{ "uniprot_canonical_ac": "A9YTQ3-1", "uniprot_ac": "A9YTQ3", "uniprot_id": "AHRR_HUMAN", "mass": { "chemical_mass": 76265.0, "monoisotopic_mass": 76265.0 }, "refseq": {}, "gene_names": [ { "name": "AHRR", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A9YTQ3", "id": "A9YTQ3" }, { "name": "BHLHE77", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/A9YTQ3", "id": "A9YTQ3" }, { "name": "KIAA1234", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/A9YTQ3", "id": "A9YTQ3" }, { "name": "hCG_1985585", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/A9YTQ3", "id": "A9YTQ3" } ], "protein_names": [ { "name": "Aryl hydrocarbon receptor repressor", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "A9YTQ3" }, { "name": "AhR repressor", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "A9YTQ3" }, { "name": "AhRR", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "A9YTQ3" }, { "name": "Class E basic helix-loop-helix protein 77", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "A9YTQ3" }, { "name": "bHLHe77", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "A9YTQ3" } ], "function": [ { "annotation": "Mediates dioxin toxicity and is involved in regulation of cell growth and differentiation. Represses the transcription activity of AHR by competing with this transcription factor for heterodimer formation with the ARNT and subsequently binding to the xenobiotic response element (XRE) sequence present in the promoter regulatory region of variety of genes. Represses CYP1A1 by binding the XRE sequence and recruiting ANKRA2, HDAC4 and/or HDAC5. Autoregulates its expression by associating with its own XRE site.", "evidence": [ { "database": "UniProtKB", "id": "A9YTQ3", "url": "https://www.uniprot.org/uniprot/A9YTQ3#function" }, { "database": "PubMed", "id": "17890447", "url": "https://glygen.org/publication/PubMed/17890447" }, { "database": "PubMed", "id": "18172554", "url": "https://glygen.org/publication/PubMed/18172554" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "52.98", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000063438", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000063438" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "54.9", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000063438", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000063438" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "60.09", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000063438", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000063438" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "65.66", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000063438", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000063438" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "68.15", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000063438", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000063438" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "74.3", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000063438", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000063438" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "63.33", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000063438", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000063438" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "53.81", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000063438", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000063438" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "59.97", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000063438", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000063438" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "60.87", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000063438", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000063438" } ] } ], "expression_disease": [ { "significant": "Yes", "trend": "up", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "A9YTQ3", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A9YTQ3" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "No", "trend": "up", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "A9YTQ3", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A9YTQ3" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "A9YTQ3", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A9YTQ3" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "A9YTQ3", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A9YTQ3" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "A9YTQ3", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A9YTQ3" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "A9YTQ3", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A9YTQ3" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "A9YTQ3", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A9YTQ3" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "A9YTQ3", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A9YTQ3" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "A9YTQ3", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A9YTQ3" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "A9YTQ3", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A9YTQ3" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "A9YTQ3", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A9YTQ3" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "A9YTQ3", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A9YTQ3" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "A9YTQ3", "url": "https://www.uniprot.org/uniprot/A9YTQ3" } ], "common_name": "Human" } ], "gene": [ { "name": "AHRR", "url": "https://www.uniprot.org/uniprot/A9YTQ3", "locus": { "chromosome": "5", "start_pos": 438291, "end_pos": 321714, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000063438", "url": "https://www.ensembl.org/id/ENSG00000063438" } ] } } ], "crossref": [ { "id": "ENSG00000063438", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000063438", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd00130", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00130", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd11435", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd11435", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "AHRR", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=AHRR", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "57491", "url": "https://www.ncbi.nlm.nih.gov/gene/57491", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "346", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=346", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "IPR000014", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000014", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR011598", "url": "https://www.ebi.ac.uk/interpro/entry/IPR011598", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013767", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013767", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR035965", "url": "https://www.ebi.ac.uk/interpro/entry/IPR035965", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036638", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036638", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR039092", "url": "https://www.ebi.ac.uk/interpro/entry/IPR039092", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "606517", "url": "http://www.omim.org/entry/606517", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_A9YTQ3", "url": "https://www.nextprot.org/entry/NX_A9YTQ3", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "QENDSMT", "url": "https://omabrowser.org/oma/group/QENDSMT/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5360131at2759", "url": "http://www.orthodb.org/?query=5360131at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR10649", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10649", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR10649:SF3", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10649:SF3", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "5Y7Y", "url": "https://www.rcsb.org/structure/5Y7Y", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00010", "url": "http://pfam.xfam.org/family/PF00010", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF00989", "url": "http://pfam.xfam.org/family/PF00989", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "A9YTQ3", "url": "https://pharos.nih.gov/targets/A9YTQ3", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_A9YTQ3", "url": "http://purl.obolibrary.org/obo/PR_A9YTQ3", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-211945", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-211976", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211976", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-211981", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211981", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-8937144", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8937144", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001229341", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001229341", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A494BZY4", "url": "https://www.uniprot.org/uniprot/A0A494BZY4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A494BZY4-1", "url": "https://www.uniprot.org/uniprot/A0A494BZY4-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2PK40", "url": "https://www.uniprot.org/uniprot/A0A7I2PK40", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2PK40-1", "url": "https://www.uniprot.org/uniprot/A0A7I2PK40-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A9YTQ3", "url": "https://www.uniprot.org/uniprot/A9YTQ3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A9YTQ3-1", "url": "https://www.uniprot.org/uniprot/A9YTQ3-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A9YTQ3-2", "url": "https://www.uniprot.org/uniprot/A9YTQ3-2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A9YTQ3-3", "url": "https://www.uniprot.org/uniprot/A9YTQ3-3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "D6RE68", "url": "https://www.uniprot.org/uniprot/D6RE68", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "D6RE68-1", "url": "https://www.uniprot.org/uniprot/D6RE68-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E5RFG4", "url": "https://www.uniprot.org/uniprot/E5RFG4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E5RFG4-1", "url": "https://www.uniprot.org/uniprot/E5RFG4-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E5RGQ2", "url": "https://www.uniprot.org/uniprot/E5RGQ2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E5RGQ2-1", "url": "https://www.uniprot.org/uniprot/E5RGQ2-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E5RHE0", "url": "https://www.uniprot.org/uniprot/E5RHE0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E5RHE0-1", "url": "https://www.uniprot.org/uniprot/E5RHE0-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "G3V143", "url": "https://www.uniprot.org/uniprot/G3V143", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "G3V143-1", "url": "https://www.uniprot.org/uniprot/G3V143-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YA43", "url": "https://www.uniprot.org/uniprot/H0YA43", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YA43-1", "url": "https://www.uniprot.org/uniprot/H0YA43-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MPRTMIPPGECTYAGRKRRRPLQKQRPAVGAEKSNPSKRHRDRLNAELDHLASLLPFPPDIISKLDKLSVLRLSVSYLRVKSFFQVVQEQSSRQPAAGAPSPGDSCPLAGSAVLEGRLLLESLNGFALVVSAEGTIFYASATIVDYLGFHQTDVMHQNIYDYIHVDDRQDFCRQLHWAMDPPQVVFGQPPPLETGDDAILGRLLRAQEWGTGTPTEYSAFLTRCFICRVRCLLDSTSGFLTMQFQGKLKFLFGQKKKAPSGAMLPPRLSLFCIAAPVLLPSAAEMKMRSALLRAKPRADTAATADAKVKATTSLCESELHGKPNYSAGRSSRESGVLVLREQTDAGRWAQVPARAPCLCLRGGPDLVLDPKGGSGDREEEQHRMLSRASGVTGRRETPGPTKPLPWTAGKHSEDGARPRLQPSKNDPPSLRPMPRGSCLPCPCVQGTFRNSPISHPPSPSPSAYSSRTSRPMRDVGEDQVHPPLCHFPQRSLQHQLPQPGAQRFATRGYPMEDMKLQGVPMPPGDLCGPTLLLDVSIKMEKDSGCEGAADGCVPSQVWLGASDRSHPATFPTRMHLKTEPDSRQQVYISHLGHGVRGAQPHGRATAGRSRELTPFHPAHCACLEPTDGLPQSEPPHQLCARGRGEQSCTCRAAEAAPVVKREPLDSPQWATHSQGMVPGMLPKSALATLVPPQASGCTFLP", "length": 701, "header": "sp|A9YTQ3-1|AHRR_HUMAN Isoform 1 of Aryl hydrocarbon receptor repressor OS=Homo sapiens OX=9606 GN=AHRR PE=1 SV=3 CANONICAL=A9YTQ3-1" }, "isoforms": [ { "isoform_ac": "A0A494BZY4-1", "url": "", "sequence": { "sequence": "MIPPGECTYAGRKRRRPLQKQRPAVGAEKSNPSKRHRDRLNAELDHLASLLPFPPDIISKLDKLSVLRLSVSYLRVKSFFQGVGSGRCRRCG", "length": 92, "header": "tr|A0A494BZY4-1|AHRR_HUMAN Computationally mapped isoform of Aryl hydrocarbon receptor repressor OS=Homo sapiens OX=9606 GN=AHRR PE=1 SV=1 CANONICAL=A9YTQ3-1" }, "locus": { "chromosome": "5", "start_pos": 367844, "end_pos": 343903, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000652417.2", "url": "https://www.ensembl.org/id/ENST00000652417.2" }, { "database": "Ensembl Peptide", "id": "ENSP00000498278.1", "url": "https://www.ensembl.org/id/ENSP00000498278.1" } ] } }, { "isoform_ac": "A0A7I2PK40-1", "url": "", "sequence": { "sequence": "MIPPGECTYAGRKRRRPLQKQRPAVGAEKSNPSKRHRDRLNAELDHLASLLPFPPDIISKLDKLSVLRLSVSYLRVKSFFQVVQEQSSRQPAAGAPSPGDSCPLAGSAVLEGRLLLESLNGFALVVSAEGTIFYASATIVDYLGFHQTDVMHQNIYDYIHVDDRQDFCRQLHWAMDPPQVVFGQPPPLETGDDAILGRLLRAQEWGTGTPTEYSAFLTRCFICRVRCLLDSTSGFLTMQFQGKLKFLFGQKKKAPSGAMLPPRLSLFCIAAPVLLPSAAEMKMRSALLRAKPRADTAATADAKVKATTSLCESELHGKPNYSAGRSSRESGVLVLREQTDAGRWAQVPARAPCLCLRGGPDLVLDPKGGSGDREEEQHRMLSRASGVTGRRETPGPTKPLPWTAGKHSEDGARPRLQPSKNDPPSLRPMPRGSCLPCPCVQGTFRNSPISHPPSPSPSAYSSRTSRPMRDVGEDQVHPPLCHFPQRSLQHQLPQPGAQRFATRGYPMEDMKLQGVPMPPGDLCGPTLLLDVSIKMEKDSGCEGAADGCVPSQVWLGASDRSHPATFPTRMHLKTEPDSRQQVYISHLGHGVRGAQPHGRATAGRSRELTPFHPAHCACLEPTDGLPQSEPPHQLCARGRGEQSCTCRAAEAAPVVKREPLDSPQWATHSQGMVPGMLPKSALATLVPPQASGCTFLP", "length": 697, "header": "tr|A0A7I2PK40-1|AHRR_HUMAN Computationally mapped isoform of Aryl hydrocarbon receptor repressor OS=Homo sapiens OX=9606 GN=AHRR PE=1 SV=1 CANONICAL=A9YTQ3-1" }, "locus": { "chromosome": "5", "start_pos": 434831, "end_pos": 343903, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000684583.1", "url": "https://www.ensembl.org/id/ENST00000684583.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000507476.1", "url": "https://www.ensembl.org/id/ENSP00000507476.1" } ] } }, { "isoform_ac": "A9YTQ3-1", "url": "", "sequence": { "sequence": "MPRTMIPPGECTYAGRKRRRPLQKQRPAVGAEKSNPSKRHRDRLNAELDHLASLLPFPPDIISKLDKLSVLRLSVSYLRVKSFFQVVQEQSSRQPAAGAPSPGDSCPLAGSAVLEGRLLLESLNGFALVVSAEGTIFYASATIVDYLGFHQTDVMHQNIYDYIHVDDRQDFCRQLHWAMDPPQVVFGQPPPLETGDDAILGRLLRAQEWGTGTPTEYSAFLTRCFICRVRCLLDSTSGFLTMQFQGKLKFLFGQKKKAPSGAMLPPRLSLFCIAAPVLLPSAAEMKMRSALLRAKPRADTAATADAKVKATTSLCESELHGKPNYSAGRSSRESGVLVLREQTDAGRWAQVPARAPCLCLRGGPDLVLDPKGGSGDREEEQHRMLSRASGVTGRRETPGPTKPLPWTAGKHSEDGARPRLQPSKNDPPSLRPMPRGSCLPCPCVQGTFRNSPISHPPSPSPSAYSSRTSRPMRDVGEDQVHPPLCHFPQRSLQHQLPQPGAQRFATRGYPMEDMKLQGVPMPPGDLCGPTLLLDVSIKMEKDSGCEGAADGCVPSQVWLGASDRSHPATFPTRMHLKTEPDSRQQVYISHLGHGVRGAQPHGRATAGRSRELTPFHPAHCACLEPTDGLPQSEPPHQLCARGRGEQSCTCRAAEAAPVVKREPLDSPQWATHSQGMVPGMLPKSALATLVPPQASGCTFLP", "length": 701, "header": "sp|A9YTQ3-1|AHRR_HUMAN Isoform 1 of Aryl hydrocarbon receptor repressor OS=Homo sapiens OX=9606 GN=AHRR PE=1 SV=3 CANONICAL=A9YTQ3-1" }, "locus": {} }, { "isoform_ac": "A9YTQ3-2", "url": "", "sequence": { "sequence": "MPRTMIPPGECTYAGRKRRRPLQKQRPAVGAEKSNPSKRHRDRLNAELDHLASLLPFPPDIISKLDKLSVLRLSVSYLRVKSFFQVVQEQSSRQPAAGAPSPGDSCPLAGSAVLEGRLLLESLNGFALVVSAEGTIFYASATIVDYLGFHQTDVMHQNIYDYIHVDDRQDFCRQLHWAMDPPQVVFGQPPPLETGDDAILGRLLRAQEWGTGTPTEYSAFLTRCFICRVRCLLDSTSGFLARGSQAWQLRLCCPEPLMTMQFQGKLKFLFGQKKKAPSGAMLPPRLSLFCIAAPVLLPSAAEMKMRSALLRAKPRADTAATADAKVKATTSLCESELHGKPNYSAGRSSRESGVLVLREQTDAGRWAQVPARAPCLCLRGGPDLVLDPKGGSGDREEEQHRMLSRASGVTGRRETPGPTKPLPWTAGKHSEDGARPRLQPSKNDPPSLRPMPRGSCLPCPCVQGTFRNSPISHPPSPSPSAYSSRTSRPMRDVGEDQVHPPLCHFPQRSLQHQLPQPGAQRFATRGYPMEDMKLQGVPMPPGDLCGPTLLLDVSIKMEKDSGCEGAADGCVPSQVWLGASDRSHPATFPTRMHLKTEPDSRQQVYISHLGHGVRGAQPHGRATAGRSRELTPFHPAHCACLEPTDGLPQSEPPHQLCARGRGEQSCTCRAAEAAPVVKREPLDSPQWATHSQGMVPGMLPKSALATLVPPQASGCTFLP", "length": 719, "header": "sp|A9YTQ3-2|AHRR_HUMAN Isoform 2 of Aryl hydrocarbon receptor repressor OS=Homo sapiens OX=9606 GN=AHRR PE=1 SV=3 CANONICAL=A9YTQ3-1" }, "locus": {} }, { "isoform_ac": "A9YTQ3-3", "url": "", "sequence": { "sequence": "MIPPGECTYAGRKRRRPLQKQRPAVGAEKSNPSKRHRDRLNAELDHLASLLPFPPDIISKLDKLSVLRLSVSYLRVKSFFQVVQEQSSRQPAAGAPSPGDSCPLAGSAVLEGRLLLESLNGFALVVSAEGTIFYASATIVDYLGFHQTDVMHQNIYDYIHVDDRQDFCRQLHWAMDPPQVVFGQPPPLETGDDAILGRLLRAQEWGTGTPTEYSAFLTRCFICRVRCLLDSTSGFLARGSQAWQLRLCCPEPLMTMQFQGKLKFLFGQKKKAPSGAMLPPRLSLFCIAAPVLLPSAAEMKMRSALLRAKPRADTAATADAKVKATTSLCESELHGKPNYSAGRSSRESGVLVLREQTDAGRWAQVPARAPCLCLRGGPDLVLDPKGGSGDREEEQHRMLSRASGVTGRRETPGPTKPLPWTAGKHSEDGARPRLQPSKNDPPSLRPMPRGSCLPCPCVQGTFRNSPISHPPSPSPSAYSSRTSRPMRDVGEDQVHPPLCHFPQRSLQHQLPQPGAQRFATRGYPMEDMKLQGVPMPPGDLCGPTLLLDVSIKMEKDSGCEGAADGCVPSQVWLGASDRSHPATFPTRMHLKTEPDSRQQVYISHLGHGVRGAQPHGRATAGRSRELTPFHPAHCACLEPTDGLPQSEPPHQLCARGRGEQSCTCRAAEAAPVVKREPLDSPQWATHSQGMVPGMLPKSALATLVPPQASGCTFLP", "length": 715, "header": "sp|A9YTQ3-3|AHRR_HUMAN Isoform 3 of Aryl hydrocarbon receptor repressor OS=Homo sapiens OX=9606 GN=AHRR PE=1 SV=3 CANONICAL=A9YTQ3-1" }, "locus": {} }, { "isoform_ac": "D6RE68-1", "url": "", "sequence": { "sequence": "MRGRGMPTDVMHQNIYDYIHVDDRQDFCRQLHWAMDPPQVVFGQPPPLETGDDAILGRLLRAQEWGTGTPTEYSAFLTRCFICRVRCLLDSTSGFLTMQFQGKLKFLFGQKKKAPSGAMLPPRLSLFCIAAPVLLPSAAEMKMRSALLRAKPRADTAATADAKVKATTSLCESELHGKPNYSAGRSSRESGVLVLREQTDAGRWAQVPARAPCLCLRGGPDLVLDPKGGSGDREEEQHRMLSRASGVTGRRETPGPTKPLPWTAGKHSEDGARPRLQPSKNDPPSLRPMPRGSCLPCPCVQGTFRNSPISHPPSPSPSAYSSRTSRPMRDVGEDQVHPPLCHFPQRSLQHQLPQPGAQRFATRGYPMEDMKLQGVPMPPGDLCGPTLLLDVSIKMEKDSGCEGAADGCVPSQVWLGASDRSHPATFPTRMHLKTEPDSRQQVYISHLGHGVRGAQPHGRATAGRSRELTPFHPAHCACLEPTDGLPQSEPPHQLCARGRGEQSCTCRAAEAAPVVKREPLDSPQWATHSQGMVPGMLPKSALATLVPPQASGCTFLP", "length": 557, "header": "tr|D6RE68-1|AHRR_HUMAN Computationally mapped isoform of Aryl hydrocarbon receptor repressor OS=Homo sapiens OX=9606 GN=AHRR PE=1 SV=1 CANONICAL=A9YTQ3-1" }, "locus": { "chromosome": "5", "start_pos": 434831, "end_pos": 421320, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000506456.1", "url": "https://www.ensembl.org/id/ENST00000506456.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000426932.1", "url": "https://www.ensembl.org/id/ENSP00000426932.1" } ] } }, { "isoform_ac": "E5RFG4-1", "url": "", "sequence": { "sequence": "MIPPGECTYAGRKRRRPLQKQRPAVGAEKSNPSKRHRDRLNAELDHLASLLPFPPDIISKLDKLSVLRLSVSYLRVKSFFQVVQEQSSRQPAAGAPSPGDSCPLAGSAVLEGRLLLESLNGFALVVSAEGTIFYASATIVDYLGFHQTDVMHQNIYD", "length": 157, "header": "tr|E5RFG4-1|AHRR_HUMAN Computationally mapped isoform of Aryl hydrocarbon receptor repressor OS=Homo sapiens OX=9606 GN=AHRR PE=1 SV=1 CANONICAL=A9YTQ3-1" }, "locus": { "chromosome": "5", "start_pos": 422758, "end_pos": 343903, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000510400.5", "url": "https://www.ensembl.org/id/ENST00000510400.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000428893.1", "url": "https://www.ensembl.org/id/ENSP00000428893.1" } ] } }, { "isoform_ac": "E5RGQ2-1", "url": "", "sequence": { "sequence": "MIPPGECTYAGRKRRRPLQKQRPAVGAEKSNPSKRHRDRLNAELDHLASLLPFPPDIISKLDKLSVLRLSVSYLRVKSFFQ", "length": 81, "header": "tr|E5RGQ2-1|AHRR_HUMAN Computationally mapped isoform of Aryl hydrocarbon receptor repressor OS=Homo sapiens OX=9606 GN=AHRR PE=1 SV=1 CANONICAL=A9YTQ3-1" }, "locus": { "chromosome": "5", "start_pos": 353910, "end_pos": 343903, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000504625.1", "url": "https://www.ensembl.org/id/ENST00000504625.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000429944.1", "url": "https://www.ensembl.org/id/ENSP00000429944.1" } ] } }, { "isoform_ac": "E5RHE0-1", "url": "", "sequence": { "sequence": "MHQNIYDYIHVD", "length": 12, "header": "tr|E5RHE0-1|AHRR_HUMAN Computationally mapped isoform of Aryl hydrocarbon receptor repressor OS=Homo sapiens OX=9606 GN=AHRR PE=1 SV=1 CANONICAL=A9YTQ3-1" }, "locus": { "chromosome": "5", "start_pos": 422773, "end_pos": 422738, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000514523.1", "url": "https://www.ensembl.org/id/ENST00000514523.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000430914.1", "url": "https://www.ensembl.org/id/ENSP00000430914.1" } ] } }, { "isoform_ac": "G3V143-1", "url": "", "sequence": { "sequence": "MIPPGECTYAGRKRRRPLQKQRPAVGAEKSNPSKRHRDRLNAELDHLASLLPFPPDIISKLDKLSVLRLSVSYLRVKSFFQGQGLAVADAEDVDDHTGERRPMSFRRPRALDTQALRRTQFGLHLLMVNIAGLIATDRL", "length": 139, "header": "tr|G3V143-1|AHRR_HUMAN Computationally mapped isoform of Aryl hydrocarbon receptor repressor OS=Homo sapiens OX=9606 GN=AHRR PE=1 SV=1 CANONICAL=A9YTQ3-1" }, "locus": { "chromosome": "5", "start_pos": 367980, "end_pos": 343903, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000515206.6", "url": "https://www.ensembl.org/id/ENST00000515206.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000430842.1", "url": "https://www.ensembl.org/id/ENSP00000430842.1" } ] } }, { "isoform_ac": "H0YA43-1", "url": "", "sequence": { "sequence": "LLPSAAEMKMRSALLRAKPRADTAATADAKDREEEQHRMLSRASGVTGRRETPGPTKPLPWTAGKHSEDGARPRLQPSKNDPPSLRPMPRGSCLPCPCVQGTFRNSPISHPPSPSPSAYSSRTSRPMRDVGEDQVHPPLCHFPQRSLQHQLPQPGAQRFATRGYPMEDMKLQGVPMPPGDLCGPTLLLDVSIKMEKDSGCEGAADGCVPSQVWLG", "length": 215, "header": "tr|H0YA43-1|H0YA43_HUMAN Computationally mapped isoform of Aryl hydrocarbon receptor repressor OS=Homo sapiens OX=9606 GN=AHRR PE=1 SV=1 CANONICAL=A9YTQ3-1" }, "locus": { "chromosome": "5", "start_pos": 434408, "end_pos": 427918, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000511487.1", "url": "https://www.ensembl.org/id/ENST00000511487.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000426076.1", "url": "https://www.ensembl.org/id/ENSP00000426076.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "Specific dehydrogenation of 3-methylindole and epoxidation of naphthalene by recombinant human CYP2F1 expressed in lymphoblastoid cells.", "journal": "Drug metabolism and disposition: the biological fate of chemicals", "date": "1999", "authors": "Lanza DL, Code E, Crespi CL, Gonzalez FJ, Yost GS", "evidence": [ { "database": "Reactome", "id": "R-HSA-211981", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211981" } ], "reference": [ { "type": "PubMed", "id": "10383923", "url": "https://glygen.org/publication/PubMed/10383923" } ] }, { "title": "Multiple roles of ligand in transforming the dioxin receptor to an active basic helix-loop-helix/PAS transcription factor complex with the nuclear protein Arnt.", "journal": "Molecular and cellular biology", "date": "1999", "authors": "Lees MJ, Whitelaw ML", "evidence": [ { "database": "Reactome", "id": "R-HSA-8937144", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8937144" } ], "reference": [ { "type": "PubMed", "id": "10409767", "url": "https://glygen.org/publication/PubMed/10409767" } ] }, { "title": "Nefazodone, meta-chlorophenylpiperazine, and their metabolites in vitro: cytochromes mediating transformation, and P450-3A4 inhibitory actions.", "journal": "Psychopharmacology", "date": "1999", "authors": "von Moltke LL, Greenblatt DJ, Granda BW, Grassi JM, Schmider J, Harmatz JS, Shader RI", "evidence": [ { "database": "Reactome", "id": "R-HSA-211945", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945" } ], "reference": [ { "type": "PubMed", "id": "10445380", "url": "https://glygen.org/publication/PubMed/10445380" } ] }, { "title": "Structure and functions of human oxysterol 7alpha-hydroxylase cDNAs and gene CYP7B1.", "journal": "Journal of lipid research", "date": "1999", "authors": "Wu Z, Martin KO, Javitt NB, Chiang JY", "evidence": [ { "database": "Reactome", "id": "R-HSA-211976", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211976" } ], "reference": [ { "type": "PubMed", "id": "10588945", "url": "https://glygen.org/publication/PubMed/10588945" } ] }, { "title": "The murine and human cholesterol 7alpha-hydroxylase gene promoters are differentially responsive to regulation by fatty acids mediated via peroxisome proliferator-activated receptor alpha.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Cheema SK, Agellon LB", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "10777541", "url": "https://glygen.org/publication/PubMed/10777541" } ] }, { "title": "Bioactivation of 5-(aziridin-1-yl)-2,4-dinitrobenzamide (CB 1954) by human NAD(P)H quinone oxidoreductase 2: a novel co-substrate-mediated antitumor prodrug therapy.", "journal": "Cancer research", "date": "2000", "authors": "Knox RJ, Jenkins TC, Hobbs SM, Chen S, Melton RG, Burke PJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-211945", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945" } ], "reference": [ { "type": "PubMed", "id": "10945627", "url": "https://glygen.org/publication/PubMed/10945627" } ] }, { "title": "Epoxide hydrolases: biochemistry and molecular biology.", "journal": "Chemico-biological interactions", "date": "2000", "authors": "Fretland AJ, Omiecinski CJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-211945", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945" } ], "reference": [ { "type": "PubMed", "id": "11154734", "url": "https://glygen.org/publication/PubMed/11154734" } ] }, { "title": "The hsp90 chaperone complex regulates intracellular localization of the dioxin receptor.", "journal": "Molecular and cellular biology", "date": "2001", "authors": "Kazlauskas A, Sundstrom S, Poellinger L, Pongratz I", "evidence": [ { "database": "Reactome", "id": "R-HSA-8937144", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8937144" } ], "reference": [ { "type": "PubMed", "id": "11259606", "url": "https://glygen.org/publication/PubMed/11259606" } ] }, { "title": "Alternative splicing and tissue-specific transcription of human and rodent ubiquitous 5-aminolevulinate synthase (ALAS1) genes.", "journal": "Biochimica et biophysica acta", "date": "2001", "authors": "Roberts AG, Elder GH", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "11267664", "url": "https://glygen.org/publication/PubMed/11267664" } ] }, { "title": "Stable association of hsp90 and p23, but Not hsp70, with active human telomerase.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Forsythe HL, Jarvis JL, Turner JW, Elmore LW, Holt SE", "evidence": [ { "database": "Reactome", "id": "R-HSA-8937144", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8937144" } ], "reference": [ { "type": "PubMed", "id": "11274138", "url": "https://glygen.org/publication/PubMed/11274138" } ] }, { "title": "Inhibitory effects of verapamil and diltiazem on simvastatin metabolism in human liver microsomes.", "journal": "British journal of clinical pharmacology", "date": "2001", "authors": "Yeo KR, Yeo WW", "evidence": [ { "database": "Reactome", "id": "R-HSA-211945", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945" } ], "reference": [ { "type": "PubMed", "id": "11422004", "url": "https://glygen.org/publication/PubMed/11422004" } ] }, { "title": "Role of human cytochrome P450 1A1, 1A2, 1B1, and 3A4 in the 2-, 4-, and 16alpha-hydroxylation of 17beta-estradiol.", "journal": "Metabolism: clinical and experimental", "date": "2001", "authors": "Badawi AF, Cavalieri EL, Rogan EG", "evidence": [ { "database": "Reactome", "id": "R-HSA-211976", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211976" } ], "reference": [ { "type": "PubMed", "id": "11555828", "url": "https://glygen.org/publication/PubMed/11555828" } ] }, { "title": "Characterization of the aryl hydrocarbon receptor repressor gene and association of its Pro185Ala polymorphism with micropenis.", "journal": "Teratology", "date": "2002", "authors": "Fujita H, Kosaki R, Yoshihashi H, Ogata T, Tomita M, Hasegawa T, Takahashi T, Matsuo N, Kosaki K", "evidence": [ { "database": "UniProtKB", "id": "A9YTQ3", "url": "https://www.uniprot.org/uniprot/A9YTQ3" } ], "reference": [ { "type": "PubMed", "id": "11835227", "url": "https://glygen.org/publication/PubMed/11835227" } ] }, { "title": "Peroxisome proliferator-activated receptor alpha (PPARalpha ) turnover by the ubiquitin-proteasome system controls the ligand-induced expression level of its target genes.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Blanquart C, Barbier O, Fruchart JC, Staels B, Glineur C", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "12118000", "url": "https://glygen.org/publication/PubMed/12118000" } ] }, { "title": "Transcriptional activities of nuclear SREBP-1a, -1c, and -2 to different target promoters of lipogenic and cholesterogenic genes.", "journal": "Journal of lipid research", "date": "2002", "authors": "Amemiya-Kudo M, Shimano H, Hasty AH, Yahagi N, Yoshikawa T, Matsuzaka T, Okazaki H, Tamura Y, Iizuka Y, Ohashi K, Osuga J, Harada K, Gotoda T, Sato R, Kimura S, Ishibashi S, Yamada N", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "12177166", "url": "https://glygen.org/publication/PubMed/12177166" } ] }, { "title": "Cytochrome P450 oxidations in the generation of reactive electrophiles: epoxidation and related reactions.", "journal": "Archives of biochemistry and biophysics", "date": "2003", "authors": "Guengerich FP", "evidence": [ { "database": "Reactome", "id": "R-HSA-211981", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211981" } ], "reference": [ { "type": "PubMed", "id": "12464245", "url": "https://glygen.org/publication/PubMed/12464245" } ] }, { "title": "Regulation of P450 4A expression by peroxisome proliferator activated receptors.", "journal": "Toxicology", "date": "2002", "authors": "Johnson EF, Hsu MH, Savas U, Griffin KJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "12505311", "url": "https://glygen.org/publication/PubMed/12505311" } ] }, { "title": "Functional role of AhR in the expression of toxic effects by TCDD.", "journal": "Biochimica et biophysica acta", "date": "2003", "authors": "Mimura J, Fujii-Kuriyama Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-8937144", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8937144" } ], "reference": [ { "type": "PubMed", "id": "12573486", "url": "https://glygen.org/publication/PubMed/12573486" } ] }, { "title": "The UDP-glucuronosyltransferase 1A9 enzyme is a peroxisome proliferator-activated receptor alpha and gamma target gene.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Barbier O, Villeneuve L, Bocher V, Fontaine C, Torra IP, Duhem C, Kosykh V, Fruchart JC, Guillemette C, Staels B", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "12582161", "url": "https://glygen.org/publication/PubMed/12582161" } ] }, { "title": "Role of polymorphic human CYP2B6 in cyclophosphamide bioactivation.", "journal": "The pharmacogenomics journal", "date": "2003", "authors": "Xie HJ, Yasar U, Lundgren S, Griskevicius L, Terelius Y, Hassan M, Rane A", "evidence": [ { "database": "Reactome", "id": "R-HSA-211981", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211981" } ], "reference": [ { "type": "PubMed", "id": "12629583", "url": "https://glygen.org/publication/PubMed/12629583" } ] }, { "title": "Crystal structure of human carboxylesterase 1 complexed with the Alzheimer's drug tacrine: from binding promiscuity to selective inhibition.", "journal": "Chemistry & biology", "date": "2003", "authors": "Bencharit S, Morton CL, Hyatt JL, Kuhn P, Danks MK, Potter PM, Redinbo MR", "evidence": [ { "database": "Reactome", "id": "R-HSA-211945", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945" } ], "reference": [ { "type": "PubMed", "id": "12725862", "url": "https://glygen.org/publication/PubMed/12725862" } ] }, { "title": "Identification of a human valacyclovirase: biphenyl hydrolase-like protein as valacyclovir hydrolase.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Kim I, Chu XY, Kim S, Provoda CJ, Lee KD, Amidon GL", "evidence": [ { "database": "Reactome", "id": "R-HSA-211945", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945" } ], "reference": [ { "type": "PubMed", "id": "12732646", "url": "https://glygen.org/publication/PubMed/12732646" } ] }, { "title": "Wine, alcohol, platelets, and the French paradox for coronary heart disease.", "journal": "Lancet (London, England)", "date": "1992", "authors": "Renaud S, de Lorgeril M", "evidence": [ { "database": "Reactome", "id": "R-HSA-211945", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945" } ], "reference": [ { "type": "PubMed", "id": "1351198", "url": "https://glygen.org/publication/PubMed/1351198" } ] }, { "title": "Characteristic expression of aryl hydrocarbon receptor repressor gene in human tissues: organ-specific distribution and variable induction patterns in mononuclear cells.", "journal": "Life Sci.", "date": "2004", "authors": "Yamamoto Junko, Ihara Kenji, Nakayama Hideki, Hikino Shunji, Satoh Kazuo, Kubo Norio, Iida Takao, Fujii Yoshiaki, Hara Toshiro", "evidence": [ { "database": "UniProtKB", "id": "A9YTQ3", "url": "https://www.uniprot.org/uniprot/A9YTQ3" } ], "reference": [ { "type": "PubMed", "id": "14672759", "url": "https://glygen.org/publication/PubMed/14672759" } ] }, { "title": "Bietti crystalline corneoretinal dystrophy is caused by mutations in the novel gene CYP4V2.", "journal": "American journal of human genetics", "date": "2004", "authors": "Li A, Jiao X, Munier FL, Schorderet DF, Yao W, Iwata F, Hayakawa M, Kanai A, Shy Chen M, Alan Lewis R, Heckenlively J, Weleber RG, Traboulsi EI, Zhang Q, Xiao X, Kaiser-Kupfer M, Sergeev YV, Hejtmancik JF", "evidence": [ { "database": "Reactome", "id": "R-HSA-211976", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211976" } ], "reference": [ { "type": "PubMed", "id": "15042513", "url": "https://glygen.org/publication/PubMed/15042513" } ] }, { "title": "Effect of peroxisome proliferator-activated receptor alpha on human angiotensinogen promoter.", "journal": "International journal of molecular medicine", "date": "2004", "authors": "Shimamoto Y, Hirota K, Fukamizu A", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "15067378", "url": "https://glygen.org/publication/PubMed/15067378" } ] }, { "title": "Functional analysis of peroxisome-proliferator-responsive element motifs in genes of fatty acid-binding proteins.", "journal": "The Biochemical journal", "date": "2004", "authors": "Schachtrup C, Emmler T, Bleck B, Sandqvist A, Spener F", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "15130092", "url": "https://glygen.org/publication/PubMed/15130092" } ] }, { "title": "Identification of Val117 and Arg372 as critical amino acid residues for the activity difference between human CYP2A6 and CYP2A13 in coumarin 7-hydroxylation.", "journal": "Archives of biochemistry and biophysics", "date": "2004", "authors": "He XY, Shen J, Hu WY, Ding X, Lu AY, Hong JY", "evidence": [ { "database": "Reactome", "id": "R-HSA-211981", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211981" } ], "reference": [ { "type": "PubMed", "id": "15196988", "url": "https://glygen.org/publication/PubMed/15196988" } ] }, { "title": "Crystal structure of quinone reductase 2 in complex with resveratrol.", "journal": "Biochemistry", "date": "2004", "authors": "Buryanovskyy L, Fu Y, Boyd M, Ma Y, Hsieh TC, Wu JM, Zhang Z", "evidence": [ { "database": "Reactome", "id": "R-HSA-211945", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945" } ], "reference": [ { "type": "PubMed", "id": "15350128", "url": "https://glygen.org/publication/PubMed/15350128" } ] }, { "title": "Identification of cytochrome P450 isoforms involved in the metabolism of loperamide in human liver microsomes.", "journal": "European journal of clinical pharmacology", "date": "2004", "authors": "Kim KA, Chung J, Jung DH, Park JY", "evidence": [ { "database": "Reactome", "id": "R-HSA-211981", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211981" } ], "reference": [ { "type": "PubMed", "id": "15365656", "url": "https://glygen.org/publication/PubMed/15365656" } ] }, { "title": "Increased levels of aflatoxin-albumin adducts are associated with CYP3A5 polymorphisms in The Gambia, West Africa.", "journal": "Pharmacogenetics", "date": "2004", "authors": "Wojnowski L, Turner PC, Pedersen B, Hustert E, Brockmoller J, Mendy M, Whittle HC, Kirk G, Wild CP", "evidence": [ { "database": "Reactome", "id": "R-HSA-211981", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211981" } ], "reference": [ { "type": "PubMed", "id": "15454734", "url": "https://glygen.org/publication/PubMed/15454734" } ] }, { "title": "Association of male infertility with Pro185Ala polymorphism in the aryl hydrocarbon receptor repressor gene: implication for the susceptibility to dioxins.", "journal": "Fertil. Steril.", "date": "2004", "authors": "Watanabe Masanori, Sueoka Kou, Sasagawa Isoji, Nakabayashi Akira, Yoshimura Yasunori, Ogata Tsutomu", "evidence": [ { "database": "UniProtKB", "id": "A9YTQ3", "url": "https://www.uniprot.org/uniprot/A9YTQ3" } ], "reference": [ { "type": "PubMed", "id": "15474075", "url": "https://glygen.org/publication/PubMed/15474075" } ] }, { "title": "Cardiovascular protective effects of resveratrol.", "journal": "Cardiovascular drug reviews", "date": "2004", "authors": "Bradamante S, Barenghi L, Villa A", "evidence": [ { "database": "Reactome", "id": "R-HSA-211945", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945" } ], "reference": [ { "type": "PubMed", "id": "15492766", "url": "https://glygen.org/publication/PubMed/15492766" } ] }, { "title": "Mechanism-based inactivation of CYP3A by HIV protease inhibitors.", "journal": "The Journal of pharmacology and experimental therapeutics", "date": "2005", "authors": "Ernest CS 2nd, Hall SD, Jones DR", "evidence": [ { "database": "Reactome", "id": "R-HSA-211945", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945" } ], "reference": [ { "type": "PubMed", "id": "15523003", "url": "https://glygen.org/publication/PubMed/15523003" } ] }, { "title": "Functional analysis of human microsomal epoxide hydrolase genetic variants.", "journal": "Chemico-biological interactions", "date": "2004", "authors": "Hosagrahara VP, Rettie AE, Hassett C, Omiecinski CJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-211945", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945" } ], "reference": [ { "type": "PubMed", "id": "15535985", "url": "https://glygen.org/publication/PubMed/15535985" } ] }, { "title": "Regulation of human hepatic hydroxysteroid sulfotransferase gene expression by the peroxisome proliferator-activated receptor alpha transcription factor.", "journal": "Molecular pharmacology", "date": "2005", "authors": "Fang HL, Strom SC, Cai H, Falany CN, Kocarek TA, Runge-Morris M", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "15635043", "url": "https://glygen.org/publication/PubMed/15635043" } ] }, { "title": "Kinetic analysis of oxidation of coumarins by human cytochrome P450 2A6.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Yun CH, Kim KH, Calcutt MW, Guengerich FP", "evidence": [ { "database": "Reactome", "id": "R-HSA-211981", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211981" } ], "reference": [ { "type": "PubMed", "id": "15665333", "url": "https://glygen.org/publication/PubMed/15665333" } ] }, { "title": "Analysis of the AhR, ARNT, and AhRR gene polymorphisms: genetic contribution to endometriosis susceptibility and severity.", "journal": "Fertil. Steril.", "date": "2005", "authors": "Tsuchiya Masaki, Katoh Takahiko, Motoyama Hiroshi, Sasaki Hiroshi, Tsugane Shoichiro, Ikenoue Tsuyomu", "evidence": [ { "database": "UniProtKB", "id": "A9YTQ3", "url": "https://www.uniprot.org/uniprot/A9YTQ3" } ], "reference": [ { "type": "PubMed", "id": "16084889", "url": "https://glygen.org/publication/PubMed/16084889" } ] }, { "title": "P450 2C18 catalyzes the metabolic bioactivation of phenytoin.", "journal": "Chemical research in toxicology", "date": "2005", "authors": "Kinobe RT, Parkinson OT, Mitchell DJ, Gillam EM", "evidence": [ { "database": "Reactome", "id": "R-HSA-211981", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211981" } ], "reference": [ { "type": "PubMed", "id": "16359177", "url": "https://glygen.org/publication/PubMed/16359177" } ] }, { "title": "Identification of novel PPARgamma target genes in primary human adipocytes.", "journal": "Gene", "date": "2006", "authors": "Perera RJ, Marcusson EG, Koo S, Kang X, Kim Y, White N, Dean NM", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "16380219", "url": "https://glygen.org/publication/PubMed/16380219" } ] }, { "title": "RNAi-mediated knockdown of aldehyde dehydrogenase class-1A1 and class-3A1 is specific and reveals that each contributes equally to the resistance against 4-hydroperoxycyclophosphamide.", "journal": "Cancer chemotherapy and pharmacology", "date": "2007", "authors": "Moreb JS, Mohuczy D, Ostmark B, Zucali JR", "evidence": [ { "database": "Reactome", "id": "R-HSA-211945", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945" } ], "reference": [ { "type": "PubMed", "id": "16614850", "url": "https://glygen.org/publication/PubMed/16614850" } ] }, { "title": "NRH:quinone oxidoreductase 2 (NQO2) catalyzes metabolic activation of quinones and anti-tumor drugs.", "journal": "Biochemical pharmacology", "date": "2006", "authors": "Celli CM, Tran N, Knox R, Jaiswal AK", "evidence": [ { "database": "Reactome", "id": "R-HSA-211945", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945" } ], "reference": [ { "type": "PubMed", "id": "16765324", "url": "https://glygen.org/publication/PubMed/16765324" } ] }, { "title": "The arylhydrocarbon receptor repressor (AhRR): structure, expression, and function.", "journal": "Biological chemistry", "date": "2006", "authors": "Haarmann-Stemmann T, Abel J", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "16972786", "url": "https://glygen.org/publication/PubMed/16972786" } ] }, { "title": "Characterization of human sterol 27-hydroxylase. A mitochondrial cytochrome P-450 that catalyzes multiple oxidation reaction in bile acid biosynthesis.", "journal": "The Journal of biological chemistry", "date": "1991", "authors": "Cali JJ, Russell DW", "evidence": [ { "database": "Reactome", "id": "R-HSA-211976", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211976" } ], "reference": [ { "type": "PubMed", "id": "1708392", "url": "https://glygen.org/publication/PubMed/1708392" } ] }, { "title": "Adipogenesis-related increase of semicarbazide-sensitive amine oxidase and monoamine oxidase in human adipocytes.", "journal": "Biochimie", "date": "2007", "authors": "Bour S, Daviaud D, Gres S, Lefort C, Prevot D, Zorzano A, Wabitsch M, Saulnier-Blache JS, Valet P, Carpene C", "evidence": [ { "database": "Reactome", "id": "R-HSA-211945", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945" } ], "reference": [ { "type": "PubMed", "id": "17400359", "url": "https://glygen.org/publication/PubMed/17400359" } ] }, { "title": "Role of steroid 11 beta-hydroxylase and steroid 18-hydroxylase in the biosynthesis of glucocorticoids and mineralocorticoids in humans.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1992", "authors": "Kawamoto T, Mitsuuchi Y, Toda K, Yokoyama Y, Miyahara K, Miura S, Ohnishi T, Ichikawa Y, Nakao K, Imura H, et al.", "evidence": [ { "database": "Reactome", "id": "R-HSA-211976", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211976" } ], "reference": [ { "type": "PubMed", "id": "1741400", "url": "https://glygen.org/publication/PubMed/1741400" } ] }, { "title": "The contribution of genetic variations of aryl hydrocarbon receptor pathway genes to male factor infertility.", "journal": "Fertil. Steril.", "date": "2007", "authors": "Merisalu Ave, Punab Margus, Altm\u00e4e Signe, Haller Kadri, Tiido Tarmo, Peters Maire, Salumets Andres", "evidence": [ { "database": "UniProtKB", "id": "A9YTQ3", "url": "https://www.uniprot.org/uniprot/A9YTQ3" } ], "reference": [ { "type": "PubMed", "id": "17559847", "url": "https://glygen.org/publication/PubMed/17559847" } ] }, { "title": "Analysis of the transcriptional regulation and molecular function of the aryl hydrocarbon receptor repressor in human cell lines.", "journal": "Drug metabolism and disposition: the biological fate of chemicals", "date": "2007-12", "authors": "Haarmann-Stemmann Thomas, Bothe Hanno, Kohli Amitabh, Sydlik Ulrich, Abel Josef, Fritsche Ellen", "evidence": [ { "database": "UniProtKB", "id": "A9YTQ3", "url": "https://www.uniprot.org/uniprot/A9YTQ3" } ], "reference": [ { "type": "PubMed", "id": "17890447", "url": "https://glygen.org/publication/PubMed/17890447" } ] }, { "title": "Identification of intracellular localization signals and of mechanisms underlining the nucleocytoplasmic shuttling of human aryl hydrocarbon receptor repressor.", "journal": "Biochem. Biophys. Res. Commun.", "date": "2007", "authors": "Kanno Y, Miyama Y, Takane Y, Nakahama T, Inouye Y", "evidence": [ { "database": "UniProtKB", "id": "A9YTQ3", "url": "https://www.uniprot.org/uniprot/A9YTQ3" }, { "database": "Reactome", "id": "R-HSA-8937144", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8937144" } ], "reference": [ { "type": "PubMed", "id": "17980155", "url": "https://glygen.org/publication/PubMed/17980155" } ] }, { "title": "Repression of aryl hydrocarbon receptor (AHR) signaling by AHR repressor: role of DNA binding and competition for AHR nuclear translocator.", "journal": "Molecular pharmacology", "date": "2008", "authors": "Evans BR, Karchner SI, Allan LL, Pollenz RS, Tanguay RL, Jenny MJ, Sherr DH, Hahn ME", "evidence": [ { "database": "Reactome", "id": "R-HSA-8937144", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8937144" } ], "reference": [ { "type": "PubMed", "id": "18000031", "url": "https://glygen.org/publication/PubMed/18000031" } ] }, { "title": "The aryl hydrocarbon receptor repressor is a putative tumor suppressor gene in multiple human cancers.", "journal": "The Journal of clinical investigation", "date": "2008-02", "authors": "Zudaire Enrique, Cuesta Natalia, Murty Vundavalli, Woodson Karen, Adams Lisa, Gonzalez Nieves, Mart\u00ednez Alfredo, Narayan Gopeshwar, Kirsch Ilan, Franklin Wilbur, Hirsch Fred, Birrer Michael, Cuttitta Frank", "evidence": [ { "database": "UniProtKB", "id": "A9YTQ3", "url": "https://www.uniprot.org/uniprot/A9YTQ3" } ], "reference": [ { "type": "PubMed", "id": "18172554", "url": "https://glygen.org/publication/PubMed/18172554" } ] }, { "title": "Kinetic, thermodynamic and X-ray structural insights into the interaction of melatonin and analogues with quinone reductase 2.", "journal": "The Biochemical journal", "date": "2008", "authors": "Calamini B, Santarsiero BD, Boutin JA, Mesecar AD", "evidence": [ { "database": "Reactome", "id": "R-HSA-211945", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945" } ], "reference": [ { "type": "PubMed", "id": "18254726", "url": "https://glygen.org/publication/PubMed/18254726" } ] }, { "title": "Molecular basis of prodrug activation by human valacyclovirase, an alpha-amino acid ester hydrolase.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Lai L, Xu Z, Zhou J, Lee KD, Amidon GL", "evidence": [ { "database": "Reactome", "id": "R-HSA-211945", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945" } ], "reference": [ { "type": "PubMed", "id": "18256025", "url": "https://glygen.org/publication/PubMed/18256025" } ] }, { "title": "Rapid clinical induction of hepatic cytochrome P4502B6 activity by ritonavir.", "journal": "Antimicrobial agents and chemotherapy", "date": "2008", "authors": "Kharasch ED, Mitchell D, Coles R, Blanco R", "evidence": [ { "database": "Reactome", "id": "R-HSA-211945", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945" } ], "reference": [ { "type": "PubMed", "id": "18285471", "url": "https://glygen.org/publication/PubMed/18285471" } ] }, { "title": "The aryl hydrocarbon receptor complex and the control of gene expression.", "journal": "Critical reviews in eukaryotic gene expression", "date": "2008", "authors": "Beischlag TV, Luis Morales J, Hollingshead BD, Perdew GH", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "18540824", "url": "https://glygen.org/publication/PubMed/18540824" } ] }, { "title": "Differential regulation of human ALAS1 mRNA and protein levels by heme and cobalt protoporphyrin.", "journal": "Molecular and cellular biochemistry", "date": "2008", "authors": "Zheng J, Shan Y, Lambrecht RW, Donohue SE, Bonkovsky HL", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "18719978", "url": "https://glygen.org/publication/PubMed/18719978" } ] }, { "title": "Regulation of constitutive and inducible AHR signaling: complex interactions involving the AHR repressor.", "journal": "Biochemical pharmacology", "date": "2009", "authors": "Hahn ME, Allan LL, Sherr DH", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "18848529", "url": "https://glygen.org/publication/PubMed/18848529" } ] }, { "title": "The fourth molybdenum containing enzyme mARC: cloning and involvement in the activation of N-hydroxylated prodrugs.", "journal": "Journal of medicinal chemistry", "date": "2008", "authors": "Gruenewald S, Wahl B, Bittner F, Hungeling H, Kanzow S, Kotthaus J, Schwering U, Mendel RR, Clement B", "evidence": [ { "database": "Reactome", "id": "R-HSA-211945", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945" } ], "reference": [ { "type": "PubMed", "id": "19053771", "url": "https://glygen.org/publication/PubMed/19053771" } ] }, { "title": "Transcriptional regulation of HMG-CoA synthase and HMG-CoA reductase genes by human ACBP.", "journal": "Cellular physiology and biochemistry : international journal of experimental cellular physiology, biochemistry, and pharmacology", "date": "2008", "authors": "Vock C, Doring F, Nitz I", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "19088433", "url": "https://glygen.org/publication/PubMed/19088433" } ] }, { "title": "The unique substrate specificity of human AOC2, a semicarbazide-sensitive amine oxidase.", "journal": "Cellular and molecular life sciences : CMLS", "date": "2009", "authors": "Kaitaniemi S, Elovaara H, Gron K, Kidron H, Liukkonen J, Salminen T, Salmi M, Jalkanen S, Elima K", "evidence": [ { "database": "Reactome", "id": "R-HSA-211945", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945" } ], "reference": [ { "type": "PubMed", "id": "19588076", "url": "https://glygen.org/publication/PubMed/19588076" } ] }, { "title": "Expression and characterization of CYP4V2 as a fatty acid omega-hydroxylase.", "journal": "Drug metabolism and disposition: the biological fate of chemicals", "date": "2009", "authors": "Nakano M, Kelly EJ, Rettie AE", "evidence": [ { "database": "Reactome", "id": "R-HSA-211976", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211976" } ], "reference": [ { "type": "PubMed", "id": "19661213", "url": "https://glygen.org/publication/PubMed/19661213" } ] }, { "title": "Comparative analysis of gene regulation by the transcription factor PPARalpha between mouse and human.", "journal": "PloS one", "date": "2009", "authors": "Rakhshandehroo M, Hooiveld G, Muller M, Kersten S", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "19710929", "url": "https://glygen.org/publication/PubMed/19710929" } ] }, { "title": "Structure and inhibition of human diamine oxidase.", "journal": "Biochemistry", "date": "2009", "authors": "McGrath AP, Hilmer KM, Collyer CA, Shepard EM, Elmore BO, Brown DE, Dooley DM, Guss JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-211945", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945" } ], "reference": [ { "type": "PubMed", "id": "19764817", "url": "https://glygen.org/publication/PubMed/19764817" } ] }, { "title": "Activating peroxisome proliferator-activated receptor gamma mutant promotes tumor growth in vivo by enhancing angiogenesis.", "journal": "Cancer research", "date": "2009", "authors": "Tian L, Zhou J, Casimiro MC, Liang B, Ojeifo JO, Wang M, Hyslop T, Wang C, Pestell RG", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "19934321", "url": "https://glygen.org/publication/PubMed/19934321" } ] }, { "title": "Naturally occurring variants of human CBR3 alter anthracycline in vitro metabolism.", "journal": "The Journal of pharmacology and experimental therapeutics", "date": "2010", "authors": "Bains OS, Karkling MJ, Lubieniecka JM, Grigliatti TA, Reid RE, Riggs KW", "evidence": [ { "database": "Reactome", "id": "R-HSA-211945", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945" } ], "reference": [ { "type": "PubMed", "id": "20007405", "url": "https://glygen.org/publication/PubMed/20007405" } ] }, { "title": "Profiling of promoter occupancy by PPARalpha in human hepatoma cells via ChIP-chip analysis.", "journal": "Nucleic acids research", "date": "2010", "authors": "van der Meer DL, Degenhardt T, Vaisanen S, de Groot PJ, Heinaniemi M, de Vries SC, Muller M, Carlberg C, Kersten S", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "20110263", "url": "https://glygen.org/publication/PubMed/20110263" } ] }, { "title": "Structural basis of human CYP51 inhibition by antifungal azoles.", "journal": "Journal of molecular biology", "date": "2010", "authors": "Strushkevich N, Usanov SA, Park HW", "evidence": [ { "database": "Reactome", "id": "R-HSA-211976", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211976" } ], "reference": [ { "type": "PubMed", "id": "20149798", "url": "https://glygen.org/publication/PubMed/20149798" } ] }, { "title": "Human carboxymethylenebutenolidase as a bioactivating hydrolase of olmesartan medoxomil in liver and intestine.", "journal": "The Journal of biological chemistry", "date": "2010", "authors": "Ishizuka T, Fujimori I, Kato M, Noji-Sakikawa C, Saito M, Yoshigae Y, Kubota K, Kurihara A, Izumi T, Ikeda T, Okazaki O", "evidence": [ { "database": "Reactome", "id": "R-HSA-211945", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945" } ], "reference": [ { "type": "PubMed", "id": "20177059", "url": "https://glygen.org/publication/PubMed/20177059" } ] }, { "title": "Tolbutamide and phenytoin hydroxylations by cDNA-expressed human liver cytochrome P4502C9.", "journal": "Biochemical and biophysical research communications", "date": "1991", "authors": "Veronese ME, Mackenzie PI, Doecke CJ, McManus ME, Miners JO, Birkett DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-211981", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211981" } ], "reference": [ { "type": "PubMed", "id": "2025243", "url": "https://glygen.org/publication/PubMed/2025243" } ] }, { "title": "Mammalian carboxylesterase 3: comparative genomics and proteomics.", "journal": "Genetica", "date": "2010", "authors": "Holmes RS, Cox LA, VandeBerg JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-211945", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945" } ], "reference": [ { "type": "PubMed", "id": "20422440", "url": "https://glygen.org/publication/PubMed/20422440" } ] }, { "title": "Arylacetamide deacetylase is a determinant enzyme for the difference in hydrolase activities of phenacetin and acetaminophen.", "journal": "Drug metabolism and disposition: the biological fate of chemicals", "date": "2010", "authors": "Watanabe A, Fukami T, Takahashi S, Kobayashi Y, Nakagawa N, Nakajima M, Yokoi T", "evidence": [ { "database": "Reactome", "id": "R-HSA-211945", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945" } ], "reference": [ { "type": "PubMed", "id": "20542992", "url": "https://glygen.org/publication/PubMed/20542992" } ] }, { "title": "Structural basis for pregnenolone biosynthesis by the mitochondrial monooxygenase system.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2011", "authors": "Strushkevich N, MacKenzie F, Cherkesova T, Grabovec I, Usanov S, Park HW", "evidence": [ { "database": "Reactome", "id": "R-HSA-211976", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211976" } ], "reference": [ { "type": "PubMed", "id": "21636783", "url": "https://glygen.org/publication/PubMed/21636783" } ] }, { "title": "Cloning and expression of a cDNA for human cytochrome P-450aldo as related to primary aldosteronism.", "journal": "Biochemical and biophysical research communications", "date": "1990", "authors": "Kawainoto T, Mitsuuchi Y, Ohnishi T, Ichikawa Y, Yokoyama Y, Sumimoto H, Toda K, Miyahara K, Kuribayashi I, Nakao K, et al.", "evidence": [ { "database": "Reactome", "id": "R-HSA-211976", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211976" } ], "reference": [ { "type": "PubMed", "id": "2256920", "url": "https://glygen.org/publication/PubMed/2256920" } ] }, { "title": "Identification of a novel intracellular cholesteryl ester hydrolase (carboxylesterase 3) in human macrophages: compensatory increase in its expression after carboxylesterase 1 silencing.", "journal": "American journal of physiology. Cell physiology", "date": "2012", "authors": "Zhao B, Bie J, Wang J, Marqueen SA, Ghosh S", "evidence": [ { "database": "Reactome", "id": "R-HSA-211945", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945" } ], "reference": [ { "type": "PubMed", "id": "22700792", "url": "https://glygen.org/publication/PubMed/22700792" } ] }, { "title": "p23 co-chaperone protects the aryl hydrocarbon receptor from degradation in mouse and human cell lines.", "journal": "Biochemical pharmacology", "date": "2012", "authors": "Nguyen PM, Wang D, Wang Y, Li Y, Uchizono JA, Chan WK", "evidence": [ { "database": "Reactome", "id": "R-HSA-8937144", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8937144" } ], "reference": [ { "type": "PubMed", "id": "22759865", "url": "https://glygen.org/publication/PubMed/22759865" } ] }, { "title": "CYP4V2 in Bietti's crystalline dystrophy: ocular localization, metabolism of omega-3-polyunsaturated fatty acids, and functional deficit of the p.H331P variant.", "journal": "Molecular pharmacology", "date": "2012", "authors": "Nakano M, Kelly EJ, Wiek C, Hanenberg H, Rettie AE", "evidence": [ { "database": "Reactome", "id": "R-HSA-211976", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211976" } ], "reference": [ { "type": "PubMed", "id": "22772592", "url": "https://glygen.org/publication/PubMed/22772592" } ] }, { "title": "The emerging role of human esterases.", "journal": "Drug metabolism and pharmacokinetics", "date": "2012", "authors": "Fukami T, Yokoi T", "evidence": [ { "database": "Reactome", "id": "R-HSA-211945", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945" } ], "reference": [ { "type": "PubMed", "id": "22813719", "url": "https://glygen.org/publication/PubMed/22813719" } ] }, { "title": "Cobicistat, a pharmacoenhancer for HIV treatments.", "journal": "Drugs of today (Barcelona, Spain : 1998)", "date": "2013", "authors": "Temesgen Z", "evidence": [ { "database": "Reactome", "id": "R-HSA-211945", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945" } ], "reference": [ { "type": "PubMed", "id": "23616950", "url": "https://glygen.org/publication/PubMed/23616950" } ] }, { "title": "Design, synthesis, biological and structural evaluation of functionalized resveratrol analogues as inhibitors of quinone reductase 2.", "journal": "Bioorganic & medicinal chemistry", "date": "2013", "authors": "St John SE, Jensen KC, Kang S, Chen Y, Calamini B, Mesecar AD, Lipton MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-211945", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945" } ], "reference": [ { "type": "PubMed", "id": "23953689", "url": "https://glygen.org/publication/PubMed/23953689" } ] }, { "title": "Nuclear receptor-mediated cell-autonomous oscillatory expression of the circadian transcription factor, neuronal PAS domain protein 2 (NPAS2).", "journal": "The Journal of biological chemistry", "date": "2013", "authors": "Matsumura R, Matsubara C, Node K, Takumi T, Akashi M", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "24196956", "url": "https://glygen.org/publication/PubMed/24196956" } ] }, { "title": "Functional characterization of protein variants encoded by nonsynonymous single nucleotide polymorphisms in MARC1 and MARC2 in healthy Caucasians.", "journal": "Drug metabolism and disposition: the biological fate of chemicals", "date": "2014", "authors": "Ott G, Reichmann D, Boerger C, Cascorbi I, Bittner F, Mendel RR, Kunze T, Clement B, Havemeyer A", "evidence": [ { "database": "Reactome", "id": "R-HSA-211945", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945" } ], "reference": [ { "type": "PubMed", "id": "24423752", "url": "https://glygen.org/publication/PubMed/24423752" } ] }, { "title": "Development of selective inhibitors for human aldehyde dehydrogenase 3A1 (ALDH3A1) for the enhancement of cyclophosphamide cytotoxicity.", "journal": "Chembiochem : a European journal of chemical biology", "date": "2014", "authors": "Parajuli B, Georgiadis TM, Fishel ML, Hurley TD", "evidence": [ { "database": "Reactome", "id": "R-HSA-211945", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945" } ], "reference": [ { "type": "PubMed", "id": "24677340", "url": "https://glygen.org/publication/PubMed/24677340" } ] }, { "title": "Cobicistat (GS-9350): A Potent and Selective Inhibitor of Human CYP3A as a Novel Pharmacoenhancer.", "journal": "ACS medicinal chemistry letters", "date": "2010", "authors": "Xu L, Liu H, Murray BP, Callebaut C, Lee MS, Hong A, Strickley RG, Tsai LK, Stray KM, Wang Y, Rhodes GR, Desai MC", "evidence": [ { "database": "Reactome", "id": "R-HSA-211945", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945" } ], "reference": [ { "type": "PubMed", "id": "24900196", "url": "https://glygen.org/publication/PubMed/24900196" } ] }, { "title": "The N-reductive system composed of mitochondrial amidoxime reducing component (mARC), cytochrome b5 (CYB5B) and cytochrome b5 reductase (CYB5R) is regulated by fasting and high fat diet in mice.", "journal": "PloS one", "date": "2014", "authors": "Jakobs HH, Mikula M, Havemeyer A, Strzalkowska A, Borowa-Chmielak M, Dzwonek A, Gajewska M, Hennig EE, Ostrowski J, Clement B", "evidence": [ { "database": "Reactome", "id": "R-HSA-211945", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945" } ], "reference": [ { "type": "PubMed", "id": "25144769", "url": "https://glygen.org/publication/PubMed/25144769" } ] }, { "title": "Uncovering global SUMOylation signaling networks in a site-specific manner.", "journal": "Nat. Struct. Mol. Biol.", "date": "2014", "authors": "Hendriks IA, D'Souza RC, Yang B, Verlaan-de Vries M, Mann M, Vertegaal AC", "evidence": [ { "database": "UniProtKB", "id": "D6RE68", "url": "https://www.uniprot.org/uniprot/D6RE68" } ], "reference": [ { "type": "PubMed", "id": "25218447", "url": "https://glygen.org/publication/PubMed/25218447" } ] }, { "title": "The mammalian molybdenum enzymes of mARC.", "journal": "Journal of biological inorganic chemistry : JBIC : a publication of the Society of Biological Inorganic Chemistry", "date": "2015", "authors": "Ott G, Havemeyer A, Clement B", "evidence": [ { "database": "Reactome", "id": "R-HSA-211945", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945" } ], "reference": [ { "type": "PubMed", "id": "25425164", "url": "https://glygen.org/publication/PubMed/25425164" } ] }, { "title": "Metabolism of doxorubicin to the cardiotoxic metabolite doxorubicinol is increased in a mouse model of chronic glutathione deficiency: A potential role for carbonyl reductase 3.", "journal": "Chemico-biological interactions", "date": "2015", "authors": "Schaupp CM, White CC, Merrill GF, Kavanagh TJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-211945", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945" } ], "reference": [ { "type": "PubMed", "id": "25446851", "url": "https://glygen.org/publication/PubMed/25446851" } ] }, { "title": "Ritonavir is the best alternative to ketoconazole as an index inhibitor of cytochrome P450-3A in drug-drug interaction studies.", "journal": "British journal of clinical pharmacology", "date": "2015", "authors": "Greenblatt DJ, Harmatz JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-211945", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945" } ], "reference": [ { "type": "PubMed", "id": "25923589", "url": "https://glygen.org/publication/PubMed/25923589" } ] }, { "title": "Characterization of two genes encoding human steroid 11 beta-hydroxylase (P-450(11) beta).", "journal": "The Journal of biological chemistry", "date": "1989", "authors": "Mornet E, Dupont J, Vitek A, White PC", "evidence": [ { "database": "Reactome", "id": "R-HSA-211976", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211976" } ], "reference": [ { "type": "PubMed", "id": "2592361", "url": "https://glygen.org/publication/PubMed/2592361" } ] }, { "title": "The crystal structure of the AhRR-ARNT heterodimer reveals the structural basis of the repression of AhR-mediated transcription.", "journal": "J. Biol. Chem.", "date": "2017", "authors": "Sakurai S, Shimizu T, Ohto U", "evidence": [ { "database": "UniProtKB", "id": "A9YTQ3", "url": "https://www.uniprot.org/uniprot/A9YTQ3" } ], "reference": [ { "type": "PubMed", "id": "28904176", "url": "https://glygen.org/publication/PubMed/28904176" } ] }, { "title": "Doxorubicin cardiotoxicity may be caused by its metabolite, doxorubicinol.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1988", "authors": "Olson RD, Mushlin PS, Brenner DE, Fleischer S, Cusack BJ, Chang BK, Boucek RJ Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-211945", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945" } ], "reference": [ { "type": "PubMed", "id": "2897122", "url": "https://glygen.org/publication/PubMed/2897122" } ] }, { "title": "Human cholesterol side-chain cleavage enzyme, P450scc: cDNA cloning, assignment of the gene to chromosome 15, and expression in the placenta.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1986", "authors": "Chung BC, Matteson KJ, Voutilainen R, Mohandas TK, Miller WL", "evidence": [ { "database": "Reactome", "id": "R-HSA-211976", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211976" } ], "reference": [ { "type": "PubMed", "id": "3024157", "url": "https://glygen.org/publication/PubMed/3024157" } ] }, { "title": "Molecular characterization of the HLA-linked steroid 21-hydroxylase B gene from an individual with congenital adrenal hyperplasia.", "journal": "The EMBO journal", "date": "1987", "authors": "Rodrigues NR, Dunham I, Yu CY, Carroll MC, Porter RR, Campbell RD", "evidence": [ { "database": "Reactome", "id": "R-HSA-211976", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211976" } ], "reference": [ { "type": "PubMed", "id": "3038528", "url": "https://glygen.org/publication/PubMed/3038528" } ] }, { "title": "Compounds with Therapeutic Potential against Novel Respiratory 2019 Coronavirus.", "journal": "Antimicrobial agents and chemotherapy", "date": "2020", "authors": "Martinez MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-211945", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945" } ], "reference": [ { "type": "PubMed", "id": "32152082", "url": "https://glygen.org/publication/PubMed/32152082" } ] }, { "title": "Arbidol combined with LPV/r versus LPV/r alone against Corona Virus Disease 2019: A retrospective cohort study.", "journal": "The Journal of infection", "date": "2020", "authors": "Deng L, Li C, Zeng Q, Liu X, Li X, Zhang H, Hong Z, Xia J", "evidence": [ { "database": "Reactome", "id": "R-HSA-211945", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945" } ], "reference": [ { "type": "PubMed", "id": "32171872", "url": "https://glygen.org/publication/PubMed/32171872" } ] }, { "title": "A Trial of Lopinavir-Ritonavir in Adults Hospitalized with Severe Covid-19.", "journal": "The New England journal of medicine", "date": "2020", "authors": "Cao B, Wang Y, Wen D, Liu W, Wang J, Fan G, Ruan L, Song B, Cai Y, Wei M, Li X, Xia J, Chen N, Xiang J, Yu T, Bai T, Xie X, Zhang L, Li C, Yuan Y, Chen H, Li H, Huang H, Tu S, Gong F, Liu Y, Wei Y, Dong C, Zhou F, Gu X, Xu J, Liu Z, Zhang Y, Li H, Shang L, Wang K, Li K, Zhou X, Dong X, Qu Z, Lu S, Hu X, Ruan S, Luo S, Wu J, Peng L, Cheng F, Pan L, Zou J, Jia C, Wang J, Liu X, Wang S, Wu X, Ge Q, He J, Zhan H, Qiu F, Guo L, Huang C, Jaki T, Hayden FG, Horby PW, Zhang D, Wang C", "evidence": [ { "database": "Reactome", "id": "R-HSA-211945", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945" } ], "reference": [ { "type": "PubMed", "id": "32187464", "url": "https://glygen.org/publication/PubMed/32187464" } ] }, { "title": "Coronavirus puts drug repurposing on the fast track.", "journal": "Nature biotechnology", "date": "2020", "authors": "Harrison C", "evidence": [ { "database": "Reactome", "id": "R-HSA-211945", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945" } ], "reference": [ { "type": "PubMed", "id": "32205870", "url": "https://glygen.org/publication/PubMed/32205870" } ] }, { "title": "Unrevealing sequence and structural features of novel coronavirus using in silico approaches: The main protease as molecular target.", "journal": "EXCLI journal", "date": "2020", "authors": "Ortega JT, Serrano ML, Pujol FH, Rangel HR", "evidence": [ { "database": "Reactome", "id": "R-HSA-211945", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945" } ], "reference": [ { "type": "PubMed", "id": "32210741", "url": "https://glygen.org/publication/PubMed/32210741" } ] }, { "title": "Structure of human steroid 21-hydroxylase genes.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1986", "authors": "White PC, New MI, Dupont B", "evidence": [ { "database": "Reactome", "id": "R-HSA-211976", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211976" } ], "reference": [ { "type": "PubMed", "id": "3487786", "url": "https://glygen.org/publication/PubMed/3487786" } ] }, { "title": "Substrate specificity of the form of cytochrome P-450 catalyzing the 4-hydroxylation of debrisoquine in man.", "journal": "Molecular pharmacology", "date": "1983", "authors": "Boobis AR, Murray S, Kahn GC, Robertz GM, Davies DS", "evidence": [ { "database": "Reactome", "id": "R-HSA-211981", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211981" } ], "reference": [ { "type": "PubMed", "id": "6220203", "url": "https://glygen.org/publication/PubMed/6220203" } ] }, { "title": "Destruction of cytochrome P-450 by ethylene. Structure of the resulting prosthetic heme adduct.", "journal": "The Journal of biological chemistry", "date": "1981", "authors": "Ortiz de Montellano PR, Beilan HS, Kunze KL, Mico BA", "evidence": [ { "database": "Reactome", "id": "R-HSA-211981", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211981" } ], "reference": [ { "type": "PubMed", "id": "7217086", "url": "https://glygen.org/publication/PubMed/7217086" } ] }, { "title": "Transcriptional regulation by lovastatin and 25-hydroxycholesterol in HepG2 cells and molecular cloning and expression of the cDNA for the human hepatic squalene synthase.", "journal": "The Journal of biological chemistry", "date": "1993", "authors": "Jiang G, McKenzie TL, Conrad DG, Shechter I", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "7685352", "url": "https://glygen.org/publication/PubMed/7685352" } ] }, { "title": "Human liver mitochondrial carnitine palmitoyltransferase I: characterization of its cDNA and chromosomal localization and partial analysis of the gene.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1995", "authors": "Britton CH, Schultz RA, Zhang B, Esser V, Foster DW, McGarry JD", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "7892212", "url": "https://glygen.org/publication/PubMed/7892212" } ] }, { "title": "Inherited amplification of an active gene in the cytochrome P450 CYP2D locus as a cause of ultrarapid metabolism of debrisoquine.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1993", "authors": "Johansson I, Lundqvist E, Bertilsson L, Dahl ML, Sjoqvist F, Ingelman-Sundberg M", "evidence": [ { "database": "Reactome", "id": "R-HSA-211981", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211981" } ], "reference": [ { "type": "PubMed", "id": "7903454", "url": "https://glygen.org/publication/PubMed/7903454" } ] }, { "title": "Dioxin binding activities of polymorphic forms of mouse and human arylhydrocarbon receptors.", "journal": "The Journal of biological chemistry", "date": "1994", "authors": "Ema M, Ohe N, Suzuki M, Mimura J, Sogawa K, Ikawa S, Fujii-Kuriyama Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-8937144", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8937144" } ], "reference": [ { "type": "PubMed", "id": "7961644", "url": "https://glygen.org/publication/PubMed/7961644" } ] }, { "title": "Purification and characterization of a human liver cocaine carboxylesterase that catalyzes the production of benzoylecgonine and the formation of cocaethylene from alcohol and cocaine.", "journal": "Biochemical pharmacology", "date": "1994", "authors": "Brzezinski MR, Abraham TL, Stone CL, Dean RA, Bosron WF", "evidence": [ { "database": "Reactome", "id": "R-HSA-211945", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945" } ], "reference": [ { "type": "PubMed", "id": "7980644", "url": "https://glygen.org/publication/PubMed/7980644" } ] }, { "title": "The ubiquitously expressed human CYP51 encodes lanosterol 14 alpha-demethylase, a cytochrome P450 whose expression is regulated by oxysterols.", "journal": "Archives of biochemistry and biophysics", "date": "1996", "authors": "Stromstedt M, Rozman D, Waterman MR", "evidence": [ { "database": "Reactome", "id": "R-HSA-211976", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211976" } ], "reference": [ { "type": "PubMed", "id": "8619637", "url": "https://glygen.org/publication/PubMed/8619637" } ] }, { "title": "A direct role for sterol regulatory element binding protein in activation of 3-hydroxy-3-methylglutaryl coenzyme A reductase gene.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Vallett SM, Sanchez HB, Rosenfeld JM, Osborne TF", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "8647822", "url": "https://glygen.org/publication/PubMed/8647822" } ] }, { "title": "Identification of residues 99, 220, and 221 of human cytochrome P450 2C19 as key determinants of omeprazole activity.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Ibeanu GC, Ghanayem BI, Linko P, Li L, Pederson LG, Goldstein JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-211981", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211981" } ], "reference": [ { "type": "PubMed", "id": "8647857", "url": "https://glygen.org/publication/PubMed/8647857" } ] }, { "title": "The kinetics of aflatoxin B1 oxidation by human cDNA-expressed and human liver microsomal cytochromes P450 1A2 and 3A4.", "journal": "Toxicology and applied pharmacology", "date": "1996", "authors": "Gallagher EP, Kunze KL, Stapleton PL, Eaton DL", "evidence": [ { "database": "Reactome", "id": "R-HSA-211981", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211981" } ], "reference": [ { "type": "PubMed", "id": "8975785", "url": "https://glygen.org/publication/PubMed/8975785" } ] }, { "title": "Cancer chemopreventive activity of resveratrol, a natural product derived from grapes.", "journal": "Science (New York, N.Y.)", "date": "1997", "authors": "Jang M, Cai L, Udeani GO, Slowing KV, Thomas CF, Beecher CW, Fong HH, Farnsworth NR, Kinghorn AD, Mehta RG, Moon RC, Pezzuto JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-211945", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945" } ], "reference": [ { "type": "PubMed", "id": "8985016", "url": "https://glygen.org/publication/PubMed/8985016" } ] }, { "title": "Molecular characterization of two mammalian bHLH-PAS domain proteins selectively expressed in the central nervous system.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1997", "authors": "Zhou YD, Barnard M, Tian H, Li X, Ring HZ, Francke U, Shelton J, Richardson J, Russell DW, McKnight SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "9012850", "url": "https://glygen.org/publication/PubMed/9012850" } ] }, { "title": "Purification and cloning of a broad substrate specificity human liver carboxylesterase that catalyzes the hydrolysis of cocaine and heroin.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Pindel EV, Kedishvili NY, Abraham TL, Brzezinski MR, Zhang J, Dean RA, Bosron WF", "evidence": [ { "database": "Reactome", "id": "R-HSA-211945", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945" } ], "reference": [ { "type": "PubMed", "id": "9169443", "url": "https://glygen.org/publication/PubMed/9169443" } ] }, { "title": "Catalytic properties of NAD(P)H:quinone oxidoreductase-2 (NQO2), a dihydronicotinamide riboside dependent oxidoreductase.", "journal": "Archives of biochemistry and biophysics", "date": "1997", "authors": "Wu K, Knox R, Sun XZ, Joseph P, Jaiswal AK, Zhang D, Deng PS, Chen S", "evidence": [ { "database": "Reactome", "id": "R-HSA-211945", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945" } ], "reference": [ { "type": "PubMed", "id": "9367528", "url": "https://glygen.org/publication/PubMed/9367528" } ] }, { "title": "Hepatitis B virus X-associated protein 2 is a subunit of the unliganded aryl hydrocarbon receptor core complex and exhibits transcriptional enhancer activity.", "journal": "Molecular and cellular biology", "date": "1998", "authors": "Meyer BK, Pray-Grant MG, Vanden Heuvel JP, Perdew GH", "evidence": [ { "database": "Reactome", "id": "R-HSA-8937144", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8937144" } ], "reference": [ { "type": "PubMed", "id": "9447995", "url": "https://glygen.org/publication/PubMed/9447995" } ] }, { "title": "A critical review of the origin and control of adrenal androgens.", "journal": "Bailliere's clinical obstetrics and gynaecology", "date": "1997", "authors": "McKenna TJ, Fearon U, Clarke D, Cunningham SK", "evidence": [ { "database": "Reactome", "id": "R-HSA-211976", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211976" } ], "reference": [ { "type": "PubMed", "id": "9536209", "url": "https://glygen.org/publication/PubMed/9536209" } ] }, { "title": "Expression of catalytically active human cytochrome p450scc in Escherichia coli and mutagenesis of isoleucine-462.", "journal": "Archives of biochemistry and biophysics", "date": "1998", "authors": "Woods ST, Sadleir J, Downs T, Triantopoulos T, Headlam MJ, Tuckey RC", "evidence": [ { "database": "Reactome", "id": "R-HSA-211976", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211976" } ], "reference": [ { "type": "PubMed", "id": "9578606", "url": "https://glygen.org/publication/PubMed/9578606" } ] }, { "title": "Steroid hydroxylation by human fetal CYP3A7 and human NADPH-cytochrome P450 reductase coexpressed in insect cells using baculovirus.", "journal": "Research communications in molecular pathology and pharmacology", "date": "1998", "authors": "Ohmori S, Fujiki N, Nakasa H, Nakamura H, Ishii I, Itahashi K, Kitada M", "evidence": [ { "database": "Reactome", "id": "R-HSA-211981", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211981" } ], "reference": [ { "type": "PubMed", "id": "9644715", "url": "https://glygen.org/publication/PubMed/9644715" } ] }, { "title": "Cloning of vascular adhesion protein 1 reveals a novel multifunctional adhesion molecule.", "journal": "The Journal of experimental medicine", "date": "1998", "authors": "Smith DJ, Salmi M, Bono P, Hellman J, Leu T, Jalkanen S", "evidence": [ { "database": "Reactome", "id": "R-HSA-211945", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945" } ], "reference": [ { "type": "PubMed", "id": "9653080", "url": "https://glygen.org/publication/PubMed/9653080" } ] }, { "title": "The nuclear receptors peroxisome proliferator-activated receptor alpha and Rev-erbalpha mediate the species-specific regulation of apolipoprotein A-I expression by fibrates.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Vu-Dac N, Chopin-Delannoy S, Gervois P, Bonnelye E, Martin G, Fruchart JC, Laudet V, Staels B", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "9748239", "url": "https://glygen.org/publication/PubMed/9748239" } ] }, { "title": "Human liver microsomal metabolism of paclitaxel and drug interactions.", "journal": "European journal of drug metabolism and pharmacokinetics", "date": "1998", "authors": "Desai PB, Duan JZ, Zhu YW, Kouzi S", "evidence": [ { "database": "Reactome", "id": "R-HSA-211981", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211981" } ], "reference": [ { "type": "PubMed", "id": "9842986", "url": "https://glygen.org/publication/PubMed/9842986" } ] } ], "pathway": [ { "id": "R-HSA-1989781", "name": "PPARA activates gene expression", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781", "resource": "Reactome", "description": "PPARA activates gene expression" }, { "id": "R-HSA-211945", "name": "Phase I - Functionalization of compounds", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945", "resource": "Reactome", "description": "Phase I - Functionalization of compounds" }, { "id": "R-HSA-211976", "name": "Endogenous sterols", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211976", "resource": "Reactome", "description": "Endogenous sterols" }, { "id": "R-HSA-211981", "name": "Xenobiotics", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211981", "resource": "Reactome", "description": "Xenobiotics" }, { "id": "R-HSA-8937144", "name": "Aryl hydrocarbon receptor signalling", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8937144", "resource": "Reactome", "description": "Aryl hydrocarbon receptor signalling" } ], "orthologs": [ { "uniprot_canonical_ac": "Q3U1U7-1", "protein_name": "Aryl hydrocarbon receptor repressor", "gene_name": "Ahrr", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MMIPSGECTYAGRKRRKPIQKRRLTMGAEKSNPSKRHRDRLNTELDHLASLLPFSPDIISKLDKLSVLRLSVSYLRVKSFFQALQETCVWSAPALSPEEHSYRGFPVQEGRLLLESLNGFALVVSAEGMIFYASATIVDYLGFHQTDVMHQNIYDYIHVDDRQDFCRQLHWAMDPPQVVFGQSPHADTDNTVLGKLLRAQEGGKGLPSEYSAFLTRCFICRVRCLLDSTSGFLTMQFQGKLKFLFGQKKKTPSGTALPPRLSLFCIVAPVLPSVTEMKMKSTFLKAKHRADIVVTMDSRAKAVTSLCESELHPKLNYLAGKSNGENGISLFRGQTDRSHWARALARSSCLCLRGGPDLLDPKGTSGDREEEDQKHILRRSPGAWGQREMHKYSYGLETPVHLRHLNWSTEQRSQESTTKLTRQPSKNEPSTCLVPHGSCVPYPGSQGMLSASNMASFRDSLDHPTGAYCSQMNRPLSDIHQGQVDPSTCHISQGSLGSRIPLTGMQRFTARGFSTEDAKLPSLPVTIGTPCNPVLSLDVPIKMENESGSQDIVEASTTSCLWLGTSDMARGHLVGFPARMHLKTEPDYRQQACTPHLGHGMLGTNPYSRDTVGSCREHAPLYSAHCTCLDPEPPHHLFMCSHSESQHPSLDQDCRAPIVKREPLDSPSWAAPGQVTVPRMFPKSASKTVIPSKGSDGIFLP", "length": 701 }, "evidence": [ { "id": "45919941", "url": "http://www.informatics.jax.org/homology/45919941", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q75NT5-1", "protein_name": "Aryl hydrocarbon receptor repressor", "gene_name": "Ahrr", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MMIPSGECTYAGRKRRKPIQKRRLTMGTEKSNPSKRHRDRLNTELDHLASLLPFSPDIISKLDKLSVLRLSVSYLRVKSFFQALQETCVWSAPALSPEDHSSRGFPVQEGRLLLESLNGFALVVSAEGMIFYASATIVDYLGFHQTDVMHQNIYDYIHVDDRQDFCRQLHWAMDPPQVVFGQSPHADTDNTVLGKLLRAQEGGKGLPSEYSAFLTRCFICRVRCLLDSTSGFLTMQFQGKLKFLFGQKKKTPSGTALPPRLSLFCIVAPVLPSVTEMKMKSAFLKAKHRADIVVTMDSRAKAVTSLCESELHPKLNYLAGRSNGENVISLFRGQTDRSHWTRALARSSCLCLRGGPDLLDPKGTSGDREEDDQKHILRRSPGARGQREMHKYSYGLETPVHLRHLDWSTEQRSQEGTTKLTRQPSKSEPSTCLVPHGSCVPYPGSQGMFSASNMASFRESLDHPTGTYCSQMNRPLPDIHQGQVDPSTCHIPQGSLGSRIPLSGMQCFTARGFSTEDAKLPSLPVNIGTPCNPVLSLEVPIKMENESGSQDIVEASTTSCVWLGTGDMTRRHLVGFPARMHLKTEPDYRQQVCTPHRGHGILGTNPHSRDTVGSCREHAPLYSAHCTCLSPEPPHHLFMCSHSESQHPSLDQDCRAPIVKREPLDSPSWAAPGHVTVPRMFPKNASITVIPSKGSDGIFLP", "length": 701 }, "evidence": [ { "id": "45919941", "url": "http://www.informatics.jax.org/homology/45919941", "database": "MGI" } ], "common_name": "Rat" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 5, "go_terms": [ { "name": "nucleoplasm", "id": "GO:0005654", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654", "evidence": [ { "database": "UniProtKB", "id": "A9YTQ3", "url": "https://www.uniprot.org/uniprot/A9YTQ3" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "A9YTQ3", "url": "https://www.uniprot.org/uniprot/A9YTQ3" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "A9YTQ3", "url": "https://www.uniprot.org/uniprot/A9YTQ3" } ], "pmid": "" }, { "name": "aryl hydrocarbon receptor complex", "id": "GO:0034751", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034751", "evidence": [ { "database": "UniProtKB", "id": "A9YTQ3", "url": "https://www.uniprot.org/uniprot/A9YTQ3" } ], "pmid": "" }, { "name": "chromatin", "id": "GO:0000785", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000785", "evidence": [ { "database": "UniProtKB", "id": "A9YTQ3", "url": "https://www.uniprot.org/uniprot/A9YTQ3" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 4, "go_terms": [ { "name": "protein dimerization activity", "id": "GO:0046983", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046983", "evidence": [ { "database": "UniProtKB", "id": "A9YTQ3", "url": "https://www.uniprot.org/uniprot/A9YTQ3" } ], "pmid": "" }, { "name": "transcription cis-regulatory region binding", "id": "GO:0000976", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000976", "evidence": [ { "database": "UniProtKB", "id": "A9YTQ3", "url": "https://www.uniprot.org/uniprot/A9YTQ3" } ], "pmid": "" }, { "name": "DNA-binding transcription factor activity, RNA polymerase II-specific", "id": "GO:0000981", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000981", "evidence": [ { "database": "UniProtKB", "id": "A9YTQ3", "url": "https://www.uniprot.org/uniprot/A9YTQ3" } ], "pmid": "" }, { "name": "nuclear receptor activity", "id": "GO:0004879", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004879", "evidence": [ { "database": "UniProtKB", "id": "A9YTQ3", "url": "https://www.uniprot.org/uniprot/A9YTQ3" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "regulation of DNA-templated transcription", "id": "GO:0006355", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006355", "evidence": [ { "database": "UniProtKB", "id": "A9YTQ3", "url": "https://www.uniprot.org/uniprot/A9YTQ3" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 324, "end_pos": 326, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 324, "end_pos": 326 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 121 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }