{ "uniprot_canonical_ac": "A8MXQ7-1", "uniprot_ac": "A8MXQ7", "uniprot_id": "IQAK1_HUMAN", "mass": { "chemical_mass": 63562.0, "monoisotopic_mass": 63562.0 }, "refseq": {}, "gene_names": [ { "name": "IQANK1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A8MXQ7", "id": "A8MXQ7" } ], "protein_names": [ { "name": "IQ motif and ankyrin repeat domain-containing protein 1", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "A8MXQ7" } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "A8MXQ7", "url": "https://www.uniprot.org/uniprot/A8MXQ7" } ], "common_name": "Human" } ], "gene": [ { "name": "IQANK1", "url": "https://www.uniprot.org/uniprot/A8MXQ7", "locus": { "chromosome": "8", "start_pos": 143790645, "end_pos": 143734139, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000203499", "url": "https://www.ensembl.org/id/ENSG00000203499" } ] } } ], "crossref": [ { "id": "ENSG00000203499", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000203499", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "IQANK1", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=IQANK1", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "49576", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=49576", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "A8MXQ7", "url": "https://www.ebi.ac.uk/intact/interactors/id:A8MXQ7*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR000048", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000048", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR002110", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002110", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR027417", "url": "https://www.ebi.ac.uk/interpro/entry/IPR027417", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036770", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036770", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "618942", "url": "http://www.omim.org/entry/618942", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_A8MXQ7", "url": "https://www.nextprot.org/entry/NX_A8MXQ7", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "A8MXQ7", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=A8MXQ7", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "ISEHDRC", "url": "https://omabrowser.org/oma/group/ISEHDRC/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "316480at2759", "url": "http://www.orthodb.org/?query=316480at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR24189", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24189", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR24189:SF57", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24189:SF57", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00023", "url": "http://pfam.xfam.org/family/PF00023", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "A8MXQ7", "url": "https://pharos.nih.gov/targets/A8MXQ7", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_A8MXQ7", "url": "http://purl.obolibrary.org/obo/PR_A8MXQ7", "database": "PRO", "categories": [ "Protein" ] }, { "id": "A0A1B0GUK7", "url": "https://www.uniprot.org/uniprot/A0A1B0GUK7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1B0GUK7-1", "url": "https://www.uniprot.org/uniprot/A0A1B0GUK7-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A8MXQ7", "url": "https://www.uniprot.org/uniprot/A8MXQ7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A8MXQ7-1", "url": "https://www.uniprot.org/uniprot/A8MXQ7-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MDSKKGRPKAAAGKWQTLHPGPKTRAAAGKPGENRPPQRKAGWQAREPASAESPQAPTGPAEDRAARAIQGAFRQLRARRELARRREERREYLEQMETPQKEAYLAPVRREQEAARRLREQEEAAQRERREELQRRRRLLDAAFDGDVGEIRAVLKEVEQLLTREGVGHDEAGEARRLQRRVALAECEDSYGNTPLSEAAAGGQPLAIQLRAELGASPNSKGAFGPTPLYRAAFGGHLAAVEVLLKLGADPRVYAEDGSTPERVASLDTVVSVLRSWDLSLTEAMLQNMEAEQQRRAQEAQRHKEAEAERCGSMTLKVQQLTREQQQCHKELQQAYCELSRRISEHDQCEWRCMDKTKLTLQAIKDTEAQVDRLRQEAQKAEEALAMARLELREQTQEGEEEAPGLKCQVTELHDVLMKDVGNRIRADGRWPLVIDPLGQAATFLRYQDTNYVDTVNPEPLRPETMWLALLGALRYGKPLVFDLREEDLFPVVQRQLEAVQERYLSLLRPTDGPEYSPTQFQEQRLEHFRLFFVTKVQWPPAEQLQVLLPVRVQLPGTGL", "length": 560, "header": "sp|A8MXQ7-1|IQAK1_HUMAN Isoform 1 of IQ motif and ankyrin repeat domain-containing protein 1 OS=Homo sapiens OX=9606 GN=IQANK1 PE=4 SV=3 CANONICAL=A8MXQ7-1" }, "isoforms": [ { "isoform_ac": "A0A1B0GUK7-1", "url": "", "sequence": { "sequence": "MDSKKGRPKAAAGKWQTLHPGPKTRAAAGKPGENRPPQRKAGWQAREPASAESPQAPTDGVSLCCQAGVHWGLAHCYLRLPGSGNSPASAS", "length": 91, "header": "tr|A0A1B0GUK7-1|IQAK1_HUMAN Computationally mapped isoform of IQ motif and ankyrin repeat domain-containing protein 1 OS=Homo sapiens OX=9606 GN=IQANK1 PE=4 SV=1 CANONICAL=A8MXQ7-1" }, "locus": { "chromosome": "8", "start_pos": 143743957, "end_pos": 143735854, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000533004.5", "url": "https://www.ensembl.org/id/ENST00000533004.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000490151.1", "url": "https://www.ensembl.org/id/ENSP00000490151.1" } ] } }, { "isoform_ac": "A8MXQ7-1", "url": "", "sequence": { "sequence": "MDSKKGRPKAAAGKWQTLHPGPKTRAAAGKPGENRPPQRKAGWQAREPASAESPQAPTGPAEDRAARAIQGAFRQLRARRELARRREERREYLEQMETPQKEAYLAPVRREQEAARRLREQEEAAQRERREELQRRRRLLDAAFDGDVGEIRAVLKEVEQLLTREGVGHDEAGEARRLQRRVALAECEDSYGNTPLSEAAAGGQPLAIQLRAELGASPNSKGAFGPTPLYRAAFGGHLAAVEVLLKLGADPRVYAEDGSTPERVASLDTVVSVLRSWDLSLTEAMLQNMEAEQQRRAQEAQRHKEAEAERCGSMTLKVQQLTREQQQCHKELQQAYCELSRRISEHDQCEWRCMDKTKLTLQAIKDTEAQVDRLRQEAQKAEEALAMARLELREQTQEGEEEAPGLKCQVTELHDVLMKDVGNRIRADGRWPLVIDPLGQAATFLRYQDTNYVDTVNPEPLRPETMWLALLGALRYGKPLVFDLREEDLFPVVQRQLEAVQERYLSLLRPTDGPEYSPTQFQEQRLEHFRLFFVTKVQWPPAEQLQVLLPVRVQLPGTGL", "length": 560, "header": "sp|A8MXQ7-1|IQAK1_HUMAN Isoform 1 of IQ motif and ankyrin repeat domain-containing protein 1 OS=Homo sapiens OX=9606 GN=IQANK1 PE=4 SV=3 CANONICAL=A8MXQ7-1" }, "locus": { "chromosome": "8", "start_pos": 143790605, "end_pos": 143735854, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000527139.7", "url": "https://www.ensembl.org/id/ENST00000527139.7" }, { "database": "Ensembl Peptide", "id": "ENSP00000489685.1", "url": "https://www.ensembl.org/id/ENSP00000489685.1" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "evidence": [ { "id": "A8MXQ7", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=A8MXQ7" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" } ] } ], "phosphorylation": [], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "A triarylphosphine-trimethylpiperidine reagent for the one-step derivatization and enrichment of protein post-translational modifications and identification by mass spectrometry.", "journal": "Chemical communications (Cambridge, England)", "date": "2018", "authors": "Huo B, Zhang W, Zhao X, Dong H, Yu Y, Wang J, Qian X, Qin W", "evidence": [ { "database": "O-GlcNAc Database", "id": "A8MXQ7", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=A8MXQ7" } ], "reference": [ { "type": "PubMed", "id": "30379171", "url": "https://glygen.org/publication/PubMed/30379171" } ] } ], "pathway": [], "orthologs": [ { "uniprot_canonical_ac": "A0A8I5ZZ17-1", "protein_name": "IQ motif and ankyrin repeat containing 1", "gene_name": "Iqank1", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MSTKKGGPKGTAKGQASLSGSKLRAAAGNPRDSQQLHRKASGPGKESFSENTKAPAAPTREDKAAIVIQCALRRYLARKEMARRWQERQEYLDEMEKLQRAAYLALVRQEQEAARKQREKEEAEERARREELQRRRRLLEAAFEGDLGEIRQVLKEVEQLMTREGVGYDEDGKARRLQRRVATVECEDSHGNTPLSEAAAGGQVPAIQLLAELGANPNSKGAFGRTPLYRAAFGGHLEAVEVLLKNGADPRVYADDGSTPEQVASLAAVVSVLQSWDLSLTEAMLQNMEAEQQRRAQEAQRHKEKEAKRITVKVQQLAKEQQKCQKELQQAYCELNRRIMEHDKCERKGLGKTELTLEAIRDAETQVDKLRLEAQKAEETLAMARLELREQTLEDEEVTEPGLKCRIAELHDVLMKDVGDRIRADGRWPLVIDPSGQAATFLRYQDTNYMDTLNPEHLKPERIRLALLGALRYGKPLVFDLREVNLFAVVQQQLEEVQPGLAEALLNRGLLAKEGYLSLLRPTDGPEYDPSQFQEARLENFRLFFVTKVQWPPADQLQILLPVRVQLQSGGF", "length": 572 }, "evidence": [ { "id": "A8MXQ7", "url": "https://omabrowser.org/oma/group/A8MXQ7/", "database": "OMA" } ], "common_name": "Rat" } ], "go_annotation": {}, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }