{ "uniprot_canonical_ac": "A8MTY7-1", "uniprot_ac": "A8MTY7", "uniprot_id": "KRA97_HUMAN", "mass": { "chemical_mass": 17793.0, "monoisotopic_mass": 17793.0 }, "refseq": { "ac": "NP_001264261", "name": "keratin-associated protein 9-7", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001264261" }, "gene_names": [ { "name": "KRTAP9-7", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A8MTY7", "id": "A8MTY7" }, { "name": "KAP9.7; KRTAP9L1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001264261", "id": "NP_001264261" }, { "name": "KAP9.7", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/A8MTY7", "id": "A8MTY7" }, { "name": "KRTAP9-7", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001264261", "id": "NP_001264261" }, { "name": "KRTAP9.7", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/A8MTY7", "id": "A8MTY7" }, { "name": "KRTAP9L1", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/A8MTY7", "id": "A8MTY7" } ], "protein_names": [ { "name": "Keratin-associated protein 9-7", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "A8MTY7" }, { "name": "Keratin-associated protein 9-like 1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "A8MTY7" }, { "name": "keratin associated protein 9-like 1; putative keratin-associated protein 9-2-like 1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001264261", "id": "NP_001264261" }, { "name": "keratin-associated protein 9-7", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001264261", "id": "NP_001264261" } ], "function": [ { "annotation": "In the hair cortex, hair keratin intermediate filaments are embedded in an interfilamentous matrix, consisting of hair keratin-associated proteins (KRTAP), which are essential for the formation of a rigid and resistant hair shaft through their extensive disulfide bond cross-linking with abundant cysteine residues of hair keratins. The matrix proteins include the high-sulfur and high-glycine-tyrosine keratins (By similarity).", "evidence": [ { "database": "UniProtKB", "id": "A8MTY7", "url": "https://www.uniprot.org/uniprot/A8MTY7#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "18.51", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000180386", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000180386" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "16.41", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000180386", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000180386" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "17.43", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000180386", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000180386" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "16.94", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000180386", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000180386" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "23.1", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000180386", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000180386" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "16.63", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000180386", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000180386" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "16.88", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000180386", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000180386" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "22.74", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000180386", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000180386" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "23.49", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000180386", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000180386" } ] } ], "expression_disease": [], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "A8MTY7", "url": "https://www.uniprot.org/uniprot/A8MTY7" } ], "common_name": "Human" } ], "gene": [ { "name": "KRTAP9-7", "url": "https://www.uniprot.org/uniprot/A8MTY7", "locus": { "chromosome": "17", "start_pos": 41276207, "end_pos": 41275698, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000180386", "url": "https://www.ensembl.org/id/ENSG00000180386" } ] } } ], "crossref": [ { "id": "ENSG00000180386", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000180386", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "KRTAP9-7", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=KRTAP9-7", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "100505724", "url": "https://www.ncbi.nlm.nih.gov/gene/100505724", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "18915", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=18915", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "IPR002494", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002494", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:100505724", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:100505724", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "NX_A8MTY7", "url": "https://www.nextprot.org/entry/NX_A8MTY7", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "CCSETCC", "url": "https://omabrowser.org/oma/group/CCSETCC/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "PF13885", "url": "http://pfam.xfam.org/family/PF13885", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "A8MTY7", "url": "https://pharos.nih.gov/targets/A8MTY7", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_A8MTY7", "url": "http://purl.obolibrary.org/obo/PR_A8MTY7", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-6805567", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6805567", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001264261", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001264261", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A8MTY7", "url": "https://www.uniprot.org/uniprot/A8MTY7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A8MTY7-1", "url": "https://www.uniprot.org/uniprot/A8MTY7-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MTHCCSPCCQPTCCRTTCWKPTTVTTCSSTPCCQPSCCVSSCCQPCCHPTCCQNTCCRTTCCQPTCVTSCCQPSCCSTPCCQPICCGSSCCGQTSCGSSCCQPSSCAPIYCRRTCYHPTSVYLPGCLNQSCGSSCCQPCCRPACCETTCCRTTCFQPTCVTSCCQPACC", "length": 169, "header": "sp|A8MTY7-1|KRA97_HUMAN Isoform 1 of Keratin-associated protein 9-7 OS=Homo sapiens OX=9606 GN=KRTAP9-7 PE=3 SV=1 CANONICAL=A8MTY7-1" }, "isoforms": [ { "isoform_ac": "A8MTY7-1", "url": "", "sequence": { "sequence": "MTHCCSPCCQPTCCRTTCWKPTTVTTCSSTPCCQPSCCVSSCCQPCCHPTCCQNTCCRTTCCQPTCVTSCCQPSCCSTPCCQPICCGSSCCGQTSCGSSCCQPSSCAPIYCRRTCYHPTSVYLPGCLNQSCGSSCCQPCCRPACCETTCCRTTCFQPTCVTSCCQPACC", "length": 169, "header": "sp|A8MTY7-1|KRA97_HUMAN Isoform 1 of Keratin-associated protein 9-7 OS=Homo sapiens OX=9606 GN=KRTAP9-7 PE=3 SV=1 CANONICAL=A8MTY7-1" }, "locus": { "chromosome": "HSCHR17_6_CTG4", "start_pos": 31412, "end_pos": 30906, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000573531.1", "url": "https://www.ensembl.org/id/ENST00000573531.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000460369.1", "url": "https://www.ensembl.org/id/ENSP00000460369.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "Stratum corneum keratin structure, function, and formation: the cubic rod-packing and membrane templating model.", "journal": "The Journal of investigative dermatology", "date": "2004", "authors": "Norlen L, Al-Amoudi A", "evidence": [ { "database": "Reactome", "id": "R-HSA-6805567", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6805567" } ], "reference": [ { "type": "PubMed", "id": "15373777", "url": "https://glygen.org/publication/PubMed/15373777" } ] }, { "title": "Human hair keratin-associated proteins.", "journal": "The journal of investigative dermatology. Symposium proceedings", "date": "2005", "authors": "Shimomura Y, Ito M", "evidence": [ { "database": "Reactome", "id": "R-HSA-6805567", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6805567" } ], "reference": [ { "type": "PubMed", "id": "16382671", "url": "https://glygen.org/publication/PubMed/16382671" } ] }, { "title": "Differential extraction of keratin subunits and filaments from normal human epidermis.", "journal": "The Journal of cell biology", "date": "1990", "authors": "Eichner R, Kahn M", "evidence": [ { "database": "Reactome", "id": "R-HSA-6805567", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6805567" } ], "reference": [ { "type": "PubMed", "id": "1691188", "url": "https://glygen.org/publication/PubMed/1691188" } ] }, { "title": "Elucidating the early stages of keratin filament assembly.", "journal": "The Journal of cell biology", "date": "1990", "authors": "Coulombe PA, Fuchs E", "evidence": [ { "database": "Reactome", "id": "R-HSA-6805567", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6805567" } ], "reference": [ { "type": "PubMed", "id": "1694855", "url": "https://glygen.org/publication/PubMed/1694855" } ] }, { "title": "Structure and biochemistry of mammalian hard keratin.", "journal": "Electron microscopy reviews", "date": "1991", "authors": "Marshall RC, Orwin DF, Gillespie JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-6805567", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6805567" } ], "reference": [ { "type": "PubMed", "id": "1714783", "url": "https://glygen.org/publication/PubMed/1714783" } ] }, { "title": "Towards a molecular description of intermediate filament structure and assembly.", "journal": "Experimental cell research", "date": "2007", "authors": "Parry DA, Strelkov SV, Burkhard P, Aebi U, Herrmann H", "evidence": [ { "database": "Reactome", "id": "R-HSA-6805567", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6805567" } ], "reference": [ { "type": "PubMed", "id": "17521629", "url": "https://glygen.org/publication/PubMed/17521629" } ] }, { "title": "Structure, function, and regulation of desmosomes.", "journal": "Progress in molecular biology and translational science", "date": "2013", "authors": "Kowalczyk AP, Green KJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-6805567", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6805567" } ], "reference": [ { "type": "PubMed", "id": "23481192", "url": "https://glygen.org/publication/PubMed/23481192" } ] }, { "title": "Pair formation and promiscuity of cytokeratins: formation in vitro of heterotypic complexes and intermediate-sized filaments by homologous and heterologous recombinations of purified polypeptides.", "journal": "The Journal of cell biology", "date": "1985", "authors": "Hatzfeld M, Franke WW", "evidence": [ { "database": "Reactome", "id": "R-HSA-6805567", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6805567" } ], "reference": [ { "type": "PubMed", "id": "2414304", "url": "https://glygen.org/publication/PubMed/2414304" } ] }, { "title": "Mammalian keratin associated proteins (KRTAPs) subgenomes: disentangling hair diversity and adaptation to terrestrial and aquatic environments.", "journal": "BMC genomics", "date": "2014", "authors": "Khan I, Maldonado E, Vasconcelos V, O'Brien SJ, Johnson WE, Antunes A", "evidence": [ { "database": "Reactome", "id": "R-HSA-6805567", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6805567" } ], "reference": [ { "type": "PubMed", "id": "25208914", "url": "https://glygen.org/publication/PubMed/25208914" } ] }, { "title": "Intermediate filament structure: hard alpha-keratin.", "journal": "Biophysical chemistry", "date": "1997", "authors": "Jones LN, Simon M, Watts NR, Booy FP, Steven AC, Parry DA", "evidence": [ { "database": "Reactome", "id": "R-HSA-6805567", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6805567" } ], "reference": [ { "type": "PubMed", "id": "9468612", "url": "https://glygen.org/publication/PubMed/9468612" } ] } ], "pathway": [ { "id": "hsa:100505724", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:100505724", "resource": "KEGG Pathway" }, { "id": "R-HSA-6805567", "name": "Keratinization", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6805567", "resource": "Reactome", "description": "Keratinization" } ], "orthologs": [ { "uniprot_canonical_ac": "A2A4M2-1", "protein_name": "Predicted gene 11568", "gene_name": "Gm11568", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MTNSCCSPCCQPTCCRTTCCRTTCWRPSCVTSCCQPCCQPSCCGSSCCQPCCQTTCCRTCFQPCCVSSCCRTPCCQPCCCVSSCCQPCCQPSCCQSSCCQPSCCQPSCCQSSCCQPSCCQSSCCQPRCCISSCCQPRCCISSCCQPCCRPSCCQSSCCKPCCQPFCLNLCCQPACSGPVTCTRTCYQPTCVCVPGCLSQGCGSSCCEPCGC", "length": 211 }, "evidence": [ { "id": "45934391", "url": "http://www.informatics.jax.org/homology/45934391", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "A8MVA2-1", "protein_name": "Keratin-associated protein 9-6", "gene_name": "KRTAP9-6", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MTHCCSPGCQPTCCRTTCCRTTCWQPTIVTTCSSTPCCQPSCCVSSCCQPYCHPTCCQNTCCRTTCCQPTCVTSCCQPSCCSTPCYQPICCGSSCCGQTSCGSSCGQSSSCAPVYCRRTCYHPTTVCLPGCLNQSCGSSCCQPCYCPACCVSSCCQHSCC", "length": 160 }, "evidence": [ { "id": "45934393", "url": "http://www.informatics.jax.org/homology/45934393", "database": "MGI" }, { "id": "45934395", "url": "http://www.informatics.jax.org/homology/45934395", "database": "MGI" }, { "id": "45934394", "url": "http://www.informatics.jax.org/homology/45934394", "database": "MGI" }, { "id": "45934391", "url": "http://www.informatics.jax.org/homology/45934391", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "A8MXZ3-1", "protein_name": "Keratin-associated protein 9-1", "gene_name": "KRTAP9-1", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MTHCCSPCCQPTCCRTTCCRTTCWKPTTVTTCSSTPCCQPSCCVPSCCQPCCHPTCCQNTCCRTTCCQPTCVASCCQPSCCSTPCCQPTCCGSSCCGQTSCGSSCCQPICGSSCCQPCCHPTCYQTICFRTTCCQPTCCQPTCCRNTSCQPTCCGSSCCQPCCHPTCCQTICRSTCCQPSCVTRCCSTPCCQPTCGGSSCCSQTCNESSYCLPCCRPTCCQTTCYRTTCCRPSCCCSPCCVSSCCQPSCC", "length": 250 }, "evidence": [ { "id": "45934391", "url": "http://www.informatics.jax.org/homology/45934391", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q64526-1", "protein_name": "Keratin associated protein 9-1", "gene_name": "Krtap9-1", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MTNSCCSPCCQPTCCRTTCCRTTCWRPSCVTSCCQPCCQPSCCGSSCCQPCCQTTCCRTCFQPCCVSSCCRTPCCQPCCCVSSCCQPCCQPSCCQSSCCQPRCCESSCCQPRCCISSCCQPCCRPSCCQSSCCRPCCQPFCLNLCCQPACSGPVTCTRTCYQPTCVCVPGCLSQGCGSSCCEPCGC", "length": 186 }, "evidence": [ { "id": "45934394", "url": "http://www.informatics.jax.org/homology/45934394", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q9BYP9-1", "protein_name": "Keratin-associated protein 9-9", "gene_name": "KRTAP9-9", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MTHCCSPCCQPTCCRTTCCRTTCWKPTTVTTCSSTPCCQPSCCVSSCCQPCCRPACCQNTCCRTTCCQPTCLSSCCGQTSCGSSCGQSSSCAPVYCRRTCYYPTTVCLPGCLNQSCGSSCCQPCCRPACCETTCCRTTCFQPTCVSSCCQPSCC", "length": 154 }, "evidence": [ { "id": "45934393", "url": "http://www.informatics.jax.org/homology/45934393", "database": "MGI" }, { "id": "45934395", "url": "http://www.informatics.jax.org/homology/45934395", "database": "MGI" }, { "id": "45934394", "url": "http://www.informatics.jax.org/homology/45934394", "database": "MGI" }, { "id": "45934391", "url": "http://www.informatics.jax.org/homology/45934391", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q9BYQ0-1", "protein_name": "Keratin-associated protein 9-8", "gene_name": "KRTAP9-8", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MTHCCSPCCQPTCCRTTCWKPTTVTTCSSTPCCQPSCCVSSCCQPCCRPTCCQNTCCQPICVTSCCQPSCCSTPCCQPTCCGQTSCGSSCGQSSSCAPVYCRRTCYHPTTVCLPGCLNQSCGSNCCQPCCRPACCETTCCRTTCFQPTCVSSCCQPSCC", "length": 159 }, "evidence": [ { "id": "45934393", "url": "http://www.informatics.jax.org/homology/45934393", "database": "MGI" }, { "id": "45934394", "url": "http://www.informatics.jax.org/homology/45934394", "database": "MGI" }, { "id": "45934391", "url": "http://www.informatics.jax.org/homology/45934391", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q9BYQ2-1", "protein_name": "Keratin-associated protein 9-4", "gene_name": "KRTAP9-4", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MTHCCSPCCQPTCCRTTCCRTTCWKPTTVTTCSSTPCCQPSCCVSSCCQPCCRPTCCQNTCCQPTCVTSCCQPSCCSTPCCQPTCCGSSCDQSSSCAPVYCRRTCYYPTTVCLPGCLNQSCGSNCCQPCCRPACCETTCFQPTCVSSCCQPFCC", "length": 154 }, "evidence": [ { "id": "45934393", "url": "http://www.informatics.jax.org/homology/45934393", "database": "MGI" }, { "id": "45934394", "url": "http://www.informatics.jax.org/homology/45934394", "database": "MGI" }, { "id": "45934391", "url": "http://www.informatics.jax.org/homology/45934391", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q9BYQ3-1", "protein_name": "Keratin-associated protein 9-3", "gene_name": "KRTAP9-3", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MTHCCSPCCQPTCCRTTCWQPTTVTTCSSTPCCQPSCCVSSCCQPCCHPTCCQNTCCRTTCCQPICVTSCCQPSCCSTPCCQPTCCGSSCGQSSSCAPVYCRRTCYHPTSVCLPGCLNQSCGSNCCQPCCRPACCETTCCRTTCFQPTCVYSCCQPSCC", "length": 159 }, "evidence": [ { "id": "45934393", "url": "http://www.informatics.jax.org/homology/45934393", "database": "MGI" }, { "id": "45934395", "url": "http://www.informatics.jax.org/homology/45934395", "database": "MGI" }, { "id": "45934394", "url": "http://www.informatics.jax.org/homology/45934394", "database": "MGI" }, { "id": "45934391", "url": "http://www.informatics.jax.org/homology/45934391", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q9BYQ4-1", "protein_name": "Keratin-associated protein 9-2", "gene_name": "KRTAP9-2", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MTHCCSPCCQPTCCRTTCCRTTCWKPTTVTTCSSTPCCQPACCVSSCCQPCCRPTCCQNTCCRTTCCQPTCVTSCCQPSCCSTPCCQPTCCGSSCCGQTSCGSSCGQSSSCAPVYCRRTCYYPTTVCLPGCLNQSCGSNCCQPCCRPACCETTCCRTTCFQPTCVSSCCQPSCC", "length": 174 }, "evidence": [ { "id": "45934393", "url": "http://www.informatics.jax.org/homology/45934393", "database": "MGI" }, { "id": "45934395", "url": "http://www.informatics.jax.org/homology/45934395", "database": "MGI" }, { "id": "45934394", "url": "http://www.informatics.jax.org/homology/45934394", "database": "MGI" }, { "id": "45934391", "url": "http://www.informatics.jax.org/homology/45934391", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q9D141-1", "protein_name": "Predicted gene 11567", "gene_name": "Gm11567", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MTNSCCSPCCQPTCCRTTCCRTTCWRPSCVTSCCQPCCQPSCCGSSCCQPCCQTTCCRTCFQPCCVSSCCRTPCCQPCCCVSSCCQPCCQPSCCQSSCCQPSCCQSSCCQPSCCQSSCCQPRCCISSCCQPCCRPSCCQSSCCKPCCQPFCLNLCCQPACSGPVTCTRTCYQPTCVCVPGCLSQGCGSNCSQSCC", "length": 195 }, "evidence": [ { "id": "45934395", "url": "http://www.informatics.jax.org/homology/45934395", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q9D3H7-1", "protein_name": "Predicted gene 11559", "gene_name": "Gm11559", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MTNSCCSPCCQPTCCRTTCCRTTCWRPSCVTSCCQPCCQPSCCGSSCCQPCCQTTCCRTCFQPCCVSSCCRTPCCQPCCCVSSCCQPCCQPSCCQSSCCQPSCCQPSCCQPSCCQPRCCISSCCQPCCRPSCCQSSCCKPCCQPFCLNLCCQPACSGPVTCTRTCYQPTCVCVPGCLSQGCGSSCCEPCGC", "length": 191 }, "evidence": [ { "id": "45934393", "url": "http://www.informatics.jax.org/homology/45934393", "database": "MGI" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "A8MTY7", "url": "https://www.uniprot.org/uniprot/A8MTY7" } ], "pmid": "" }, { "name": "keratin filament", "id": "GO:0045095", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045095", "evidence": [ { "database": "UniProtKB", "id": "A8MTY7", "url": "https://www.uniprot.org/uniprot/A8MTY7" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 128, "end_pos": 130, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.mgi", "label": "MGI Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 128, "end_pos": 130 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 10 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }