{
    "uniprot_canonical_ac": "B0G102-1",
    "uniprot_ac": "B0G102",
    "uniprot_id": "CKS1_DICDI",
    "mass": {
        "chemical_mass": 9707.0,
        "monoisotopic_mass": 9707.0
    },
    "refseq": {
        "ac": "XP_001732965",
        "name": "cyclin-dependent kinases regulatory subunit",
        "summary": "",
        "url": "https://www.ncbi.nlm.nih.gov/protein/XP_001732965"
    },
    "gene_names": [
        {
            "name": "cks1",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "https://www.uniprot.org/uniprot/B0G102",
            "id": "B0G102"
        },
        {
            "name": "DDB_G0271642",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "https://www.uniprot.org/uniprot/B0G102",
            "id": "B0G102"
        },
        {
            "name": "cks1",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/XP_001732965",
            "id": "XP_001732965"
        }
    ],
    "protein_names": [
        {
            "name": "Cyclin-dependent kinases regulatory subunit",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "",
            "id": "B0G102"
        },
        {
            "name": "cyclin-dependent kinases regulatory subunit",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/XP_001732965",
            "id": "XP_001732965"
        }
    ],
    "function": [
        {
            "annotation": "Binds to the catalytic subunit of the cyclin dependent kinases and is essential for their biological function.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "B0G102",
                    "url": "https://www.uniprot.org/uniprot/B0G102#function"
                }
            ]
        }
    ],
    "disease": [],
    "snv": [],
    "mutagenesis": [],
    "expression_tissue": [],
    "expression_disease": [],
    "species": [
        {
            "name": "Dictyostelium discoideum",
            "taxid": 44689,
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "B0G102",
                    "url": "https://www.uniprot.org/uniprot/B0G102"
                }
            ],
            "common_name": "Cellular slime molds"
        }
    ],
    "gene": [
        {
            "name": "cks1",
            "url": "https://www.uniprot.org/uniprot/B0G102",
            "locus": {}
        }
    ],
    "crossref": [
        {
            "id": "DDB_G0271642",
            "url": "http://dictybase.org/gene/DDB_G0271642",
            "database": "dictyBase",
            "categories": [
                "Organism-specific"
            ]
        },
        {
            "id": "8618042",
            "url": "https://www.ncbi.nlm.nih.gov/gene/8618042",
            "database": "GeneID",
            "categories": [
                "Genome Annotation"
            ]
        },
        {
            "id": "IPR000789",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR000789",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR036858",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR036858",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "ddi:DDB_G0271642",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+ddi:DDB_G0271642",
            "database": "KEGG Pathway",
            "categories": [
                "Enzyme and Pathway"
            ]
        },
        {
            "id": "PTHR23415",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23415",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR23415:SF29",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23415:SF29",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PF01111",
            "url": "http://pfam.xfam.org/family/PF01111",
            "database": "Pfam",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PR_B0G102",
            "url": "http://purl.obolibrary.org/obo/PR_B0G102",
            "database": "PRO",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "R-DDI-69231",
            "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-69231",
            "database": "Reactome",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "XP_001732965",
            "url": "https://www.ncbi.nlm.nih.gov/protein/XP_001732965",
            "database": "RefSeq",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "B0G102",
            "url": "https://www.uniprot.org/uniprot/B0G102",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "B0G102-1",
            "url": "https://www.uniprot.org/uniprot/B0G102-1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        }
    ],
    "sequence": {
        "sequence": "MPSAPHYSSKYYDDKYEYRHVILPSEISSLIPRDVLLTEDECRKLGIRQSDGWEHYANHKPEPHILLFRRPHSGIPNDVDYL",
        "length": 82,
        "header": "sp|B0G102-1|CKS1_DICDI Isoform 1 of Cyclin-dependent kinases regulatory subunit  OS=Dictyostelium discoideum OX=44689 GN=cks1 PE=3 SV=1 CANONICAL=B0G102-1"
    },
    "isoforms": [
        {
            "isoform_ac": "B0G102-1",
            "url": "",
            "sequence": {
                "sequence": "MPSAPHYSSKYYDDKYEYRHVILPSEISSLIPRDVLLTEDECRKLGIRQSDGWEHYANHKPEPHILLFRRPHSGIPNDVDYL",
                "length": 82,
                "header": "sp|B0G102-1|CKS1_DICDI Isoform 1 of Cyclin-dependent kinases regulatory subunit  OS=Dictyostelium discoideum OX=44689 GN=cks1 PE=3 SV=1 CANONICAL=B0G102-1"
            },
            "locus": {}
        }
    ],
    "glycosylation": [],
    "phosphorylation": [],
    "glycation": [],
    "keywords": [],
    "publication": [
        {
            "title": "Sequence and analysis of chromosome 2 of Dictyostelium discoideum.",
            "journal": "Nature",
            "date": "2002",
            "authors": "Gl\u00f6ckner Gernot, Eichinger Ludwig, Szafranski Karol, Pachebat Justin A, Bankier Alan T, Dear Paul H, Lehmann R\u00fcdiger, Baumgart Cornelia, Parra Gen\u00eds, Abril Josep F, Guig\u00f3 Roderic, Kumpf Kai, Tunggal Budi, Cox Edward, Quail Michael A, Platzer Matthias, Rosenthal Andr\u00e9, Noegel Angelika A,",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "B0G102",
                    "url": "https://www.uniprot.org/uniprot/B0G102"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "12097910",
                    "url": "https://glygen.org/publication/PubMed/12097910"
                }
            ]
        },
        {
            "title": "The genome of the social amoeba Dictyostelium discoideum.",
            "journal": "Nature",
            "date": "2005",
            "authors": "Eichinger L, Pachebat J A, Gl\u00f6ckner G, Rajandream M-A, Sucgang R, Berriman M, Song J, Olsen R, Szafranski K, Xu Q, Tunggal B, Kummerfeld S, Madera M, Konfortov B A, Rivero F, Bankier A T, Lehmann R, Hamlin N, Davies R, Gaudet P, Fey P, Pilcher K, Chen G, Saunders D, Sodergren E, Davis P, Kerhornou A, Nie X, Hall N, Anjard C, Hemphill L, Bason N, Farbrother P, Desany B, Just E, Morio T, Rost R, Churcher C, Cooper J, Haydock S, van Driessche N, Cronin A, Goodhead I, Muzny D, Mourier T, Pain A, Lu M, Harper D, Lindsay R, Hauser H, James K, Quiles M, Madan Babu M, Saito T, Buchrieser C, Wardroper A, Felder M, Thangavelu M, Johnson D, Knights A, Loulseged H, Mungall K, Oliver K, Price C, Quail M A, Urushihara H, Hernandez J, Rabbinowitsch E, Steffen D, Sanders M, Ma J, Kohara Y, Sharp S, Simmonds M, Spiegler S, Tivey A, Sugano S, White B, Walker D, Woodward J, Winckler T, Tanaka Y, Shaulsky G, Schleicher M, Weinstock G, Rosenthal A, Cox E C, Chisholm R L, Gibbs R, Loomis W F, Platzer M, Kay R R, Williams J, Dear P H, Noegel A A, Barrell B, Kuspa A",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "B0G102",
                    "url": "https://www.uniprot.org/uniprot/B0G102"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "15875012",
                    "url": "https://glygen.org/publication/PubMed/15875012"
                }
            ]
        }
    ],
    "pathway": [
        {
            "id": "ddi:DDB_G0271642",
            "name": "",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+ddi:DDB_G0271642",
            "resource": "KEGG Pathway"
        },
        {
            "id": "R-DDI-69231",
            "name": "Cyclin D associated events in G1",
            "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-69231",
            "resource": "Reactome",
            "description": "Cyclin D associated events in G1"
        }
    ],
    "orthologs": [],
    "go_annotation": {
        "categories": [
            {
                "name": "Molecular Function",
                "total": 4,
                "go_terms": [
                    {
                        "name": "protein kinase binding",
                        "id": "GO:0019901",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019901",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "B0G102",
                                "url": "https://www.uniprot.org/uniprot/B0G102"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "histone binding",
                        "id": "GO:0042393",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042393",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "B0G102",
                                "url": "https://www.uniprot.org/uniprot/B0G102"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "ubiquitin binding",
                        "id": "GO:0043130",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043130",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "B0G102",
                                "url": "https://www.uniprot.org/uniprot/B0G102"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "cyclin-dependent protein serine/threonine kinase activator activity",
                        "id": "GO:0061575",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0061575",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "B0G102",
                                "url": "https://www.uniprot.org/uniprot/B0G102"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            },
            {
                "name": "Biological Process",
                "total": 3,
                "go_terms": [
                    {
                        "name": "cell division",
                        "id": "GO:0051301",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051301",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "B0G102",
                                "url": "https://www.uniprot.org/uniprot/B0G102"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "regulation of mitotic cell cycle",
                        "id": "GO:0007346",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007346",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "B0G102",
                                "url": "https://www.uniprot.org/uniprot/B0G102"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "cell cycle",
                        "id": "GO:0007049",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007049",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "B0G102",
                                "url": "https://www.uniprot.org/uniprot/B0G102"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            },
            {
                "name": "Cellular Component",
                "total": 2,
                "go_terms": [
                    {
                        "name": "SCF ubiquitin ligase complex",
                        "id": "GO:0019005",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019005",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "B0G102",
                                "url": "https://www.uniprot.org/uniprot/B0G102"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "cyclin-dependent protein kinase holoenzyme complex",
                        "id": "GO:0000307",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000307",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "B0G102",
                                "url": "https://www.uniprot.org/uniprot/B0G102"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            }
        ]
    },
    "pro_annotation": [],
    "site_annotation": [],
    "ptm_annotation": [],
    "interactions": [],
    "reactions": [],
    "reaction_participants": [],
    "reaction_enzymes": [],
    "biomarkers": [],
    "synthesized_glycans": [],
    "cluster_types": [],
    "sequence_features": {
        "n_linked_sites": [],
        "o_linked_sites": [],
        "snv_sites": [],
        "glycation_sites": [],
        "phosphorylation_sites": [],
        "sequon_annotation_sites": []
    },
    "section_stats": [
        {
            "table_id": "glycosylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported_with_glycan",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_predicted",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_automatic_literature_mining",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "phosphorylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_non_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "publication",
            "table_stats": [
                {
                    "field": "total",
                    "count": 2
                }
            ],
            "sort_fields": [
                "title",
                "journal",
                "date",
                "authors"
            ]
        }
    ]
}