{ "uniprot_canonical_ac": "A8MUU9-1", "uniprot_ac": "A8MUU9", "uniprot_id": "YV023_HUMAN", "mass": { "chemical_mass": 55306.0, "monoisotopic_mass": 55306.0 }, "refseq": {}, "gene_names": [], "protein_names": [ { "name": "Putative uncharacterized protein ENSP00000383309", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "A8MUU9" } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "A8MUU9", "url": "https://www.uniprot.org/uniprot/A8MUU9" } ], "common_name": "Human" } ], "gene": [ { "name": "", "url": "https://www.uniprot.org/uniprot/A8MUU9", "locus": {} } ], "crossref": [ { "id": "NX_A8MUU9", "url": "https://www.nextprot.org/entry/NX_A8MUU9", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "A8MUU9", "url": "https://oglcnac.org/atlas/detail/A8MUU9", "database": "O-GlcNAc Atlas", "categories": [ "Glycoproteomics" ] }, { "id": "A8MUU9", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=A8MUU9", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "PTHR35683", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR35683", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR35683:SF7", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR35683:SF7", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "A8MUU9", "url": "https://pharos.nih.gov/targets/A8MUU9", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "A8MUU9", "url": "https://www.uniprot.org/uniprot/A8MUU9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A8MUU9-1", "url": "https://www.uniprot.org/uniprot/A8MUU9-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MPPTASLTRSPPTASQTRTLPRASRTRTPPRASLTRSPPTASLRRTPSRASRTRTPPRASLKRTPSRASLTRTLSRASLTRLKSRASHTRTPSRASLTRTPPTASRTRSLPRASRTRTPPRTSQRRMPPRTSQTRTPPRASLRRTPSRASRTRTPPRASLRRTPSRASLTRTPSRASLTRLKSRASHTRTPSRASLTRTPPTASLTRASRTRTPPRTSQTRTPPRASLRRTPSRASLTRTPSRASLTRTPSRASLTRLKSRASHTRTPSRASLTRTPPTASLTRTPPTASLTRTPPRASLTRSPPRASLTRTPPTASLTRSPPTASLTRTPPRASLTRSPPRASLTRTPSTASLTRTPSRASLTRSKSRASHTRTPSRASLTRTPPRASLTRTPPRASLTRSPPTASLTRMPPTASLTRSPPRASLTRTPPRASLTRSPSTASLTRTPPGTWLRRTPPRTSLTRTPPTASLTRTPYTASLTRTPYTASLMRMPYMTSLMTPYKAR", "length": 505, "header": "sp|A8MUU9-1|YV023_HUMAN Isoform 1 of Putative uncharacterized protein ENSP00000383309 OS=Homo sapiens OX=9606 GN= PE=5 SV=3 CANONICAL=A8MUU9-1" }, "isoforms": [ { "isoform_ac": "A8MUU9-1", "url": "", "sequence": { "sequence": "MPPTASLTRSPPTASQTRTLPRASRTRTPPRASLTRSPPTASLRRTPSRASRTRTPPRASLKRTPSRASLTRTLSRASLTRLKSRASHTRTPSRASLTRTPPTASRTRSLPRASRTRTPPRTSQRRMPPRTSQTRTPPRASLRRTPSRASRTRTPPRASLRRTPSRASLTRTPSRASLTRLKSRASHTRTPSRASLTRTPPTASLTRASRTRTPPRTSQTRTPPRASLRRTPSRASLTRTPSRASLTRTPSRASLTRLKSRASHTRTPSRASLTRTPPTASLTRTPPTASLTRTPPRASLTRSPPRASLTRTPPTASLTRSPPTASLTRTPPRASLTRSPPRASLTRTPSTASLTRTPSRASLTRSKSRASHTRTPSRASLTRTPPRASLTRTPPRASLTRSPPTASLTRMPPTASLTRSPPRASLTRTPPRASLTRSPSTASLTRTPPGTWLRRTPPRTSLTRTPPTASLTRTPYTASLTRTPYTASLMRMPYMTSLMTPYKAR", "length": 505, "header": "sp|A8MUU9-1|YV023_HUMAN Isoform 1 of Putative uncharacterized protein ENSP00000383309 OS=Homo sapiens OX=9606 GN= PE=5 SV=3 CANONICAL=A8MUU9-1" }, "locus": {} } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 17, "start_aa": "Thr", "end_pos": 17, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr17", "evidence": [ { "id": "A8MUU9", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=A8MUU9" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "28411811", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28411811" }, { "id": "A8MUU9", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/A8MUU9" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 96, "start_aa": "Ser", "end_pos": 96, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser96", "evidence": [ { "id": "A8MUU9", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=A8MUU9" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "28411811", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28411811" }, { "id": "A8MUU9", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/A8MUU9" } ] } ], "phosphorylation": [], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "A novel strategy for global mapping of O-GlcNAc proteins and peptides using selective enzymatic deglycosylation, HILIC enrichment and mass spectrometry identification.", "journal": "Talanta", "date": "2017", "authors": "Shen B, Zhang W, Shi Z, Tian F, Deng Y, Sun C, Wang G, Qin W, Qian X", "evidence": [ { "database": "O-GlcNAc Database", "id": "A8MUU9", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=A8MUU9" } ], "reference": [ { "type": "PubMed", "id": "28411811", "url": "https://glygen.org/publication/PubMed/28411811" } ] }, { "title": "A triarylphosphine-trimethylpiperidine reagent for the one-step derivatization and enrichment of protein post-translational modifications and identification by mass spectrometry.", "journal": "Chemical communications (Cambridge, England)", "date": "2018", "authors": "Huo B, Zhang W, Zhao X, Dong H, Yu Y, Wang J, Qian X, Qin W", "evidence": [ { "database": "O-GlcNAc Database", "id": "A8MUU9", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=A8MUU9" }, { "database": "O-GlcNAc Atlas", "id": "A8MUU9", "url": "https://oglcnac.org/atlas/detail/A8MUU9" } ], "reference": [ { "type": "PubMed", "id": "30379171", "url": "https://glygen.org/publication/PubMed/30379171" } ] } ], "pathway": [], "orthologs": [], "go_annotation": {}, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [ 17, 96 ], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 2 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 2 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }