{ "uniprot_canonical_ac": "A8MXU0-1", "uniprot_ac": "A8MXU0", "uniprot_id": "DB108_HUMAN", "mass": { "chemical_mass": 8390.0, "monoisotopic_mass": 8390.0 }, "refseq": {}, "gene_names": [ { "name": "DEFB108A", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A8MXU0", "id": "A8MXU0" }, { "name": "DEFB108C", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A8MXU0", "id": "A8MXU0" }, { "name": "DEFB108P1", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/A8MXU0", "id": "A8MXU0" }, { "name": "DEFB108P2", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/A8MXU0", "id": "A8MXU0" } ], "protein_names": [ { "name": "Putative beta-defensin 108A", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "A8MXU0" }, { "name": "Defensin, beta 108A", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "A8MXU0" }, { "name": "Defensin, beta 108C", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "A8MXU0" }, { "name": "Putative beta-defensin 108B pseudogene 1/2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "A8MXU0" } ], "function": [ { "annotation": "Has antibacterial activity.", "evidence": [ { "database": "UniProtKB", "id": "A8MXU0", "url": "https://www.uniprot.org/uniprot/A8MXU0#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "A8MXU0", "url": "https://www.uniprot.org/uniprot/A8MXU0" } ], "common_name": "Human" } ], "gene": [ { "name": "DEFB108C", "url": "https://www.uniprot.org/uniprot/A8MXU0", "locus": { "chromosome": "8", "start_pos": 7377500, "end_pos": 7373114, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000215371", "url": "https://www.ensembl.org/id/ENSG00000215371" } ] } } ], "crossref": [ { "id": "DEFB108A", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=DEFB108A", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "DEFB108C", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=DEFB108C", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "18089", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=18089", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "30847", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=30847", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "IPR025933", "url": "https://www.ebi.ac.uk/interpro/entry/IPR025933", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "NX_A8MXU0", "url": "https://www.nextprot.org/entry/NX_A8MXU0", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "5174659at2759", "url": "http://www.orthodb.org/?query=5174659at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PF13841", "url": "http://pfam.xfam.org/family/PF13841", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "A8MXU0", "url": "https://pharos.nih.gov/targets/A8MXU0", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_A8MXU0", "url": "http://purl.obolibrary.org/obo/PR_A8MXU0", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-1461957", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1461957", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "A0AA34QVJ0", "url": "https://www.uniprot.org/uniprot/A0AA34QVJ0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0AA34QVJ0-1", "url": "https://www.uniprot.org/uniprot/A0AA34QVJ0-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A8MXU0", "url": "https://www.uniprot.org/uniprot/A8MXU0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A8MXU0-1", "url": "https://www.uniprot.org/uniprot/A8MXU0-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MRIAVLFFTIFFFMSQVLPAKGKFKEICERPNGSCRDFCLETEIHVGRCLNSRPCCLPLGHQPRIESTTPKKD", "length": 73, "header": "sp|A8MXU0-1|DB108_HUMAN Isoform 1 of Putative beta-defensin 108A OS=Homo sapiens OX=9606 GN=DEFB108C PE=5 SV=2 CANONICAL=A8MXU0-1" }, "isoforms": [ { "isoform_ac": "A0AA34QVJ0-1", "url": "", "sequence": { "sequence": "MKPNFFLSSAMRIAVLFFTIFFFMSQVLPAKGKFKEICERPNGSCRDFCLETEIHVGRCLNSRPCCLPLGHQPRIESTTPKKD", "length": 83, "header": "tr|A0AA34QVJ0-1|DB108_HUMAN Computationally mapped isoform of Putative beta-defensin 108A OS=Homo sapiens OX=9606 GN=DEFB108C PE=5 SV=1 CANONICAL=A8MXU0-1" }, "locus": {} }, { "isoform_ac": "A8MXU0-1", "url": "", "sequence": { "sequence": "MRIAVLFFTIFFFMSQVLPAKGKFKEICERPNGSCRDFCLETEIHVGRCLNSRPCCLPLGHQPRIESTTPKKD", "length": 73, "header": "sp|A8MXU0-1|DB108_HUMAN Isoform 1 of Putative beta-defensin 108A OS=Homo sapiens OX=9606 GN=DEFB108C PE=5 SV=2 CANONICAL=A8MXU0-1" }, "locus": {} } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "Beta-defensins: linking innate and adaptive immunity through dendritic and T cell CCR6.", "journal": "Science (New York, N.Y.)", "date": "1999", "authors": "Yang D, Chertov O, Bykovskaia SN, Chen Q, Buffo MJ, Shogan J, Anderson M, Schroder JM, Wang JM, Howard OM, Oppenheim JJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-1461957", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1461957" } ], "reference": [ { "type": "PubMed", "id": "10521347", "url": "https://glygen.org/publication/PubMed/10521347" } ] }, { "title": "Human neutrophil defensins selectively chemoattract naive T and immature dendritic cells.", "journal": "Journal of leukocyte biology", "date": "2000", "authors": "Yang D, Chen Q, Chertov O, Oppenheim JJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-1461957", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1461957" } ], "reference": [ { "type": "PubMed", "id": "10914484", "url": "https://glygen.org/publication/PubMed/10914484" } ] }, { "title": "Isolation and characterization of human beta -defensin-3, a novel human inducible peptide antibiotic.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Harder J, Bartels J, Christophers E, Schroder JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-1461957", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1461957" } ], "reference": [ { "type": "PubMed", "id": "11085990", "url": "https://glygen.org/publication/PubMed/11085990" } ] }, { "title": "Identification of a novel, multifunctional beta-defensin (human beta-defensin 3) with specific antimicrobial activity. Its interaction with plasma membranes of Xenopus oocytes and the induction of macrophage chemoattraction.", "journal": "Cell and tissue research", "date": "2001", "authors": "Garcia JR, Jaumann F, Schulz S, Krause A, Rodriguez-Jimenez J, Forssmann U, Adermann K, Kluver E, Vogelmeier C, Becker D, Hedrich R, Forssmann WG, Bals R", "evidence": [ { "database": "Reactome", "id": "R-HSA-1461957", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1461957" } ], "reference": [ { "type": "PubMed", "id": "11702237", "url": "https://glygen.org/publication/PubMed/11702237" } ] }, { "title": "Epithelial cell-derived human beta-defensin-2 acts as a chemotaxin for mast cells through a pertussis toxin-sensitive and phospholipase C-dependent pathway.", "journal": "International immunology", "date": "2002", "authors": "Niyonsaba F, Iwabuchi K, Matsuda H, Ogawa H, Nagaoka I", "evidence": [ { "database": "Reactome", "id": "R-HSA-1461957", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1461957" } ], "reference": [ { "type": "PubMed", "id": "11934878", "url": "https://glygen.org/publication/PubMed/11934878" } ] }, { "title": "Duplication and selection in the evolution of primate beta-defensin genes.", "journal": "Genome Biol.", "date": "2003", "authors": "Semple CA, Rolfe M, Dorin JR", "evidence": [ { "database": "UniProtKB", "id": "A8MXU0", "url": "https://www.uniprot.org/uniprot/A8MXU0" } ], "reference": [ { "type": "PubMed", "id": "12734011", "url": "https://glygen.org/publication/PubMed/12734011" } ] }, { "title": "Human -defensin-3 activates professional antigen-presenting cells via Toll-like receptors 1 and 2.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2007", "authors": "Funderburg N, Lederman MM, Feng Z, Drage MG, Jadlowsky J, Harding CV, Weinberg A, Sieg SF", "evidence": [ { "database": "Reactome", "id": "R-HSA-1461957", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1461957" } ], "reference": [ { "type": "PubMed", "id": "18006661", "url": "https://glygen.org/publication/PubMed/18006661" } ] }, { "title": "Human beta-defensin 2 and 3 and their mouse orthologs induce chemotaxis through interaction with CCR2.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2010", "authors": "Rohrl J, Yang D, Oppenheim JJ, Hehlgans T", "evidence": [ { "database": "Reactome", "id": "R-HSA-1461957", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1461957" } ], "reference": [ { "type": "PubMed", "id": "20483750", "url": "https://glygen.org/publication/PubMed/20483750" } ] }, { "title": "Tissue-specific human beta-defensins (HBD)1, HBD2, and HBD3 secretion from human extra-placental membranes stimulated with Escherichia coli.", "journal": "Reproductive biology and endocrinology : RB&E", "date": "2010", "authors": "Garcia-Lopez G, Flores-Espinosa P, Zaga-Clavellina V", "evidence": [ { "database": "Reactome", "id": "R-HSA-1461957", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1461957" } ], "reference": [ { "type": "PubMed", "id": "21122132", "url": "https://glygen.org/publication/PubMed/21122132" } ] }, { "title": "Human beta-defensin-1: an antimicrobial peptide of urogenital tissues.", "journal": "The Journal of clinical investigation", "date": "1998", "authors": "Valore EV, Park CH, Quayle AJ, Wiles KR, McCray PB Jr, Ganz T", "evidence": [ { "database": "Reactome", "id": "R-HSA-1461957", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1461957" } ], "reference": [ { "type": "PubMed", "id": "9541493", "url": "https://glygen.org/publication/PubMed/9541493" } ] } ], "pathway": [ { "id": "R-HSA-1461957", "name": "Beta defensins", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1461957", "resource": "Reactome", "description": "Beta defensins" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "extracellular region", "id": "GO:0005576", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576", "evidence": [ { "database": "UniProtKB", "id": "A8MXU0", "url": "https://www.uniprot.org/uniprot/A8MXU0" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 2, "go_terms": [ { "name": "innate immune response", "id": "GO:0045087", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045087", "evidence": [ { "database": "UniProtKB", "id": "A8MXU0", "url": "https://www.uniprot.org/uniprot/A8MXU0" } ], "pmid": "" }, { "name": "defense response to bacterium", "id": "GO:0042742", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042742", "evidence": [ { "database": "UniProtKB", "id": "A8MXU0", "url": "https://www.uniprot.org/uniprot/A8MXU0" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 32, "end_pos": 34, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 32, "end_pos": 34 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 10 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }