulfide + an alcohol + H2O.", "evidence": [ { "id": "A0A8I6AAF3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I6AAF3" } ] }, { "ec_number": "1.11.1.24", "activity": "", "evidence": [ { "id": "A0A8I6AAF3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I6AAF3" } ] } ] }, { "uniprot_ac": "A0A8I6ALP6", "gene_name": "ENSRNOG00000066051", "activity": [ { "ec_number": "1.11.1.24", "activity": "[thioredoxin]-dithiol + a hydroperoxide = [thioredoxin]-disulfide + an alcohol + H2O.", "evidence": [ { "id": "A0A8I6ALP6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I6ALP6" } ] }, { "ec_number": "1.11.1.24", "activity": "", "evidence": [ { "id": "A0A8I6ALP6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I6ALP6" } ] } ] }, { "uniprot_ac": "B0G133", "gene_name": "", "activity": [ { "ec_number": "1.11.1.24", "activity": "[thioredoxin]-dithiol + a hydroperoxide = [thioredoxin]-disulfide + an alcohol + H2O.", "evidence": [ { "id": "B0G133", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B0G133" } ] }, { "ec_number": "1.11.1.24", "activity": "", "evidence": [ { "id": "B0G133", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B0G133" } ] } ] }, { "uniprot_ac": "O08807", "gene_name": "Prdx4", "activity": [ { "ec_number": "1.11.1.24", "activity": "[thioredoxin]-dithiol + a hydroperoxide = [thioredoxin]-disulfide + an alcohol + H2O.", "evidence": [ { "id": "O08807", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O08807" } ] }, { "ec_number": "1.11.1.24", "activity": "", "evidence": [ { "id": "O08807", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O08807" } ] } ] }, { "uniprot_ac": "P20108", "gene_name": "Prdx3", "activity": [ { "ec_number": "1.11.1.24", "activity": "[thioredoxin]-dithiol + a hydroperoxide = [thioredoxin]-disulfide + an alcohol + H2O.", "evidence": [ { "id": "P20108", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P20108" } ] }, { "ec_number": "1.11.1.24", "activity": "", "evidence": [ { "id": "P20108", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P20108" } ] } ] }, { "uniprot_ac": "P30044", "gene_name": "PRDX5", "activity": [ { "ec_number": "1.11.1.24", "activity": "[thioredoxin]-dithiol + a hydroperoxide = [thioredoxin]-disulfide + an alcohol + H2O.", "evidence": [ { "id": "P30044", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P30044" } ] }, { "ec_number": "1.11.1.24", "activity": "", "evidence": [ { "id": "P30044", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P30044" } ] } ] }, { "uniprot_ac": "P30048", "gene_name": "PRDX3", "activity": [ { "ec_number": "1.11.1.24", "activity": "[thioredoxin]-dithiol + a hydroperoxide = [thioredoxin]-disulfide + an alcohol + H2O.", "evidence": [ { "id": "P30048", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P30048" } ] }, { "ec_number": "1.11.1.24", "activity": "", "evidence": [ { "id": "P30048", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P30048" } ] } ] }, { "uniprot_ac": "P32119", "gene_name": "PRDX2", "activity": [ { "ec_number": "1.11.1.24", "activity": "[thioredoxin]-dithiol + a hydroperoxide = [thioredoxin]-disulfide + an alcohol + H2O.", "evidence": [ { "id": "P32119", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P32119" } ] }, { "ec_number": "1.11.1.24", "activity": "", "evidence": [ { "id": "P32119", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P32119" } ] } ] }, { "uniprot_ac": "P34760", "gene_name": "TSA1", "activity": [ { "ec_number": "1.11.1.24", "activity": "[thioredoxin]-dithiol + a hydroperoxide = [thioredoxin]-disulfide + an alcohol + H2O.", "evidence": [ { "id": "P34760", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P34760" } ] }, { "ec_number": "1.11.1.24", "activity": "", "evidence": [ { "id": "P34760", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P34760" } ] } ] }, { "uniprot_ac": "P35700", "gene_name": "Prdx1", "activity": [ { "ec_number": "1.11.1.24", "activity": "[thioredoxin]-dithiol + a hydroperoxide = [thioredoxin]-disulfide + an alcohol + H2O.", "evidence": [ { "id": "P35700", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P35700" } ] }, { "ec_number": "1.11.1.24", "activity": "", "evidence": [ { "id": "P35700", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P35700" } ] } ] }, { "uniprot_ac": "P35704", "gene_name": "Prdx2", "activity": [ { "ec_number": "1.11.1.24", "activity": "[thioredoxin]-dithiol + a hydroperoxide = [thioredoxin]-disulfide + an alcohol + H2O.", "evidence": [ { "id": "P35704", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P35704" } ] }, { "ec_number": "1.11.1.24", "activity": "", "evidence": [ { "id": "P35704", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P35704" } ] } ] }, { "uniprot_ac": "P36014", "gene_name": "GPX1", "activity": [ { "ec_number": "1.11.1.9", "activity": "2 glutathione + H2O2 = glutathione disulfide + 2 H2O.", "evidence": [ { "id": "P36014", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P36014" } ] }, { "ec_number": "1.11.1.24", "activity": "[thioredoxin]-dithiol + a hydroperoxide = [thioredoxin]-disulfide + an alcohol + H2O.", "evidence": [ { "id": "P36014", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P36014" } ] }, { "ec_number": "1.11.1.24", "activity": "", "evidence": [ { "id": "P36014", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P36014" } ] }, { "ec_number": "1.11.1.9", "activity": "", "evidence": [ { "id": "P36014", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P36014" } ] } ] }, { "uniprot_ac": "P38013", "gene_name": "AHP1", "activity": [ { "ec_number": "1.11.1.24", "activity": "[thioredoxin]-dithiol + a hydroperoxide = [thioredoxin]-disulfide + an alcohol + H2O.", "evidence": [ { "id": "P38013", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P38013" } ] }, { "ec_number": "1.11.1.24", "activity": "", "evidence": [ { "id": "P38013", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P38013" } ] } ] }, { "uniprot_ac": "P38143", "gene_name": "GPX2", "activity": [ { "ec_number": "1.11.1.24", "activity": "[thioredoxin]-dithiol + a hydroperoxide = [thioredoxin]-disulfide + an alcohol + H2O.", "evidence": [ { "id": "P38143", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P38143" } ] }, { "ec_number": "1.11.1.24", "activity": "", "evidence": [ { "id": "P38143", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P38143" } ] } ] }, { "uniprot_ac": "P40553", "gene_name": "DOT5", "activity": [ { "ec_number": "1.11.1.24", "activity": "[thioredoxin]-dithiol + a hydroperoxide = [thioredoxin]-disulfide + an alcohol + H2O.", "evidence": [ { "id": "P40553", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P40553" } ] }, { "ec_number": "1.11.1.24", "activity": "", "evidence": [ { "id": "P40553", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P40553" } ] } ] }, { "uniprot_ac": "P40581", "gene_name": "HYR1", "activity": [ { "ec_number": "1.11.1.24", "activity": "[thioredoxin]-dithiol + a hydroperoxide = [thioredoxin]-disulfide + an alcohol + H2O.", "evidence": [ { "id": "P40581", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P40581" } ] }, { "ec_number": "1.11.1.24", "activity": "", "evidence": [ { "id": "P40581", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P40581" } ] } ] }, { "uniprot_ac": "P99029", "gene_name": "Prdx5", "activity": [ { "ec_number": "1.11.1.24", "activity": "[thioredoxin]-dithiol + a hydroperoxide = [thioredoxin]-disulfide + an alcohol + H2O.", "evidence": [ { "id": "P99029", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P99029" } ] }, { "ec_number": "1.11.1.24", "activity": "", "evidence": [ { "id": "P99029", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P99029" } ] } ] }, { "uniprot_ac": "Q04120", "gene_name": "TSA2", "activity": [ { "ec_number": "1.11.1.24", "activity": "[thioredoxin]-dithiol + a hydroperoxide = [thioredoxin]-disulfide + an alcohol + H2O.", "evidence": [ { "id": "Q04120", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q04120" } ] }, { "ec_number": "1.11.1.24", "activity": "", "evidence": [ { "id": "Q04120", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q04120" } ] } ] }, { "uniprot_ac": "Q06830", "gene_name": "PRDX1", "activity": [ { "ec_number": "1.11.1.24", "activity": "[thioredoxin]-dithiol + a hydroperoxide = [thioredoxin]-disulfide + an alcohol + H2O.", "evidence": [ { "id": "Q06830", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q06830" } ] }, { "ec_number": "1.11.1.24", "activity": "", "evidence": [ { "id": "Q06830", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q06830" } ] } ] }, { "uniprot_ac": "Q13162", "gene_name": "PRDX4", "activity": [ { "ec_number": "1.11.1.24", "activity": "[thioredoxin]-dithiol + a hydroperoxide = [thioredoxin]-disulfide + an alcohol + H2O.", "evidence": [ { "id": "Q13162", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q13162" } ] }, { "ec_number": "1.11.1.24", "activity": "", "evidence": [ { "id": "Q13162", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q13162" } ] } ] }, { "uniprot_ac": "Q54NG4", "gene_name": "", "activity": [ { "ec_number": "1.11.1.24", "activity": "[thioredoxin]-dithiol + a hydroperoxide = [thioredoxin]-disulfide + an alcohol + H2O.", "evidence": [ { "id": "Q54NG4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54NG4" } ] }, { "ec_number": "1.11.1.24", "activity": "", "evidence": [ { "id": "Q54NG4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54NG4" } ] } ] }, { "uniprot_ac": "Q54SE2", "gene_name": "", "activity": [ { "ec_number": "1.11.1.24", "activity": "[thioredoxin]-dithiol + a hydroperoxide = [thioredoxin]-disulfide + an alcohol + H2O.", "evidence": [ { "id": "Q54SE2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54SE2" } ] }, { "ec_number": "1.11.1.24", "activity": "", "evidence": [ { "id": "Q54SE2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54SE2" } ] } ] }, { "uniprot_ac": "Q54W09", "gene_name": "", "activity": [ { "ec_number": "1.11.1.24", "activity": "[thioredoxin]-dithiol + a hydroperoxide = [thioredoxin]-disulfide + an alcohol + H2O.", "evidence": [ { "id": "Q54W09", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54W09" } ] }, { "ec_number": "1.11.1.24", "activity": "", "evidence": [ { "id": "Q54W09", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54W09" } ] } ] }, { "uniprot_ac": "Q54W30", "gene_name": "", "activity": [ { "ec_number": "1.11.1.24", "activity": "[thioredoxin]-dithiol + a hydroperoxide = [thioredoxin]-disulfide + an alcohol + H2O.", "evidence": [ { "id": "Q54W30", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54W30" } ] }, { "ec_number": "1.11.1.24", "activity": "", "evidence": [ { "id": "Q54W30", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54W30" } ] } ] }, { "uniprot_ac": "Q552Z0", "gene_name": "", "activity": [ { "ec_number": "1.11.1.24", "activity": "[thioredoxin]-dithiol + a hydroperoxide = [thioredoxin]-disulfide + an alcohol + H2O.", "evidence": [ { "id": "Q552Z0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q552Z0" } ] }, { "ec_number": "1.11.1.24", "activity": "", "evidence": [ { "id": "Q552Z0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q552Z0" } ] } ] }, { "uniprot_ac": "Q555L5", "gene_name": "prdx4", "activity": [ { "ec_number": "1.11.1.24", "activity": "[thioredoxin]-dithiol + a hydroperoxide = [thioredoxin]-disulfide + an alcohol + H2O.", "evidence": [ { "id": "Q555L5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q555L5" } ] }, { "ec_number": "1.11.1.24", "activity": "", "evidence": [ { "id": "Q555L5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q555L5" } ] } ] }, { "uniprot_ac": "Q559T9", "gene_name": "", "activity": [ { "ec_number": "1.11.1.24", "activity": "[thioredoxin]-dithiol + a hydroperoxide = [thioredoxin]-disulfide + an alcohol + H2O.", "evidence": [ { "id": "Q559T9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q559T9" } ] }, { "ec_number": "1.11.1.24", "activity": "", "evidence": [ { "id": "Q559T9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q559T9" } ] } ] }, { "uniprot_ac": "Q55E48", "gene_name": "", "activity": [ { "ec_number": "1.11.1.24", "activity": "[thioredoxin]-dithiol + a hydroperoxide = [thioredoxin]-disulfide + an alcohol + H2O.", "evidence": [ { "id": "Q55E48", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55E48" } ] }, { "ec_number": "1.11.1.24", "activity": "", "evidence": [ { "id": "Q55E48", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55E48" } ] } ] }, { "uniprot_ac": "Q55EE4", "gene_name": "", "activity": [ { "ec_number": "1.11.1.24", "activity": "[thioredoxin]-dithiol + a hydroperoxide = [thioredoxin]-disulfide + an alcohol + H2O.", "evidence": [ { "id": "Q55EE4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55EE4" } ] }, { "ec_number": "1.11.1.24", "activity": "", "evidence": [ { "id": "Q55EE4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55EE4" } ] } ] }, { "uniprot_ac": "Q55EF1", "gene_name": "", "activity": [ { "ec_number": "1.11.1.24", "activity": "[thioredoxin]-dithiol + a hydroperoxide = [thioredoxin]-disulfide + an alcohol + H2O.", "evidence": [ { "id": "Q55EF1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55EF1" } ] }, { "ec_number": "1.11.1.24", "activity": "", "evidence": [ { "id": "Q55EF1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55EF1" } ] } ] }, { "uniprot_ac": "Q55FA7", "gene_name": "", "activity": [ { "ec_number": "1.11.1.24", "activity": "[thioredoxin]-dithiol + a hydroperoxide = [thioredoxin]-disulfide + an alcohol + H2O.", "evidence": [ { "id": "Q55FA7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55FA7" } ] }, { "ec_number": "1.11.1.24", "activity": "", "evidence": [ { "id": "Q55FA7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55FA7" } ] } ] }, { "uniprot_ac": "Q61171", "gene_name": "Prdx2", "activity": [ { "ec_number": "1.11.1.24", "activity": "[thioredoxin]-dithiol + a hydroperoxide = [thioredoxin]-disulfide + an alcohol + H2O.", "evidence": [ { "id": "Q61171", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q61171" } ] }, { "ec_number": "1.11.1.24", "activity": "", "evidence": [ { "id": "Q61171", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q61171" } ] } ] }, { "uniprot_ac": "Q63716", "gene_name": "Prdx1", "activity": [ { "ec_number": "1.11.1.24", "activity": "[thioredoxin]-dithiol + a hydroperoxide = [thioredoxin]-disulfide + an alcohol + H2O.", "evidence": [ { "id": "Q63716", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q63716" } ] }, { "ec_number": "1.11.1.24", "activity": "", "evidence": [ { "id": "Q63716", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q63716" } ] } ] }, { "uniprot_ac": "Q960M4", "gene_name": "Prx5", "activity": [ { "ec_number": "1.11.1.24", "activity": "[thioredoxin]-dithiol + a hydroperoxide = [thioredoxin]-disulfide + an alcohol + H2O.", "evidence": [ { "id": "Q960M4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q960M4" } ] }, { "ec_number": "1.11.1.24", "activity": "", "evidence": [ { "id": "Q960M4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q960M4" } ] } ] }, { "uniprot_ac": "Q9R063", "gene_name": "Prdx5", "activity": [ { "ec_number": "1.11.1.24", "activity": "[thioredoxin]-dithiol + a hydroperoxide = [thioredoxin]-disulfide + an alcohol + H2O.", "evidence": [ { "id": "Q9R063", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9R063" } ] }, { "ec_number": "1.11.1.24", "activity": "", "evidence": [ { "id": "Q9R063", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9R063" } ] } ] }, { "uniprot_ac": "Q9V3P0", "gene_name": "Prx2", "activity": [ { "ec_number": "1.11.1.24", "activity": "[thioredoxin]-dithiol + a hydroperoxide = [thioredoxin]-disulfide + an alcohol + H2O.", "evidence": [ { "id": "Q9V3P0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9V3P0" } ] }, { "ec_number": "1.11.1.24", "activity": "", "evidence": [ { "id": "Q9V3P0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9V3P0" } ] } ] }, { "uniprot_ac": "Q9V3Q4", "gene_name": "Prx4", "activity": [ { "ec_number": "1.11.1.24", "activity": "[thioredoxin]-dithiol + a hydroperoxide = [thioredoxin]-disulfide + an alcohol + H2O.", "evidence": [ { "id": "Q9V3Q4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9V3Q4" } ] }, { "ec_number": "1.11.1.24", "activity": "", "evidence": [ { "id": "Q9V3Q4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9V3Q4" } ] } ] }, { "uniprot_ac": "Q9VEJ0", "gene_name": "Prx3", "activity": [ { "ec_number": "1.11.1.24", "activity": "[thioredoxin]-dithiol + a hydroperoxide = [thioredoxin]-disulfide + an alcohol + H2O.", "evidence": [ { "id": "Q9VEJ0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VEJ0" } ] }, { "ec_number": "1.11.1.24", "activity": "", "evidence": [ { "id": "Q9VEJ0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VEJ0" } ] } ] }, { "uniprot_ac": "Q9VUM4", "gene_name": "Prx1", "activity": [ { "ec_number": "1.11.1.24", "activity": "[thioredoxin]-dithiol + a hydroperoxide = [thioredoxin]-disulfide + an alcohol + H2O.", "evidence": [ { "id": "Q9VUM4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VUM4" } ] }, { "ec_number": "1.11.1.24", "activity": "", "evidence": [ { "id": "Q9VUM4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VUM4" } ] } ] }, { "uniprot_ac": "Q9Z0V5", "gene_name": "Prdx4", "activity": [ { "ec_number": "1.11.1.24", "activity": "[thioredoxin]-dithiol + a hydroperoxide = [thioredoxin]-disulfide + an alcohol + H2O.", "evidence": [ { "id": "Q9Z0V5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z0V5" } ] }, { "ec_number": "1.11.1.24", "activity": "", "evidence": [ { "id": "Q9Z0V5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z0V5" } ] } ] }, { "uniprot_ac": "Q9Z0V6", "gene_name": "Prdx3", "activity": [ { "ec_number": "1.11.1.24", "activity": "[thioredoxin]-dithiol + a hydroperoxide = [thioredoxin]-disulfide + an alcohol + H2O.", "evidence": [ { "id": "Q9Z0V6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z0V6" } ] }, { "ec_number": "1.11.1.24", "activity": "", "evidence": [ { "id": "Q9Z0V6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z0V6" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 88, "end_pos": 90 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }