{ "uniprot_canonical_ac": "A8MT69-1", "uniprot_ac": "A8MT69", "uniprot_id": "CENPX_HUMAN", "mass": { "chemical_mass": 8959.0, "monoisotopic_mass": 8959.0 }, "refseq": { "ac": "NP_001257935", "name": "centromere protein X isoform 1", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001257935" }, "gene_names": [ { "name": "CENPX", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A8MT69", "id": "A8MT69" }, { "name": "CENP-X; D9; FAAP10; MHF2; STRA13", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001257935", "id": "NP_001257935" }, { "name": "CENPX", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001257935", "id": "NP_001257935" }, { "name": "FAAP10", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/A8MT69", "id": "A8MT69" }, { "name": "MHF2", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/A8MT69", "id": "A8MT69" }, { "name": "STRA13", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/A8MT69", "id": "A8MT69" } ], "protein_names": [ { "name": "Centromere protein X", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "A8MT69" }, { "name": "CENP-X", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "A8MT69" }, { "name": "FANCM-associated histone fold protein 2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "A8MT69" }, { "name": "FANCM-interacting histone fold protein 2; Fanconi anemia-associated polypeptide of 10 kDa; stimulated by retinoic acid 13 homolog; retinoic acid-inducible gene D9 protein homolog; stimulated by retinoic acid gene 13 protein homolog; FANCM associated histone fold protein 2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001257935", "id": "NP_001257935" }, { "name": "FANCM-interacting histone fold protein 2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "A8MT69" }, { "name": "Fanconi anemia-associated polypeptide of 10 kDa", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "A8MT69" }, { "name": "Retinoic acid-inducible gene D9 protein homolog", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "A8MT69" }, { "name": "Stimulated by retinoic acid gene 13 protein homolog", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "A8MT69" }, { "name": "centromere protein X isoform 1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001257935", "id": "NP_001257935" } ], "function": [ { "annotation": "CENPX assembly in living human cells, revealing a window in S phase and G2 in which de novo assembly of the complex from a soluble precursor occurs through a dynamic exchange mechanism. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_001257935", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001257935" }, { "database": "PubMed", "id": "24522885", "url": "https://glygen.org/publication/PubMed/24522885" } ] }, { "annotation": "DNA-binding component of the Fanconi anemia (FA) core complex. Required for the normal activation of the FA pathway, leading to monoubiquitination of the FANCI-FANCD2 complex in response to DNA damage, cellular resistance to DNA cross-linking drugs, and prevention of chromosomal breakage (PubMed:20347428, PubMed:20347429). In complex with CENPS (MHF heterodimer), crucial cofactor for FANCM in both binding and ATP-dependent remodeling of DNA. Stabilizes FANCM. In complex with CENPS and FANCM (but not other FANC proteins), rapidly recruited to blocked forks and promotes gene conversion at blocked replication forks (PubMed:20347428, PubMed:20347429). In complex with CENPS, CENPT and CENPW (CENP-T-W-S-X heterotetramer), involved in the formation of a functional kinetochore outer plate, which is essential for kinetochore-microtubule attachment and faithful mitotic progression (PubMed:19620631). As a component of MHF and CENP-T-W-S-X complexes, binds DNA and bends it to form a nucleosome-like structure (PubMed:20347428, PubMed:20347429). DNA-binding function is fulfilled in the presence of CENPS, with the following preference for DNA substates: Holliday junction > double-stranded > splay arm > single-stranded. Does not bind DNA on its own (PubMed:20347429).", "evidence": [ { "database": "UniProtKB", "id": "A8MT69", "url": "https://www.uniprot.org/uniprot/A8MT69#function" }, { "database": "PubMed", "id": "20347429", "url": "https://glygen.org/publication/PubMed/20347429" }, { "database": "PubMed", "id": "20347428", "url": "https://glygen.org/publication/PubMed/20347428" }, { "database": "PubMed", "id": "19620631", "url": "https://glygen.org/publication/PubMed/19620631" } ] }, { "annotation": "Identification of human and mouse homologs of clone D9 of a murine promyelocyte cell line that was upregulated by retinoic acid.", "evidence": [ { "database": "RefSeq", "id": "NP_001257935", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001257935" }, { "database": "PubMed", "id": "8839844", "url": "https://glygen.org/publication/PubMed/8839844" } ] }, { "annotation": "MHF prefers branched DNA over dsDNA because it engages two duplex arms. MHF engages DNA forks or various four-way junctions independent of the junction-site structure. The DNA-binding interface of MHF is important for cellular resistance to DNA damage.", "evidence": [ { "database": "RefSeq", "id": "NP_001257935", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001257935" }, { "database": "PubMed", "id": "24390579", "url": "https://glygen.org/publication/PubMed/24390579" } ] }, { "annotation": "Provide biochemical evidence that MHF1 and MHF2 assemble into a heterodimer that binds DNA and enhances the DNA branch migration activity of FANCM.", "evidence": [ { "database": "RefSeq", "id": "NP_001257935", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001257935" }, { "database": "PubMed", "id": "20347429", "url": "https://glygen.org/publication/PubMed/20347429" } ] }, { "annotation": "Results identified a centromere protein S (CENP-S)-containing subcomplex that includes the new constitutive kinetochore protein CENP-X [Stra13]", "evidence": [ { "database": "RefSeq", "id": "NP_001257935", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001257935" }, { "database": "PubMed", "id": "19620631", "url": "https://glygen.org/publication/PubMed/19620631" } ] }, { "annotation": "The MHF complex, which is a heterotetramer that comprises two MHF1-MHF2 heterodimers, is remodeled by FANCM to favor recognition of branched DNA over dsDNA.", "evidence": [ { "database": "RefSeq", "id": "NP_001257935", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001257935" }, { "database": "PubMed", "id": "24699063", "url": "https://glygen.org/publication/PubMed/24699063" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [ { "significant": "Yes", "trend": "up", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "A8MT69", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A8MT69" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "No", "trend": "down", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "A8MT69", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A8MT69" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "A8MT69", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A8MT69" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "A8MT69", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A8MT69" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "A8MT69", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A8MT69" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "A8MT69", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A8MT69" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "A8MT69", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A8MT69" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "A8MT69", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A8MT69" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "A8MT69", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A8MT69" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "A8MT69", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A8MT69" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "A8MT69", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A8MT69" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "A8MT69", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A8MT69" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "A8MT69", "url": "https://www.uniprot.org/uniprot/A8MT69" } ], "common_name": "Human" } ], "gene": [ { "name": "CENPX", "url": "https://www.uniprot.org/uniprot/A8MT69", "locus": { "chromosome": "17", "start_pos": 82018702, "end_pos": 82024107, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000169689", "url": "https://www.ensembl.org/id/ENSG00000169689" } ] } } ], "crossref": [ { "id": "ENSG00000169689", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000169689", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "CENPX", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=CENPX", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "201254", "url": "https://www.ncbi.nlm.nih.gov/gene/201254", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "11422", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=11422", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "A8MT69", "url": "https://www.ebi.ac.uk/intact/interactors/id:A8MT69*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR018552", "url": "https://www.ebi.ac.uk/interpro/entry/IPR018552", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:201254", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:201254", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "615128", "url": "http://www.omim.org/entry/615128", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_A8MT69", "url": "https://www.nextprot.org/entry/NX_A8MT69", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "A8MT69", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=A8MT69", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "CSSFKED", "url": "https://omabrowser.org/oma/group/CSSFKED/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "3181181at2759", "url": "http://www.orthodb.org/?query=3181181at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR28680", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR28680", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR28680:SF1", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR28680:SF1", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "4DRA", "url": "https://www.rcsb.org/structure/4DRA", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4DRB", "url": "https://www.rcsb.org/structure/4DRB", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4E44", "url": "https://www.rcsb.org/structure/4E44", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4E45", "url": "https://www.rcsb.org/structure/4E45", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4NDY", "url": "https://www.rcsb.org/structure/4NDY", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4NE1", "url": "https://www.rcsb.org/structure/4NE1", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4NE3", "url": "https://www.rcsb.org/structure/4NE3", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4NE5", "url": "https://www.rcsb.org/structure/4NE5", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4NE6", "url": "https://www.rcsb.org/structure/4NE6", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7R5S", "url": "https://www.rcsb.org/structure/7R5S", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7XHN", "url": "https://www.rcsb.org/structure/7XHN", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7XHO", "url": "https://www.rcsb.org/structure/7XHO", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7YWX", "url": "https://www.rcsb.org/structure/7YWX", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF09415", "url": "http://pfam.xfam.org/family/PF09415", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "A8MT69", "url": "https://pharos.nih.gov/targets/A8MT69", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_A8MT69", "url": "http://purl.obolibrary.org/obo/PR_A8MT69", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-606279", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-606279", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-6783310", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783310", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001257935", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001257935", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A8MT69", "url": "https://www.uniprot.org/uniprot/A8MT69", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A8MT69-1", "url": "https://www.uniprot.org/uniprot/A8MT69-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A8MT69-2", "url": "https://www.uniprot.org/uniprot/A8MT69-2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A8MT69-3", "url": "https://www.uniprot.org/uniprot/A8MT69-3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "J3QR01", "url": "https://www.uniprot.org/uniprot/J3QR01", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "J3QR01-1", "url": "https://www.uniprot.org/uniprot/J3QR01-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "J3QR35", "url": "https://www.uniprot.org/uniprot/J3QR35", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "J3QR35-1", "url": "https://www.uniprot.org/uniprot/J3QR35-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "J3QRS1", "url": "https://www.uniprot.org/uniprot/J3QRS1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "J3QRS1-1", "url": "https://www.uniprot.org/uniprot/J3QRS1-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MEGAGAGSGFRKELVSRLLHLHFKDDKTKVSGDALQLMVELLKVFVVEAAVRGVRQAQAEDALRVDVDQLEKVLPQLLLDF", "length": 81, "header": "sp|A8MT69-1|CENPX_HUMAN Isoform 1 of Centromere protein X OS=Homo sapiens OX=9606 GN=CENPX PE=1 SV=1 CANONICAL=A8MT69-1" }, "isoforms": [ { "isoform_ac": "A8MT69-1", "url": "", "sequence": { "sequence": "MEGAGAGSGFRKELVSRLLHLHFKDDKTKVSGDALQLMVELLKVFVVEAAVRGVRQAQAEDALRVDVDQLEKVLPQLLLDF", "length": 81, "header": "sp|A8MT69-1|CENPX_HUMAN Isoform 1 of Centromere protein X OS=Homo sapiens OX=9606 GN=CENPX PE=1 SV=1 CANONICAL=A8MT69-1" }, "locus": { "chromosome": "17", "start_pos": 82022861, "end_pos": 82019208, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000392359.8", "url": "https://www.ensembl.org/id/ENST00000392359.8" }, { "database": "Ensembl Peptide", "id": "ENSP00000376168.3", "url": "https://www.ensembl.org/id/ENSP00000376168.3" } ] } }, { "isoform_ac": "A8MT69-2", "url": "", "sequence": { "sequence": "MEGAGAGSGFRKELVSRLLHLHFKDDKTKEAAVRGVRQAQAEDALRVDVDQLEKVLPQLLLDF", "length": 63, "header": "sp|A8MT69-2|CENPX_HUMAN Isoform 2 of Centromere protein X OS=Homo sapiens OX=9606 GN=CENPX PE=1 SV=1 CANONICAL=A8MT69-1" }, "locus": { "chromosome": "17", "start_pos": 82022861, "end_pos": 82019208, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000306704.10", "url": "https://www.ensembl.org/id/ENST00000306704.10" }, { "database": "Ensembl Peptide", "id": "ENSP00000302951.6", "url": "https://www.ensembl.org/id/ENSP00000302951.6" } ] } }, { "isoform_ac": "A8MT69-3", "url": "", "sequence": { "sequence": "MEGAGAGSGFRKELVSRLLHLHFKDDKTKEAAVRGVRQAQAEDALRVDVDQLEKLLDF", "length": 58, "header": "sp|A8MT69-3|CENPX_HUMAN Isoform 3 of Centromere protein X OS=Homo sapiens OX=9606 GN=CENPX PE=1 SV=1 CANONICAL=A8MT69-1" }, "locus": { "chromosome": "17", "start_pos": 82022861, "end_pos": 82019208, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000580435.5", "url": "https://www.ensembl.org/id/ENST00000580435.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000462015.1", "url": "https://www.ensembl.org/id/ENSP00000462015.1" } ] } }, { "isoform_ac": "J3QR01-1", "url": "", "sequence": { "sequence": "EGAGAGSGFRKELVSRLLHLHFKDDKTKVSGDALQLMVELLKVFVVEAAVRGVRQAQAEDALRVDVDQLEKLLDF", "length": 75, "header": "tr|J3QR01-1|J3QR01_HUMAN Computationally mapped isoform of Centromere protein X OS=Homo sapiens OX=9606 GN=CENPX PE=1 SV=1 CANONICAL=A8MT69-1" }, "locus": { "chromosome": "17", "start_pos": 82022858, "end_pos": 82019208, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000584600.5", "url": "https://www.ensembl.org/id/ENST00000584600.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000463974.1", "url": "https://www.ensembl.org/id/ENSP00000463974.1" } ] } }, { "isoform_ac": "J3QR35-1", "url": "", "sequence": { "sequence": "XPLPGTKPALHAGNQELVSRLLHLHFKDDKTKEAAVRGVRQAQAEDALRVDVDQLEKVLPQLLLDF", "length": 66, "header": "tr|J3QR35-1|J3QR35_HUMAN Computationally mapped isoform of Centromere protein X OS=Homo sapiens OX=9606 GN=CENPX PE=1 SV=1 CANONICAL=A8MT69-1" }, "locus": { "chromosome": "17", "start_pos": 82024107, "end_pos": 82019206, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000579520.5", "url": "https://www.ensembl.org/id/ENST00000579520.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000464024.1", "url": "https://www.ensembl.org/id/ENSP00000464024.1" } ] } }, { "isoform_ac": "J3QRS1-1", "url": "", "sequence": { "sequence": "MEGAGAGSGFRKELVSRLLHLHFKDDKTKVSGDALQLMVELLKVFVVGEPRAHAPSGHSIRNFAFFQRENQDVFSRFPQGPKLGSPEPVCQKQQSAACGRPRQKTRSVWTWTSWRRCFRSCSWTSRDLSRG", "length": 131, "header": "tr|J3QRS1-1|J3QRS1_HUMAN Computationally mapped isoform of Centromere protein X OS=Homo sapiens OX=9606 GN=CENPX PE=1 SV=1 CANONICAL=A8MT69-1" }, "locus": { "chromosome": "17", "start_pos": 82022861, "end_pos": 82019189, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000584347.1", "url": "https://www.ensembl.org/id/ENST00000584347.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000464357.1", "url": "https://www.ensembl.org/id/ENSP00000464357.1" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "evidence": [ { "id": "A8MT69", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=A8MT69" }, { "id": "29485866", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29485866" } ] } ], "phosphorylation": [], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "Double-stranded-RNA-activated protein kinase PKR enhances transcriptional activation by tumor suppressor p53.", "journal": "Molecular and cellular biology", "date": "1999-04", "authors": "Cuddihy A R, Li S, Tam N W, Wong A H, Taya Y, Abraham N, Bell J C, Koromilas A E", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "10082513", "url": "https://glygen.org/publication/PubMed/10082513" } ] }, { "title": "The double-stranded RNA activated protein kinase PKR physically associates with the tumor suppressor p53 protein and phosphorylates human p53 on serine 392 in vitro.", "journal": "Oncogene", "date": "1999", "authors": "Cuddihy AR, Wong AH, Tam NW, Li S, Koromilas AE", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "10348343", "url": "https://glygen.org/publication/PubMed/10348343" } ] }, { "title": "DRBP76, a double-stranded RNA-binding nuclear protein, is phosphorylated by the interferon-induced protein kinase, PKR.", "journal": "The Journal of biological chemistry", "date": "1999-07-16", "authors": "Patel R C, Vestal D J, Xu Z, Bandyopadhyay S, Guo W, Erme S M, Williams B R, Sen G C", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "10400669", "url": "https://glygen.org/publication/PubMed/10400669" } ] }, { "title": "HIV-I TAT inhibits PKR activity by both RNA-dependent and RNA-independent mechanisms.", "journal": "Archives of biochemistry and biophysics", "date": "2000-01-15", "authors": "Cai R, Carpick B, Chun R F, Jeang K T, Williams B R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "10620360", "url": "https://glygen.org/publication/PubMed/10620360" } ] }, { "title": "JNK2 and IKKbeta are required for activating the innate response to viral infection.", "journal": "Immunity", "date": "1999-12", "authors": "Chu W M, Ostertag D, Li Z W, Chang L, Chen Y, Hu Y, Williams B, Perrault J, Karin M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "10626894", "url": "https://glygen.org/publication/PubMed/10626894" } ] }, { "title": "NF-kappaB activation by double-stranded-RNA-activated protein kinase (PKR) is mediated through NF-kappaB-inducing kinase and IkappaB kinase.", "journal": "Molecular and cellular biology", "date": "2000-02", "authors": "Zamanian-Daryoush M, Mogensen T H, DiDonato J A, Williams B R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "10648614", "url": "https://glygen.org/publication/PubMed/10648614" } ] }, { "title": "PKR stimulates NF-kappaB irrespective of its kinase function by interacting with the IkappaB kinase complex.", "journal": "Molecular and cellular biology", "date": "2000-07", "authors": "Bonnet M C, Weil R, Dam E, Hovanessian A G, Meurs E F", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "10848580", "url": "https://glygen.org/publication/PubMed/10848580" } ] }, { "title": "The B56alpha regulatory subunit of protein phosphatase 2A is a target for regulation by double-stranded RNA-dependent protein kinase PKR.", "journal": "Molecular and cellular biology", "date": "2000", "authors": "Xu Z, Williams BR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "10866685", "url": "https://glygen.org/publication/PubMed/10866685" } ] }, { "title": "A Role of RNA Helicase A in cis-Acting Transactivation Response Element-mediated Transcriptional Regulation of Human Immunodeficiency Virus Type 1.", "journal": "The Journal of biological chemistry", "date": "2001-02-23", "authors": "Fujii R, Okamoto M, Aratani S, Oishi T, Ohshima T, Taira K, Baba M, Fukamizu A, Nakajima T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "11096080", "url": "https://glygen.org/publication/PubMed/11096080" } ] }, { "title": "Functional characterization of and cooperation between the double-stranded RNA-binding motifs of the protein kinase PKR.", "journal": "The Journal of biological chemistry", "date": "2001-03-30", "authors": "Tian B, Mathews M B", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "11134010", "url": "https://glygen.org/publication/PubMed/11134010" } ] }, { "title": "Hepatitis C virus envelope protein E2 does not inhibit PKR by simple competition with autophosphorylation sites in the RNA-binding domain.", "journal": "Journal of virology", "date": "2001", "authors": "Taylor DR, Tian B, Romano PR, Hinnebusch AG, Lai MM, Mathews MB", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "11152499", "url": "https://glygen.org/publication/PubMed/11152499" } ] }, { "title": "Identification of the interferon-inducible double-stranded RNA-dependent protein kinase as a regulator of cellular response to bulky adducts.", "journal": "Cancer research", "date": "2000-12-15", "authors": "Bergeron J, Benlimame N, Zeng-Rong N, Xiao D, Scrivens P J, Koromilas A E, Alaoui-Jamali M A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "11156368", "url": "https://glygen.org/publication/PubMed/11156368" } ] }, { "title": "Role of double-stranded RNA-dependent protein kinase in mediating hypersensitivity of Fanconi anemia complementation group C cells to interferon gamma, tumor necrosis factor-alpha, and double-stranded RNA.", "journal": "Blood", "date": "2001-03-15", "authors": "Pang Q, Keeble W, Diaz J, Christianson T A, Fagerlie S, Rathbun K, Faulkner G R, O'Dwyer M, Bagby G C", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "11238103", "url": "https://glygen.org/publication/PubMed/11238103" } ] }, { "title": "Modular structure of PACT: distinct domains for binding and activating PKR.", "journal": "Molecular and cellular biology", "date": "2001-03", "authors": "Peters G A, Hartmann R, Qin J, Sen G C", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "11238927", "url": "https://glygen.org/publication/PubMed/11238927" } ] }, { "title": "Interaction of the Fanconi anemia proteins and BRCA1 in a common pathway.", "journal": "Molecular cell", "date": "2001", "authors": "Garcia-Higuera I, Taniguchi T, Ganesan S, Meyn MS, Timmers C, Hejna J, Grompe M, D'Andrea AD", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783310", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783310" } ], "reference": [ { "type": "PubMed", "id": "11239454", "url": "https://glygen.org/publication/PubMed/11239454" } ] }, { "title": "Enhanced antiviral and antiproliferative properties of a STAT1 mutant unable to interact with the protein kinase PKR.", "journal": "The Journal of biological chemistry", "date": "2001-04-27", "authors": "Wong A H, Durbin J E, Li S, Dever T E, Decker T, Koromilas A E", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "11278865", "url": "https://glygen.org/publication/PubMed/11278865" } ] }, { "title": "The catalytic activity of dsRNA-dependent protein kinase, PKR, is required for NF-kappaB activation.", "journal": "Oncogene", "date": "2001-01-18", "authors": "Gil J, Rullas J, Garc\u00eda M A, Alcam\u00ed J, Esteban M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "11313968", "url": "https://glygen.org/publication/PubMed/11313968" } ] }, { "title": "Binding of double-stranded RNA to protein kinase PKR is required for dimerization and promotes critical autophosphorylation events in the activation loop.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Zhang F, Romano PR, Nagamura-Inoue T, Tian B, Dever TE, Mathews MB, Ozato K, Hinnebusch AG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "11337501", "url": "https://glygen.org/publication/PubMed/11337501" } ] }, { "title": "Protein kinase PKR is required for platelet-derived growth factor signaling of c-fos gene expression via Erks and Stat3.", "journal": "The EMBO journal", "date": "2001", "authors": "Deb A, Zamanian-Daryoush M, Xu Z, Kadereit S, Williams BR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "11350938", "url": "https://glygen.org/publication/PubMed/11350938" } ] }, { "title": "Nuclear factor 90 is a substrate and regulator of the eukaryotic initiation factor 2 kinase double-stranded RNA-activated protein kinase.", "journal": "The Journal of biological chemistry", "date": "2001-08-31", "authors": "Parker L M, Fierro-Monti I, Mathews M B", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "11438540", "url": "https://glygen.org/publication/PubMed/11438540" } ] }, { "title": "FANCC interacts with Hsp70 to protect hematopoietic cells from IFN-gamma/TNF-alpha-mediated cytotoxicity.", "journal": "The EMBO journal", "date": "2001-08-15", "authors": "Pang Q, Keeble W, Christianson T A, Faulkner G R, Bagby G C", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "11500375", "url": "https://glygen.org/publication/PubMed/11500375" } ] }, { "title": "Double-stranded RNA-dependent protein kinase, PKR, down-regulates CDC2/cyclin B1 and induces apoptosis in non-transformed but not in v-mos transformed cells.", "journal": "Oncogene", "date": "2001-12-06", "authors": "Dagon Y, Dovrat S, Vilchik S, Hacohen D, Shlomo G, Sredni B, Salzberg S, Nir U", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "11781817", "url": "https://glygen.org/publication/PubMed/11781817" } ] }, { "title": "Gene-specific regulation by general translation factors.", "journal": "Cell", "date": "2002-02-22", "authors": "Dever Thomas E", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "11909525", "url": "https://glygen.org/publication/PubMed/11909525" } ] }, { "title": "Inactivation of the PKR protein kinase and stimulation of mRNA translation by the cellular co-chaperone P58(IPK) does not require J domain function.", "journal": "Biochemistry", "date": "2002-04-16", "authors": "Yan Wei, Gale Michael J, Tan Seng-Lai, Katze Michael G", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "11939789", "url": "https://glygen.org/publication/PubMed/11939789" } ] }, { "title": "The C-terminal, third conserved motif of the protein activator PACT plays an essential role in the activation of double-stranded-RNA-dependent protein kinase (PKR).", "journal": "The Biochemical journal", "date": "2002-08-15", "authors": "Huang Xu, Hutchins Brian, Patel Rekha C", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "11985496", "url": "https://glygen.org/publication/PubMed/11985496" } ] }, { "title": "Contribution of double-stranded RNA-activated protein kinase toward antiproliferative actions of heparin on vascular smooth muscle cells.", "journal": "Arteriosclerosis, thrombosis, and vascular biology", "date": "2002-09-01", "authors": "Patel Rekha C, Handy Indhira, Patel Chandrashekhar V", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "12231563", "url": "https://glygen.org/publication/PubMed/12231563" } ] }, { "title": "The anti-apoptotic function of Hsp70 in the interferon-inducible double-stranded RNA-dependent protein kinase-mediated death signaling pathway requires the Fanconi anemia protein, FANCC.", "journal": "The Journal of biological chemistry", "date": "2002-12-20", "authors": "Pang Qishen, Christianson Tracy A, Keeble Winifred, Koretsky Tara, Bagby Grover C", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "12397061", "url": "https://glygen.org/publication/PubMed/12397061" } ] }, { "title": "Nucleophosmin interacts with and inhibits the catalytic function of eukaryotic initiation factor 2 kinase PKR.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Pang Q, Christianson TA, Koretsky T, Carlson H, David L, Keeble W, Faulkner GR, Speckhart A, Bagby GC", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "12882984", "url": "https://glygen.org/publication/PubMed/12882984" } ] }, { "title": "Identification of the double-stranded RNA-binding domain of the human interferon-inducible protein kinase.", "journal": "The Journal of biological chemistry", "date": "1992-04-15", "authors": "Patel R C, Sen G C", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "1373135", "url": "https://glygen.org/publication/PubMed/1373135" } ] }, { "title": "The carboxy-terminal, M3 motifs of PACT and TRBP have opposite effects on PKR activity.", "journal": "Virology", "date": "2003-10-25", "authors": "Gupta Vishal, Huang Xu, Patel Rekha C", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "14585331", "url": "https://glygen.org/publication/PubMed/14585331" } ] }, { "title": "Protein kinase R (PKR) interacts with and activates mitogen-activated protein kinase kinase 6 (MKK6) in response to double-stranded RNA stimulation.", "journal": "The Journal of biological chemistry", "date": "2004-09-03", "authors": "Silva Arist\u00f3bolo M, Whitmore Mark, Xu Zan, Jiang Zhengfan, Li Xiaoxia, Williams Bryan R G", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "15229216", "url": "https://glygen.org/publication/PubMed/15229216" } ] }, { "title": "The Fanconi anemia proteins functionally interact with the protein kinase regulated by RNA (PKR).", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Zhang X, Li J, Sejas DP, Rathbun KR, Bagby GC, Pang Q", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "15299030", "url": "https://glygen.org/publication/PubMed/15299030" } ] }, { "title": "Mis16 and Mis18 are required for CENP-A loading and histone deacetylation at centromeres.", "journal": "Cell", "date": "2004", "authors": "Hayashi T, Fujita Y, Iwasaki O, Adachi Y, Takahashi K, Yanagida M", "evidence": [ { "database": "Reactome", "id": "R-HSA-606279", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-606279" } ], "reference": [ { "type": "PubMed", "id": "15369671", "url": "https://glygen.org/publication/PubMed/15369671" } ] }, { "title": "DNA cross-link repair protein SNM1A interacts with PIAS1 in nuclear focus formation.", "journal": "Molecular and cellular biology", "date": "2004", "authors": "Ishiai M, Kimura M, Namikoshi K, Yamazoe M, Yamamoto K, Arakawa H, Agematsu K, Matsushita N, Takeda S, Buerstedde JM, Takata M", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783310", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783310" } ], "reference": [ { "type": "PubMed", "id": "15572677", "url": "https://glygen.org/publication/PubMed/15572677" } ] }, { "title": "Phosphorylation of HIV Tat by PKR increases interaction with TAR RNA and enhances transcription.", "journal": "Virology journal", "date": "2005-02-28", "authors": "Endo-Munoz Liliana, Warby Tammra, Harrich David, McMillan Nigel A J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "15737233", "url": "https://glygen.org/publication/PubMed/15737233" } ] }, { "title": "Identification of the heparin-binding domains of the interferon-induced protein kinase, PKR.", "journal": "The FEBS journal", "date": "2005-03", "authors": "Fasciano Stephen, Hutchins Brian, Handy Indhira, Patel Rekha C", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "15752359", "url": "https://glygen.org/publication/PubMed/15752359" } ] }, { "title": "Mechanisms for HIV Tat upregulation of IL-10 and other cytokine expression: kinase signaling and PKR-mediated immune response.", "journal": "FEBS letters", "date": "2005-06-06", "authors": "Li James C B, Lee Davy C W, Cheung Benny K W, Lau Allan S Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "15907845", "url": "https://glygen.org/publication/PubMed/15907845" } ] }, { "title": "Higher-order substrate recognition of eIF2alpha by the RNA-dependent protein kinase PKR.", "journal": "Cell", "date": "2005", "authors": "Dar AC, Dever TE, Sicheri F", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "16179258", "url": "https://glygen.org/publication/PubMed/16179258" } ] }, { "title": "Mechanistic link between PKR dimerization, autophosphorylation, and eIF2alpha substrate recognition.", "journal": "Cell", "date": "2005", "authors": "Dey M, Cao C, Dar AC, Tamura T, Ozato K, Sicheri F, Dever TE", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "16179259", "url": "https://glygen.org/publication/PubMed/16179259" } ] }, { "title": "Tyrosine phosphorylation acts as a molecular switch to full-scale activation of the eIF2alpha RNA-dependent protein kinase.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2006", "authors": "Su Q, Wang S, Baltzis D, Qu LK, Wong AH, Koromilas AE", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "16373505", "url": "https://glygen.org/publication/PubMed/16373505" } ] }, { "title": "The catalytic activity of the eukaryotic initiation factor-2alpha kinase PKR is required to negatively regulate Stat1 and Stat3 via activation of the T-cell protein-tyrosine phosphatase.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Wang S, Raven JF, Baltzis D, Kazemi S, Brunet DV, Hatzoglou M, Tremblay ML, Koromilas AE", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "16431927", "url": "https://glygen.org/publication/PubMed/16431927" } ] }, { "title": "The N-terminus of PKR is responsible for the activation of the NF-kappaB signaling pathway by interacting with the IKK complex.", "journal": "Cellular signalling", "date": "2006-11", "authors": "Bonnet Marion C, Daurat Caroline, Ottone Catherine, Meurs Eliane F", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "16600570", "url": "https://glygen.org/publication/PubMed/16600570" } ] }, { "title": "The CENP-H-I complex is required for the efficient incorporation of newly synthesized CENP-A into centromeres.", "journal": "Nature cell biology", "date": "2006", "authors": "Okada M, Cheeseman IM, Hori T, Okawa K, McLeod IX, Yates JR 3rd, Desai A, Fukagawa T", "evidence": [ { "database": "Reactome", "id": "R-HSA-606279", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-606279" } ], "reference": [ { "type": "PubMed", "id": "16622420", "url": "https://glygen.org/publication/PubMed/16622420" } ] }, { "title": "Double-stranded RNA-dependent protein kinase phosphorylation of the alpha-subunit of eukaryotic translation initiation factor 2 mediates apoptosis.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Scheuner D, Patel R, Wang F, Lee K, Kumar K, Wu J, Nilsson A, Karin M, Kaufman RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "16717090", "url": "https://glygen.org/publication/PubMed/16717090" } ] }, { "title": "UBE2T is the E2 in the Fanconi anemia pathway and undergoes negative autoregulation.", "journal": "Molecular cell", "date": "2006", "authors": "Machida YJ, Machida Y, Chen Y, Gurtan AM, Kupfer GM, D'Andrea AD, Dutta A", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783310", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783310" } ], "reference": [ { "type": "PubMed", "id": "16916645", "url": "https://glygen.org/publication/PubMed/16916645" } ] }, { "title": "Phosphorylation of FANCD2 on two novel sites is required for mitomycin C resistance.", "journal": "Molecular and cellular biology", "date": "2006", "authors": "Ho GP, Margossian S, Taniguchi T, D'Andrea AD", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783310", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783310" } ], "reference": [ { "type": "PubMed", "id": "16943440", "url": "https://glygen.org/publication/PubMed/16943440" } ] }, { "title": "Molecular cloning and characterization of the human double-stranded RNA-activated protein kinase induced by interferon.", "journal": "Cell", "date": "1990-07-27", "authors": "Meurs E, Chong K, Galabru J, Thomas N S, Kerr I M, Williams B R, Hovanessian A G", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "1695551", "url": "https://glygen.org/publication/PubMed/1695551" } ] }, { "title": "Phosphorylation of specific serine residues in the PKR activation domain of PACT is essential for its ability to mediate apoptosis.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Peters GA, Li S, Sen GC", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "16982605", "url": "https://glygen.org/publication/PubMed/16982605" } ] }, { "title": "Double-stranded RNA deaminase ADAR1 increases host susceptibility to virus infection.", "journal": "Journal of virology", "date": "2007-01", "authors": "Nie Yongzhan, Hammond Graeme L, Yang Jing-Hua", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "17079286", "url": "https://glygen.org/publication/PubMed/17079286" } ] }, { "title": "Activation of PKR: an open and shut case?", "journal": "Trends in biochemical sciences", "date": "2007-02", "authors": "Cole James L", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "17196820", "url": "https://glygen.org/publication/PubMed/17196820" } ] }, { "title": "Priming of centromere for CENP-A recruitment by human hMis18alpha, hMis18beta, and M18BP1.", "journal": "Developmental cell", "date": "2007", "authors": "Fujita Y, Hayashi T, Kiyomitsu T, Toyoda Y, Kokubu A, Obuse C, Yanagida M", "evidence": [ { "database": "Reactome", "id": "R-HSA-606279", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-606279" } ], "reference": [ { "type": "PubMed", "id": "17199038", "url": "https://glygen.org/publication/PubMed/17199038" } ] }, { "title": "Identification of FAAP24, a Fanconi anemia core complex protein that interacts with FANCM.", "journal": "Molecular cell", "date": "2007", "authors": "Ciccia A, Ling C, Coulthard R, Yan Z, Xue Y, Meetei AR, Laghmani el H, Joenje H, McDonald N, de Winter JP, Wang W, West SC", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783310", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783310" } ], "reference": [ { "type": "PubMed", "id": "17289582", "url": "https://glygen.org/publication/PubMed/17289582" } ] }, { "title": "Functional genomics identifies a Myb domain-containing protein family required for assembly of CENP-A chromatin.", "journal": "The Journal of cell biology", "date": "2007", "authors": "Maddox PS, Hyndman F, Monen J, Oegema K, Desai A", "evidence": [ { "database": "Reactome", "id": "R-HSA-606279", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-606279" } ], "reference": [ { "type": "PubMed", "id": "17339379", "url": "https://glygen.org/publication/PubMed/17339379" } ] }, { "title": "Identification of the FANCI protein, a monoubiquitinated FANCD2 paralog required for DNA repair.", "journal": "Cell", "date": "2007", "authors": "Smogorzewska A, Matsuoka S, Vinciguerra P, McDonald ER 3rd, Hurov KE, Luo J, Ballif BA, Gygi SP, Hofmann K, D'Andrea AD, Elledge SJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783310", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783310" } ], "reference": [ { "type": "PubMed", "id": "17412408", "url": "https://glygen.org/publication/PubMed/17412408" } ] }, { "title": "FANCI is a second monoubiquitinated member of the Fanconi anemia pathway.", "journal": "Nature structural & molecular biology", "date": "2007", "authors": "Sims AE, Spiteri E, Sims RJ 3rd, Arita AG, Lach FP, Landers T, Wurm M, Freund M, Neveling K, Hanenberg H, Auerbach AD, Huang TT", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783310", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783310" } ], "reference": [ { "type": "PubMed", "id": "17460694", "url": "https://glygen.org/publication/PubMed/17460694" } ] }, { "title": "UBE2T, the Fanconi anemia core complex, and FANCD2 are recruited independently to chromatin: a basis for the regulation of FANCD2 monoubiquitination.", "journal": "Molecular and cellular biology", "date": "2007", "authors": "Alpi A, Langevin F, Mosedale G, Machida YJ, Dutta A, Patel KJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783310", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783310" } ], "reference": [ { "type": "PubMed", "id": "17938197", "url": "https://glygen.org/publication/PubMed/17938197" } ] }, { "title": "A UAF1-containing multisubunit protein complex regulates the Fanconi anemia pathway.", "journal": "Molecular cell", "date": "2007", "authors": "Cohn MA, Kowal P, Yang K, Haas W, Huang TT, Gygi SP, D'Andrea AD", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783310", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783310" } ], "reference": [ { "type": "PubMed", "id": "18082604", "url": "https://glygen.org/publication/PubMed/18082604" } ] }, { "title": "Interaction of human tRNA-dihydrouridine synthase-2 with interferon-induced protein kinase PKR.", "journal": "Nucleic acids research", "date": "2008", "authors": "Mittelstadt M, Frump A, Khuu T, Fowlkes V, Handy I, Patel CV, Patel RC", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "18096616", "url": "https://glygen.org/publication/PubMed/18096616" } ] }, { "title": "Cell cycle-dependent chromatin loading of the Fanconi anemia core complex by FANCM/FAAP24.", "journal": "Blood", "date": "2008", "authors": "Kim JM, Kee Y, Gurtan A, D'Andrea AD", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783310", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783310" } ], "reference": [ { "type": "PubMed", "id": "18174376", "url": "https://glygen.org/publication/PubMed/18174376" } ] }, { "title": "Nck-1 interacts with PKR and modulates its activation by dsRNA.", "journal": "Biochemical and biophysical research communications", "date": "2008", "authors": "Cardin E, Larose L", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "18835251", "url": "https://glygen.org/publication/PubMed/18835251" } ] }, { "title": "FANCI phosphorylation functions as a molecular switch to turn on the Fanconi anemia pathway.", "journal": "Nature structural & molecular biology", "date": "2008", "authors": "Ishiai M, Kitao H, Smogorzewska A, Tomida J, Kinomura A, Uchida E, Saberi A, Kinoshita E, Kinoshita-Kikuta E, Koike T, Tashiro S, Elledge SJ, Takata M", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783310", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783310" } ], "reference": [ { "type": "PubMed", "id": "18931676", "url": "https://glygen.org/publication/PubMed/18931676" } ] }, { "title": "PKR regulates B56(alpha)-mediated BCL2 phosphatase activity in acute lymphoblastic leukemia-derived REH cells.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Ruvolo VR, Kurinna SM, Karanjeet KB, Schuster TF, Martelli AM, McCubrey JA, Ruvolo PP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "18957415", "url": "https://glygen.org/publication/PubMed/18957415" } ] }, { "title": "Mechanistic insight into site-restricted monoubiquitination of FANCD2 by Ube2t, FANCL, and FANCI.", "journal": "Molecular cell", "date": "2008", "authors": "Alpi AF, Pace PE, Babu MM, Patel KJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783310", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783310" } ], "reference": [ { "type": "PubMed", "id": "19111657", "url": "https://glygen.org/publication/PubMed/19111657" } ] }, { "title": "An antiviral response directed by PKR phosphorylation of the RNA helicase A.", "journal": "PLoS pathogens", "date": "2009", "authors": "Sadler AJ, Latchoumanin O, Hawkes D, Mak J, Williams BR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "19229320", "url": "https://glygen.org/publication/PubMed/19229320" } ] }, { "title": "Active establishment of centromeric CENP-A chromatin by RSF complex.", "journal": "The Journal of cell biology", "date": "2009", "authors": "Perpelescu M, Nozaki N, Obuse C, Yang H, Yoda K", "evidence": [ { "database": "Reactome", "id": "R-HSA-606279", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-606279" } ], "reference": [ { "type": "PubMed", "id": "19398759", "url": "https://glygen.org/publication/PubMed/19398759" } ] }, { "title": "Centromere-specific assembly of CENP-a nucleosomes is mediated by HJURP.", "journal": "Cell", "date": "2009", "authors": "Foltz DR, Jansen LE, Bailey AO, Yates JR 3rd, Bassett EA, Wood S, Black BE, Cleveland DW", "evidence": [ { "database": "Reactome", "id": "R-HSA-606279", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-606279" } ], "reference": [ { "type": "PubMed", "id": "19410544", "url": "https://glygen.org/publication/PubMed/19410544" } ] }, { "title": "HJURP is a cell-cycle-dependent maintenance and deposition factor of CENP-A at centromeres.", "journal": "Cell", "date": "2009", "authors": "Dunleavy EM, Roche D, Tagami H, Lacoste N, Ray-Gallet D, Nakamura Y, Daigo Y, Nakatani Y, Almouzni-Pettinotti G", "evidence": [ { "database": "Reactome", "id": "R-HSA-606279", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-606279" } ], "reference": [ { "type": "PubMed", "id": "19410545", "url": "https://glygen.org/publication/PubMed/19410545" } ] }, { "title": "PKR, a p53 target gene, plays a crucial role in the tumor-suppressor function of p53.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2009-05-12", "authors": "Yoon Cheol-Hee, Lee Eun-Soo, Lim Dae-Seog, Bae Yong-Soo", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "19416861", "url": "https://glygen.org/publication/PubMed/19416861" } ] }, { "title": "FANCI protein binds to DNA and interacts with FANCD2 to recognize branched structures.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Yuan F, El Hokayem J, Zhou W, Zhang Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783310", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783310" } ], "reference": [ { "type": "PubMed", "id": "19561358", "url": "https://glygen.org/publication/PubMed/19561358" } ] }, { "title": "FANCI binds branched DNA and is monoubiquitinated by UBE2T-FANCL.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Longerich S, San Filippo J, Liu D, Sung P", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783310", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783310" } ], "reference": [ { "type": "PubMed", "id": "19589784", "url": "https://glygen.org/publication/PubMed/19589784" } ] }, { "title": "Human SLX4 is a Holliday junction resolvase subunit that binds multiple DNA repair/recombination endonucleases.", "journal": "Cell", "date": "2009", "authors": "Fekairi S, Scaglione S, Chahwan C, Taylor ER, Tissier A, Coulon S, Dong MQ, Ruse C, Yates JR 3rd, Russell P, Fuchs RP, McGowan CH, Gaillard PHL", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783310", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783310" } ], "reference": [ { "type": "PubMed", "id": "19596236", "url": "https://glygen.org/publication/PubMed/19596236" } ] }, { "title": "The CENP-S complex is essential for the stable assembly of outer kinetochore structure.", "journal": "The Journal of cell biology", "date": "2009", "authors": "Amano M, Suzuki A, Hori T, Backer C, Okawa K, Cheeseman IM, Fukagawa T", "evidence": [ { "database": "UniProtKB", "id": "A8MT69", "url": "https://www.uniprot.org/uniprot/A8MT69" }, { "database": "RefSeq", "id": "NP_001257935", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001257935" } ], "reference": [ { "type": "PubMed", "id": "19620631", "url": "https://glygen.org/publication/PubMed/19620631" } ] }, { "title": "RNA-specific adenosine deaminase ADAR1 suppresses measles virus-induced apoptosis and activation of protein kinase PKR.", "journal": "The Journal of biological chemistry", "date": "2009-10-23", "authors": "Toth Ann M, Li Zhiqun, Cattaneo Roberto, Samuel Charles E", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "19710021", "url": "https://glygen.org/publication/PubMed/19710021" } ] }, { "title": "Adenosine deaminase ADAR1 increases gene expression at the translational level by decreasing protein kinase PKR-dependent eIF-2alpha phosphorylation.", "journal": "Journal of molecular biology", "date": "2009-11-06", "authors": "Wang Ying, Samuel Charles E", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "19733181", "url": "https://glygen.org/publication/PubMed/19733181" } ] }, { "title": "Phosphorylation of the human microRNA-generating complex mediates MAPK/Erk signaling.", "journal": "Cell", "date": "2009-10-02", "authors": "Paroo Zain, Ye Xuecheng, Chen She, Liu Qinghua", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "19804757", "url": "https://glygen.org/publication/PubMed/19804757" } ] }, { "title": "PKR is not a universal target of tumor suppressor p53 in response to genotoxic stress.", "journal": "Cell cycle (Georgetown, Tex.)", "date": "2009-11-01", "authors": "Rahman Mashrur, Lem Christopher, Muaddi Hala, Koromilas Antonis E", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "19838063", "url": "https://glygen.org/publication/PubMed/19838063" } ] }, { "title": "DNA polymerase POLN participates in cross-link repair and homologous recombination.", "journal": "Molecular and cellular biology", "date": "2010", "authors": "Moldovan GL, Madhavan MV, Mirchandani KD, McCaffrey RM, Vinciguerra P, D'Andrea AD", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783310", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783310" } ], "reference": [ { "type": "PubMed", "id": "19995904", "url": "https://glygen.org/publication/PubMed/19995904" } ] }, { "title": "HJURP binds CENP-A via a highly conserved N-terminal domain and mediates its deposition at centromeres.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2010", "authors": "Shuaib M, Ouararhni K, Dimitrov S, Hamiche A", "evidence": [ { "database": "Reactome", "id": "R-HSA-606279", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-606279" } ], "reference": [ { "type": "PubMed", "id": "20080577", "url": "https://glygen.org/publication/PubMed/20080577" } ] }, { "title": "Novel enzymatic function of DNA polymerase nu in translesion DNA synthesis past major groove DNA-peptide and DNA-DNA cross-links.", "journal": "Chemical research in toxicology", "date": "2010", "authors": "Yamanaka K, Minko IG, Takata K, Kolbanovskiy A, Kozekov ID, Wood RD, Rizzo CJ, Lloyd RS", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783310", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783310" } ], "reference": [ { "type": "PubMed", "id": "20102227", "url": "https://glygen.org/publication/PubMed/20102227" } ] }, { "title": "A histone-fold complex and FANCM form a conserved DNA-remodeling complex to maintain genome stability.", "journal": "Molecular cell", "date": "2010", "authors": "Yan Z, Delannoy M, Ling C, Daee D, Osman F, Muniandy PA, Shen X, Oostra AB, Du H, Steltenpool J, Lin T, Schuster B, Decaillet C, Stasiak A, Stasiak AZ, Stone S, Hoatlin ME, Schindler D, Woodcock CL, Joenje H, Sen R, de Winter JP, Li L, Seidman MM, Whitby MC, Myung K, Constantinou A, Wang W", "evidence": [ { "database": "UniProtKB", "id": "A8MT69", "url": "https://www.uniprot.org/uniprot/A8MT69" }, { "database": "Reactome", "id": "R-HSA-6783310", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783310" } ], "reference": [ { "type": "PubMed", "id": "20347428", "url": "https://glygen.org/publication/PubMed/20347428" } ] }, { "title": "MHF1-MHF2, a histone-fold-containing protein complex, participates in the Fanconi anemia pathway via FANCM.", "journal": "Molecular cell", "date": "2010", "authors": "Singh TR, Saro D, Ali AM, Zheng XF, Du CH, Killen MW, Sachpatzidis A, Wahengbam K, Pierce AJ, Xiong Y, Sung P, Meetei AR", "evidence": [ { "database": "UniProtKB", "id": "A8MT69", "url": "https://www.uniprot.org/uniprot/A8MT69" }, { "database": "Reactome", "id": "R-HSA-6783310", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783310" }, { "database": "RefSeq", "id": "NP_001257935", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001257935" } ], "reference": [ { "type": "PubMed", "id": "20347429", "url": "https://glygen.org/publication/PubMed/20347429" } ] }, { "title": "RAD18-dependent recruitment of SNM1A to DNA repair complexes by a ubiquitin-binding zinc finger.", "journal": "The Journal of biological chemistry", "date": "2010", "authors": "Yang K, Moldovan GL, D'Andrea AD", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783310", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783310" } ], "reference": [ { "type": "PubMed", "id": "20385554", "url": "https://glygen.org/publication/PubMed/20385554" } ] }, { "title": "New Cdc2 Tyr 4 phosphorylation by dsRNA-activated protein kinase triggers Cdc2 polyubiquitination and G2 arrest under genotoxic stresses.", "journal": "EMBO reports", "date": "2010", "authors": "Yoon CH, Miah MA, Kim KP, Bae YS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "20395957", "url": "https://glygen.org/publication/PubMed/20395957" } ] }, { "title": "Respiratory syncytial virus limits alpha subunit of eukaryotic translation initiation factor 2 (eIF2alpha) phosphorylation to maintain translation and viral replication.", "journal": "The Journal of biological chemistry", "date": "2010-07-30", "authors": "Groskreutz Dayna J, Babor Ellen C, Monick Martha M, Varga Steven M, Hunninghake Gary W", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "20519500", "url": "https://glygen.org/publication/PubMed/20519500" } ] }, { "title": "Dual recognition of CENP-A nucleosomes is required for centromere assembly.", "journal": "The Journal of cell biology", "date": "2010", "authors": "Carroll CW, Milks KJ, Straight AF", "evidence": [ { "database": "Reactome", "id": "R-HSA-606279", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-606279" } ], "reference": [ { "type": "PubMed", "id": "20566683", "url": "https://glygen.org/publication/PubMed/20566683" } ] }, { "title": "Identification of KIAA1018/FAN1, a DNA repair nuclease recruited to DNA damage by monoubiquitinated FANCD2.", "journal": "Cell", "date": "2010", "authors": "MacKay C, Declais AC, Lundin C, Agostinho A, Deans AJ, MacArtney TJ, Hofmann K, Gartner A, West SC, Helleday T, Lilley DM, Rouse J", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783310", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783310" } ], "reference": [ { "type": "PubMed", "id": "20603015", "url": "https://glygen.org/publication/PubMed/20603015" } ] }, { "title": "Deficiency of FANCD2-associated nuclease KIAA1018/FAN1 sensitizes cells to interstrand crosslinking agents.", "journal": "Cell", "date": "2010", "authors": "Kratz K, Schopf B, Kaden S, Sendoel A, Eberhard R, Lademann C, Cannavo E, Sartori AA, Hengartner MO, Jiricny J", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783310", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783310" } ], "reference": [ { "type": "PubMed", "id": "20603016", "url": "https://glygen.org/publication/PubMed/20603016" } ] }, { "title": "A genetic screen identifies FAN1, a Fanconi anemia-associated nuclease necessary for DNA interstrand crosslink repair.", "journal": "Molecular cell", "date": "2010", "authors": "Smogorzewska A, Desetty R, Saito TT, Schlabach M, Lach FP, Sowa ME, Clark AB, Kunkel TA, Harper JW, Colaiacovo MP, Elledge SJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783310", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783310" } ], "reference": [ { "type": "PubMed", "id": "20603073", "url": "https://glygen.org/publication/PubMed/20603073" } ] }, { "title": "The FANCM/FAAP24 complex is required for the DNA interstrand crosslink-induced checkpoint response.", "journal": "Molecular cell", "date": "2010", "authors": "Huang M, Kim JM, Shiotani B, Yang K, Zou L, D'Andrea AD", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783310", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783310" } ], "reference": [ { "type": "PubMed", "id": "20670894", "url": "https://glygen.org/publication/PubMed/20670894" } ] }, { "title": "FAN1 acts with FANCI-FANCD2 to promote DNA interstrand cross-link repair.", "journal": "Science (New York, N.Y.)", "date": "2010", "authors": "Liu T, Ghosal G, Yuan J, Chen J, Huang J", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783310", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783310" } ], "reference": [ { "type": "PubMed", "id": "20671156", "url": "https://glygen.org/publication/PubMed/20671156" } ] }, { "title": "The double-stranded RNA-dependent protein kinase differentially regulates insulin receptor substrates 1 and 2 in HepG2 cells.", "journal": "Molecular biology of the cell", "date": "2010", "authors": "Yang X, Nath A, Opperman MJ, Chan C", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "20685959", "url": "https://glygen.org/publication/PubMed/20685959" } ] }, { "title": "Multiple forms of PKR present in the nuclei of acute leukemia cells represent an active kinase that is responsive to stress.", "journal": "Leukemia", "date": "2011", "authors": "Blalock WL, Bavelloni A, Piazzi M, Tagliavini F, Faenza I, Martelli AM, Follo MY, Cocco L", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "21072047", "url": "https://glygen.org/publication/PubMed/21072047" } ] }, { "title": "Phosphorylation of the NFAR proteins by the dsRNA-dependent protein kinase PKR constitutes a novel mechanism of translational regulation and cellular defense.", "journal": "Genes & development", "date": "2010", "authors": "Harashima A, Guettouche T, Barber GN", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "21123651", "url": "https://glygen.org/publication/PubMed/21123651" } ] }, { "title": "Multiple levels of PKR inhibition during HIV-1 replication.", "journal": "Reviews in medical virology", "date": "2011-01", "authors": "Clerzius Guerline, G\u00e9linas Jean-Fran\u00e7ois, Gatignol Anne", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "21294215", "url": "https://glygen.org/publication/PubMed/21294215" } ] }, { "title": "Involvement of SLX4 in interstrand cross-link repair is regulated by the Fanconi anemia pathway.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2011", "authors": "Yamamoto KN, Kobayashi S, Tsuda M, Kurumizaka H, Takata M, Kono K, Jiricny J, Takeda S, Hirota K", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783310", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783310" } ], "reference": [ { "type": "PubMed", "id": "21464321", "url": "https://glygen.org/publication/PubMed/21464321" } ] }, { "title": "Precursor miR-886, a novel noncoding RNA repressed in cancer, associates with PKR and modulates its activity.", "journal": "RNA (New York, N.Y.)", "date": "2011-06", "authors": "Lee Kwanbok, Kunkeaw Nawapol, Jeon Sung Ho, Lee Inhan, Johnson Betty H, Kang Gum-Yong, Bang Joo Young, Park Hyung Soon, Leelayuwat Chanvit, Lee Yong Sun", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "21518807", "url": "https://glygen.org/publication/PubMed/21518807" } ] }, { "title": "Inhibition of RNase L and RNA-dependent protein kinase (PKR) by sunitinib impairs antiviral innate immunity.", "journal": "The Journal of biological chemistry", "date": "2011-07-29", "authors": "Jha Babal Kant, Polyakova Irina, Kessler Patricia, Dong Beihua, Dickerman Benjamin, Sen Ganes C, Silverman Robert H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "21636578", "url": "https://glygen.org/publication/PubMed/21636578" } ] }, { "title": "DNA interstrand crosslink repair and cancer.", "journal": "Nature reviews. Cancer", "date": "2011", "authors": "Deans AJ, West SC", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783310", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783310" } ], "reference": [ { "type": "PubMed", "id": "21701511", "url": "https://glygen.org/publication/PubMed/21701511" } ] }, { "title": "Structure of the FANCI-FANCD2 complex: insights into the Fanconi anemia DNA repair pathway.", "journal": "Science (New York, N.Y.)", "date": "2011", "authors": "Joo W, Xu G, Persky NS, Smogorzewska A, Rudge DG, Buzovetsky O, Elledge SJ, Pavletich NP", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783310", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783310" } ], "reference": [ { "type": "PubMed", "id": "21764741", "url": "https://glygen.org/publication/PubMed/21764741" } ] }, { "title": "HJURP is a CENP-A chromatin assembly factor sufficient to form a functional de novo kinetochore.", "journal": "The Journal of cell biology", "date": "2011", "authors": "Barnhart MC, Kuich PH, Stellfox ME, Ward JA, Bassett EA, Black BE, Foltz DR", "evidence": [ { "database": "Reactome", "id": "R-HSA-606279", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-606279" } ], "reference": [ { "type": "PubMed", "id": "21768289", "url": "https://glygen.org/publication/PubMed/21768289" } ] }, { "title": "The cellular TAR RNA binding protein, TRBP, promotes HIV-1 replication primarily by inhibiting the activation of double-stranded RNA-dependent kinase PKR.", "journal": "Journal of virology", "date": "2011-12", "authors": "Sanghvi Viraj R, Steel Laura F", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "21937648", "url": "https://glygen.org/publication/PubMed/21937648" } ] }, { "title": "Heparin activates PKR by inducing dimerization.", "journal": "Journal of molecular biology", "date": "2011-11-11", "authors": "Anderson Eric, Pierre-Louis Willythssa S, Wong C Jason, Lary Jeffrey W, Cole James L", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "21978664", "url": "https://glygen.org/publication/PubMed/21978664" } ] }, { "title": "Activation of the Antiviral Kinase PKR and Viral Countermeasures.", "journal": "Viruses", "date": "2009-12", "authors": "Dauber Bianca, Wolff Thorsten", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "21994559", "url": "https://glygen.org/publication/PubMed/21994559" } ] }, { "title": "The RAX/PACT-PKR stress response pathway promotes p53 sumoylation and activation, leading to G(1) arrest.", "journal": "Cell cycle (Georgetown, Tex.)", "date": "2012", "authors": "Bennett RL, Pan Y, Christian J, Hui T, May WS Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "22214662", "url": "https://glygen.org/publication/PubMed/22214662" } ] }, { "title": "ATR-ATRIP kinase complex triggers activation of the Fanconi anemia DNA repair pathway.", "journal": "Cancer research", "date": "2012", "authors": "Shigechi T, Tomida J, Sato K, Kobayashi M, Eykelenboom JK, Pessina F, Zhang Y, Uchida E, Ishiai M, Lowndes NF, Yamamoto K, Kurumizaka H, Maehara Y, Takata M", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783310", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783310" } ], "reference": [ { "type": "PubMed", "id": "22258451", "url": "https://glygen.org/publication/PubMed/22258451" } ] }, { "title": "DNA robustly stimulates FANCD2 monoubiquitylation in the complex with FANCI.", "journal": "Nucleic acids research", "date": "2012", "authors": "Sato K, Toda K, Ishiai M, Takata M, Kurumizaka H", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783310", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783310" } ], "reference": [ { "type": "PubMed", "id": "22287633", "url": "https://glygen.org/publication/PubMed/22287633" } ] }, { "title": "CENP-T-W-S-X forms a unique centromeric chromatin structure with a histone-like fold.", "journal": "Cell", "date": "2012", "authors": "Nishino Tatsuya, Takeuchi Kozo, Gascoigne Karen E, Suzuki Aussie, Hori Tetsuya, Oyama Takuji, Morikawa Kosuke, Cheeseman Iain M, Fukagawa Tatsuo", "evidence": [ { "database": "UniProtKB", "id": "A8MT69", "url": "https://www.uniprot.org/uniprot/A8MT69" } ], "reference": [ { "type": "PubMed", "id": "22304917", "url": "https://glygen.org/publication/PubMed/22304917" } ] }, { "title": "Fanconi anemia (FA) binding protein FAAP20 stabilizes FA complementation group A (FANCA) and participates in interstrand cross-link repair.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2012", "authors": "Leung JW, Wang Y, Fong KW, Huen MS, Li L, Chen J", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783310", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783310" } ], "reference": [ { "type": "PubMed", "id": "22396592", "url": "https://glygen.org/publication/PubMed/22396592" } ] }, { "title": "Tat-responsive region RNA of human immunodeficiency virus 1 can prevent activation of the double-stranded-RNA-activated protein kinase.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1990-11", "authors": "Gunnery S, Rice A P, Robertson H D, Mathews M B", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "2247437", "url": "https://glygen.org/publication/PubMed/2247437" } ] }, { "title": "The structure of the FANCM-MHF complex reveals physical features for functional assembly.", "journal": "Nature communications", "date": "2012", "authors": "Tao Y, Jin C, Li X, Qi S, Chu L, Niu L, Yao X, Teng M", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783310", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783310" } ], "reference": [ { "type": "PubMed", "id": "22510687", "url": "https://glygen.org/publication/PubMed/22510687" } ] }, { "title": "Characterization of the human SNM1A and SNM1B/Apollo DNA repair exonucleases.", "journal": "The Journal of biological chemistry", "date": "2012", "authors": "Sengerova B, Allerston CK, Abu M, Lee SY, Hartley J, Kiakos K, Schofield CJ, Hartley JA, Gileadi O, McHugh PJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783310", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783310" } ], "reference": [ { "type": "PubMed", "id": "22692201", "url": "https://glygen.org/publication/PubMed/22692201" } ] }, { "title": "Characterization of the direct physical interaction of nc886, a cellular non-coding RNA, and PKR.", "journal": "FEBS letters", "date": "2012-09-21", "authors": "Jeon Sung Ho, Lee Kwanbok, Lee Kwang Soo, Kunkeaw Nawapol, Johnson Betty H, Holthauzen Luis Marcelo F, Gong Bin, Leelayuwat Chanvit, Lee Yong Sun", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "22986343", "url": "https://glygen.org/publication/PubMed/22986343" } ] }, { "title": "Cytoplasmic STAT3 represses autophagy by inhibiting PKR activity.", "journal": "Molecular cell", "date": "2012-12-14", "authors": "Shen Shensi, Niso-Santano Mireia, Adjemian Sandy, Takehara Tetsuo, Malik Shoaib Ahmad, Minoux Herv\u00e9, Souquere Sylvie, Mari\u00f1o Guillermo, Lachkar Sylvie, Senovilla Laura, Galluzzi Lorenzo, Kepp Oliver, Pierron G\u00e9rard, Maiuri Maria Chiara, Hikita Hayato, Kroemer Romano, Kroemer Guido", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "23084476", "url": "https://glygen.org/publication/PubMed/23084476" } ] }, { "title": "Activation of double-stranded RNA-activated protein kinase (PKR) by interferon-stimulated gene 15 (ISG15) modification down-regulates protein translation.", "journal": "The Journal of biological chemistry", "date": "2013-01-25", "authors": "Okumura Fumihiko, Okumura Akiko J, Uematsu Keiji, Hatakeyama Shigetsugu, Zhang Dong-Er, Kamura Takumi", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "23229543", "url": "https://glygen.org/publication/PubMed/23229543" } ] }, { "title": "Fanconi anaemia and the repair of Watson and Crick DNA crosslinks.", "journal": "Nature", "date": "2013", "authors": "Kottemann MC, Smogorzewska A", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783310", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783310" } ], "reference": [ { "type": "PubMed", "id": "23325218", "url": "https://glygen.org/publication/PubMed/23325218" } ] }, { "title": "ATR-dependent phosphorylation of FANCM at serine 1045 is essential for FANCM functions.", "journal": "Cancer research", "date": "2013", "authors": "Singh TR, Ali AM, Paramasivam M, Pradhan A, Wahengbam K, Seidman MM, Meetei AR", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783310", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783310" } ], "reference": [ { "type": "PubMed", "id": "23698467", "url": "https://glygen.org/publication/PubMed/23698467" } ] }, { "title": "A novel interplay between the Fanconi anemia core complex and ATR-ATRIP kinase during DNA cross-link repair.", "journal": "Nucleic acids research", "date": "2013", "authors": "Tomida J, Itaya A, Shigechi T, Unno J, Uchida E, Ikura M, Masuda Y, Matsuda S, Adachi J, Kobayashi M, Meetei AR, Maehara Y, Yamamoto K, Kamiya K, Matsuura A, Matsuda T, Ikura T, Ishiai M, Takata M", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783310", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783310" } ], "reference": [ { "type": "PubMed", "id": "23723247", "url": "https://glygen.org/publication/PubMed/23723247" } ] }, { "title": "Suppression of antiviral innate immunity by sunitinib enhances oncolytic virotherapy.", "journal": "Molecular therapy : the journal of the American Society of Gene Therapy", "date": "2013-09", "authors": "Jha Babal K, Dong Beihua, Nguyen Carvell T, Polyakova Irina, Silverman Robert H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "23732991", "url": "https://glygen.org/publication/PubMed/23732991" } ] }, { "title": "Coordinated actions of SLX1-SLX4 and MUS81-EME1 for Holliday junction resolution in human cells.", "journal": "Molecular cell", "date": "2013", "authors": "Wyatt HD, Sarbajna S, Matos J, West SC", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783310", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783310" } ], "reference": [ { "type": "PubMed", "id": "24076221", "url": "https://glygen.org/publication/PubMed/24076221" } ] }, { "title": "Identification of the PKR nuclear interactome reveals roles in ribosome biogenesis, mRNA processing and cell division.", "journal": "Journal of cellular physiology", "date": "2014-08", "authors": "Blalock William L, Piazzi Manuela, Bavelloni Alberto, Raffini Mirco, Faenza Irene, D'Angelo Antonietta, Cocco Lucio", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "24347309", "url": "https://glygen.org/publication/PubMed/24347309" } ] }, { "title": "Structure of the human FANCL RING-Ube2T complex reveals determinants of cognate E3-E2 selection.", "journal": "Structure (London, England : 1993)", "date": "2014", "authors": "Hodson C, Purkiss A, Miles JA, Walden H", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783310", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783310" } ], "reference": [ { "type": "PubMed", "id": "24389026", "url": "https://glygen.org/publication/PubMed/24389026" } ] }, { "title": "The MHF complex senses branched DNA by binding a pair of crossover DNA duplexes.", "journal": "Nature communications", "date": "2014", "authors": "Zhao Q, Saro D, Sachpatzidis A, Singh TR, Schlingman D, Zheng XF, Mack A, Tsai MS, Mochrie S, Regan L, Meetei AR, Sung P, Xiong Y", "evidence": [ { "database": "RefSeq", "id": "NP_001257935", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001257935" } ], "reference": [ { "type": "PubMed", "id": "24390579", "url": "https://glygen.org/publication/PubMed/24390579" } ] }, { "title": "A CENP-S/X complex assembles at the centromere in S and G2 phases of the human cell cycle.", "journal": "Open Biol.", "date": "2014", "authors": "Dornblut C, Quinn N, Monajambashi S, Prendergast L, van Vuuren C, Munch S, Deng W, Leonhardt H, Cardoso MC, Hoischen C, Diekmann S, Sullivan KF", "evidence": [ { "database": "UniProtKB", "id": "A8MT69", "url": "https://www.uniprot.org/uniprot/A8MT69" }, { "database": "RefSeq", "id": "NP_001257935", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001257935" } ], "reference": [ { "type": "PubMed", "id": "24522885", "url": "https://glygen.org/publication/PubMed/24522885" } ] }, { "title": "NF90 exerts antiviral activity through regulation of PKR phosphorylation and stress granules in infected cells.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2014-04-15", "authors": "Wen Xi, Huang Xiaofeng, Mok Bobo Wing-Yee, Chen Yixin, Zheng Min, Lau Siu-Ying, Wang Pui, Song Wenjun, Jin Dong-Yan, Yuen Kwok-Yung, Chen Honglin", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "24623135", "url": "https://glygen.org/publication/PubMed/24623135" } ] }, { "title": "Regulation of FANCD2 and FANCI monoubiquitination by their interaction and by DNA.", "journal": "Nucleic acids research", "date": "2014", "authors": "Longerich S, Kwon Y, Tsai MS, Hlaing AS, Kupfer GM, Sung P", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783310", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783310" } ], "reference": [ { "type": "PubMed", "id": "24623813", "url": "https://glygen.org/publication/PubMed/24623813" } ] }, { "title": "IPS-1 plays an essential role in dsRNA-induced stress granule formation by interacting with PKR and promoting its activation.", "journal": "Journal of cell science", "date": "2014-06-01", "authors": "Zhang Peifen, Li Yuye, Xia Jun, He Junfang, Pu Jieying, Xie Jiong, Wu Siyu, Feng Lianqiang, Huang Xi, Zhang Ping", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "24659800", "url": "https://glygen.org/publication/PubMed/24659800" } ] }, { "title": "The histone-fold complex MHF is remodeled by FANCM to recognize branched DNA and protect genome stability.", "journal": "Cell research", "date": "2014", "authors": "Fox D 3rd, Yan Z, Ling C, Zhao Y, Lee DY, Fukagawa T, Yang W, Wang W", "evidence": [ { "database": "RefSeq", "id": "NP_001257935", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001257935" } ], "reference": [ { "type": "PubMed", "id": "24699063", "url": "https://glygen.org/publication/PubMed/24699063" } ] }, { "title": "XPF-ERCC1 acts in Unhooking DNA interstrand crosslinks in cooperation with FANCD2 and FANCP/SLX4.", "journal": "Molecular cell", "date": "2014", "authors": "Klein Douwel D, Boonen RA, Long DT, Szypowska AA, Raschle M, Walter JC, Knipscheer P", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783310", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783310" } ], "reference": [ { "type": "PubMed", "id": "24726325", "url": "https://glygen.org/publication/PubMed/24726325" } ] }, { "title": "A bimodular nuclear localization signal assembled via an extended double-stranded RNA-binding domain acts as an RNA-sensing signal for transportin 1.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2014", "authors": "Barraud P, Banerjee S, Mohamed WI, Jantsch MF, Allain FH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "24753571", "url": "https://glygen.org/publication/PubMed/24753571" } ] }, { "title": "The genetic and biochemical basis of FANCD2 monoubiquitination.", "journal": "Molecular cell", "date": "2014", "authors": "Rajendra E, Oestergaard VH, Langevin F, Wang M, Dornan GL, Patel KJ, Passmore LA", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783310", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783310" } ], "reference": [ { "type": "PubMed", "id": "24905007", "url": "https://glygen.org/publication/PubMed/24905007" } ] }, { "title": "DNA repair. Mechanism of DNA interstrand cross-link processing by repair nuclease FAN1.", "journal": "Science (New York, N.Y.)", "date": "2014", "authors": "Wang R, Persky NS, Yoo B, Ouerfelli O, Smogorzewska A, Elledge SJ, Pavletich NP", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783310", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783310" } ], "reference": [ { "type": "PubMed", "id": "25430771", "url": "https://glygen.org/publication/PubMed/25430771" } ] }, { "title": "Structural insights into 5' flap DNA unwinding and incision by the human FAN1 dimer.", "journal": "Nature communications", "date": "2014", "authors": "Zhao Q, Xue X, Longerich S, Sung P, Xiong Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783310", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783310" } ], "reference": [ { "type": "PubMed", "id": "25500724", "url": "https://glygen.org/publication/PubMed/25500724" } ] }, { "title": "p53-derived host restriction of HIV-1 replication by protein kinase R-mediated Tat phosphorylation and inactivation.", "journal": "Journal of virology", "date": "2015-04", "authors": "Yoon Cheol-Hee, Kim Sang-Yoon, Byeon Se Eun, Jeong Yideul, Lee Jinjoo, Kim Kwang Pyo, Park Jinseu, Bae Yong-Soo", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "25653431", "url": "https://glygen.org/publication/PubMed/25653431" } ] }, { "title": "Potential role for snoRNAs in PKR activation during metabolic stress.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2015-04-21", "authors": "Youssef Osama A, Safran Sarah A, Nakamura Takahisa, Nix David A, Hotamisligil G\u00f6khan S, Bass Brenda L", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "25848059", "url": "https://glygen.org/publication/PubMed/25848059" } ] }, { "title": "The Regulatory and Kinase Domains but Not the Interdomain Linker Determine Human Double-stranded RNA-activated Kinase (PKR) Sensitivity to Inhibition by Viral Non-coding RNAs.", "journal": "The Journal of biological chemistry", "date": "2015-11-20", "authors": "Sunita S, Schwartz Samantha L, Conn Graeme L", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "26432638", "url": "https://glygen.org/publication/PubMed/26432638" } ] }, { "title": "Activated PKR inhibits pancreatic \u03b2-cell proliferation through sumoylation-dependent stabilization of P53.", "journal": "Molecular immunology", "date": "2015-12", "authors": "Song Ying, Wan XiaoMeng, Gao LiLi, Pan Yi, Xie WeiPing, Wang Hong, Guo Jun", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "26446704", "url": "https://glygen.org/publication/PubMed/26446704" } ] }, { "title": "Regulation of PKR by RNA: formation of active and inactive dimers.", "journal": "Biochemistry", "date": "2015-11-10", "authors": "Husain Bushra, Hesler Stephen, Cole James L", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "26488609", "url": "https://glygen.org/publication/PubMed/26488609" } ] }, { "title": "Essential role of protein kinase R antagonism by TRS1 in human cytomegalovirus replication.", "journal": "Virology", "date": "2016-02", "authors": "Braggin Jacquelyn E, Child Stephanie J, Geballe Adam P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "26716879", "url": "https://glygen.org/publication/PubMed/26716879" } ] }, { "title": "Editing of Cellular Self-RNAs by Adenosine Deaminase ADAR1 Suppresses Innate Immune Stress Responses.", "journal": "The Journal of biological chemistry", "date": "2016-03-18", "authors": "George Cyril X, Ramaswami Gokul, Li Jin Billy, Samuel Charles E", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "26817845", "url": "https://glygen.org/publication/PubMed/26817845" } ] }, { "title": "Activation of PKR by short stem-loop RNAs containing single-stranded arms.", "journal": "RNA (New York, N.Y.)", "date": "2016-07", "authors": "Mayo Christopher B, Wong C Jason, Lopez Prisma E, Lary Jeffrey W, Cole James L", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "27208315", "url": "https://glygen.org/publication/PubMed/27208315" } ] }, { "title": "Discriminating Self and Non-Self by RNA: Roles for RNA Structure, Misfolding, and Modification in Regulating the Innate Immune Sensor PKR.", "journal": "Accounts of chemical research", "date": "2016-06-21", "authors": "Hull Chelsea M, Bevilacqua Philip C", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "27269119", "url": "https://glygen.org/publication/PubMed/27269119" } ] }, { "title": "NF90 is a novel influenza A virus NS1-interacting protein that antagonizes the inhibitory role of NS1 on PKR phosphorylation.", "journal": "FEBS letters", "date": "2016-08", "authors": "Li Ting, Li Xi, Zhu WenFei, Wang HuiYu, Mei Lin, Wu ShaoQiang, Lin XiangMei, Han XueQing", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "27423063", "url": "https://glygen.org/publication/PubMed/27423063" } ] }, { "title": "Mechanism of Protein Kinase R Inhibition by Human Cytomegalovirus pTRS1.", "journal": "Journal of virology", "date": "2017", "authors": "Vincent HA, Ziehr B, Moorman NJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "27974558", "url": "https://glygen.org/publication/PubMed/27974558" } ] }, { "title": "Human noncoding RNA 886 (nc886) adopts two structurally distinct conformers that are functionally opposing regulators of PKR.", "journal": "RNA (New York, N.Y.)", "date": "2017-04", "authors": "Calderon Brenda M, Conn Graeme L", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "28069888", "url": "https://glygen.org/publication/PubMed/28069888" } ] }, { "title": "ADAR1 and PACT contribute to efficient translation of transcripts containing HIV-1 trans-activating response (TAR) element.", "journal": "The Biochemical journal", "date": "2017", "authors": "Chukwurah E, Handy I, Patel RC", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "28167698", "url": "https://glygen.org/publication/PubMed/28167698" } ] }, { "title": "Auto-phosphorylation Represses Protein Kinase R Activity.", "journal": "Scientific reports", "date": "2017-03-10", "authors": "Wang Die, de Weerd Nicole A, Willard Belinda, Polekhina Galina, Williams Bryan R G, Sadler Anthony J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "28281686", "url": "https://glygen.org/publication/PubMed/28281686" } ] }, { "title": "Non-coding RNA 886 promotes renal cell carcinoma growth and metastasis through the Janus kinase 2/signal transducer and activator of transcription 3 signaling pathway.", "journal": "Molecular medicine reports", "date": "2017-10", "authors": "Lei Jun, Xiao Ju-Hua, Zhang Shou-Hua, Liu Zhi-Qiang, Huang Kai, Luo Zhi-Peng, Xiao Xin-Lan, Hong Zheng-Dong", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "28765891", "url": "https://glygen.org/publication/PubMed/28765891" } ] }, { "title": "Inhibition of the inflammatory response to stress by targeting interaction between PKR and its cellular activator PACT.", "journal": "Scientific reports", "date": "2017-11-23", "authors": "Dabo Stephanie, Maillard Patrick, Collados Rodriguez Milagros, Hansen Marianne Dor\u00e9, Mazouz Sabrina, Bigot Donna-Joe, Tible Marion, Janvier Genevi\u00e8ve, Helynck Olivier, Cassonnet Patricia, Jacob Yves, Bellalou Jacques, Gatignol Anne, Patel Rekha C, Hugon Jacques, Munier-Lehmann H\u00e9l\u00e8ne, Meurs Eliane F", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "29170442", "url": "https://glygen.org/publication/PubMed/29170442" } ] }, { "title": "PPP2R5A: A multirole protein phosphatase subunit in regulating cancer development.", "journal": "Cancer letters", "date": "2018", "authors": "Mao Z, Liu C, Lin X, Sun B, Su C", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "29175459", "url": "https://glygen.org/publication/PubMed/29175459" } ] }, { "title": "Contribution of the two dsRBM motifs to the double-stranded RNA binding and protein interactions of PACT.", "journal": "Journal of cellular biochemistry", "date": "2018-04", "authors": "Chukwurah Evelyn, Willingham Victoria, Singh Madhurima, Castillo-Azofeifa David, Patel Rekha C", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "29231267", "url": "https://glygen.org/publication/PubMed/29231267" } ] }, { "title": "Stress-induced TRBP phosphorylation enhances its interaction with PKR to regulate cellular survival.", "journal": "Scientific reports", "date": "2018", "authors": "Chukwurah E, Patel RC", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "29348664", "url": "https://glygen.org/publication/PubMed/29348664" } ] }, { "title": "Nc886 is epigenetically repressed in prostate cancer and acts as a tumor suppressor through the inhibition of cell growth.", "journal": "BMC cancer", "date": "2018-02-02", "authors": "Fort Rafael Sebasti\u00e1n, Math\u00f3 Cecilia, Geraldo Murilo Vieira, Ottati Mar\u00eda Carolina, Yamashita Alex Shimura, Saito Kelly Cristina, Leite Katia Ramos Moreira, M\u00e9ndez Manuel, Maedo Noem\u00ed, M\u00e9ndez Laura, Garat Beatriz, Kimura Edna Teruko, Sotelo-Silveira Jos\u00e9 Roberto, Duhagon Mar\u00eda Ana", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "29394925", "url": "https://glygen.org/publication/PubMed/29394925" } ] }, { "title": "Human ADAR1 Prevents Endogenous RNA from Triggering Translational Shutdown.", "journal": "Cell", "date": "2018-02-08", "authors": "Chung Hachung, Calis Jorg J A, Wu Xianfang, Sun Tony, Yu Yingpu, Sarbanes Stephanie L, Dao Thi Viet Loan, Shilvock Abigail R, Hoffmann H-Heinrich, Rosenberg Brad R, Rice Charles M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "29395325", "url": "https://glygen.org/publication/PubMed/29395325" } ] }, { "title": "Role of eIF2\u03b1 Kinases in Translational Control and Adaptation to Cellular Stress.", "journal": "Cold Spring Harbor perspectives in biology", "date": "2018-07-02", "authors": "Wek Ronald C", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "29440070", "url": "https://glygen.org/publication/PubMed/29440070" } ] }, { "title": "O-GlcNAc Transferase Recognizes Protein Substrates Using an Asparagine Ladder in the Tetratricopeptide Repeat (TPR) Superhelix.", "journal": "Journal of the American Chemical Society", "date": "2018", "authors": "Levine ZG, Fan C, Melicher MS, Orman M, Benjamin T, Walker S", "evidence": [ { "database": "O-GlcNAc Database", "id": "A8MT69", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=A8MT69" } ], "reference": [ { "type": "PubMed", "id": "29485866", "url": "https://glygen.org/publication/PubMed/29485866" } ] }, { "title": "Inflammation kinase PKR phosphorylates \u03b1-synuclein and causes \u03b1-synuclein-dependent cell death.", "journal": "Neurobiology of disease", "date": "2018-07", "authors": "Reimer Lasse, Vesterager Louise Buur, Betzer Cristine, Zheng Jin, Nielsen L\u00e6rke Dalsgaard, Kofoed Rikke Hahn, Lassen Louise Berkhoudt, B\u00f8lcho Ulrik, Paludan S\u00f8ren Riis, Fog Karina, Jensen Poul Henning", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "29501855", "url": "https://glygen.org/publication/PubMed/29501855" } ] }, { "title": "PKR Senses Nuclear and Mitochondrial Signals by Interacting with Endogenous Double-Stranded RNAs.", "journal": "Molecular cell", "date": "2018-09-20", "authors": "Kim Yoosik, Park Joha, Kim Sujin, Kim MinA, Kang Myeong-Gyun, Kwak Chulhwan, Kang Minjeong, Kim Baekgyu, Rhee Hyun-Woo, Kim V Narry", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "30174290", "url": "https://glygen.org/publication/PubMed/30174290" } ] }, { "title": "The search for a PKR code-differential regulation of protein kinase R activity by diverse RNA and protein regulators.", "journal": "RNA (New York, N.Y.)", "date": "2019", "authors": "Bou-Nader C, Gordon JM, Henderson FE, Zhang J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "30770398", "url": "https://glygen.org/publication/PubMed/30770398" } ] }, { "title": "Structure and Degradation of Circular RNAs Regulate PKR Activation in Innate Immunity.", "journal": "Cell", "date": "2019-05-02", "authors": "Liu Chu-Xiao, Li Xiang, Nan Fang, Jiang Shan, Gao Xiang, Guo Si-Kun, Xue Wei, Cui Yange, Dong Kaige, Ding Huihua, Qu Bo, Zhou Zhaocai, Shen Nan, Yang Li, Chen Ling-Ling", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "31031002", "url": "https://glygen.org/publication/PubMed/31031002" } ] }, { "title": "vtRNA2-1/nc886 Produces a Small RNA That Contributes to Its Tumor Suppression Action through the microRNA Pathway in Prostate Cancer.", "journal": "Non-coding RNA", "date": "2020-02-20", "authors": "Fort Rafael Sebasti\u00e1n, Garat Beatriz, Sotelo-Silveira Jos\u00e9 Roberto, Duhagon Mar\u00eda Ana", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "32093270", "url": "https://glygen.org/publication/PubMed/32093270" } ] }, { "title": "PKR kinase directly regulates tau expression and Alzheimer's disease-related tau phosphorylation.", "journal": "Brain pathology (Zurich, Switzerland)", "date": "2021-01", "authors": "Reimer Lasse, Betzer Cristine, Kofoed Rikke Hahn, Volbracht Christiane, Fog Karina, Kurhade Chaitanya, Nilsson Emma, \u00d6verby Anna K, Jensen Poul Henning", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "32716602", "url": "https://glygen.org/publication/PubMed/32716602" } ] }, { "title": "Cell fate determined by the activation balance between PKR and SPHK1.", "journal": "Cell death and differentiation", "date": "2021-01", "authors": "Qiao Han, Jiang Tianqing, Mu Peiqiang, Chen Xiaoxuan, Wen Xianhui, Hu Zhangsheng, Tang Shulin, Wen Jikai, Deng Yiqun", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "32801355", "url": "https://glygen.org/publication/PubMed/32801355" } ] }, { "title": "The PKR/P38/RIPK1 Signaling Pathway as a Therapeutic Target in Alzheimer's Disease.", "journal": "International journal of molecular sciences", "date": "2021-03-19", "authors": "Hugon Jacques, Paquet Claire", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "33808629", "url": "https://glygen.org/publication/PubMed/33808629" } ] }, { "title": "PKR activity modulation by phosphomimetic mutations of serine residues located three aminoacids upstream of double-stranded RNA binding motifs.", "journal": "Scientific reports", "date": "2021-04-28", "authors": "Cesaro Teresa, Hayashi Yohei, Borghese Fabian, Vertommen Didier, Wavreil Fanny, Michiels Thomas", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "33911136", "url": "https://glygen.org/publication/PubMed/33911136" } ] }, { "title": "Regulation of PKR activation and apoptosis during oxidative stress by TRBP phosphorylation.", "journal": "The international journal of biochemistry & cell biology", "date": "2021-08", "authors": "Ukhueduan Benedicth, Chukwurah Evelyn, Patel Rekha C", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "34174402", "url": "https://glygen.org/publication/PubMed/34174402" } ] }, { "title": "Nc886 promotes renal cancer cell drug-resistance by enhancing EMT through Rock2 phosphorylation-mediated \u03b2-catenin nuclear translocation.", "journal": "Cell cycle (Georgetown, Tex.)", "date": "2022-02", "authors": "Gao Weiyin, Zhang Shouhua, Guorong Li, Liu Queling, Zhu Anyi, Gui Fu, Zou Yan, Wu Yiguo, Luo Yang, Hong Zhengdong", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "34974812", "url": "https://glygen.org/publication/PubMed/34974812" } ] }, { "title": "Downregulation of nc886 contributes to prostate cancer cell invasion and TGF\u03b21-induced EMT.", "journal": "Genes & diseases", "date": "2022-07", "authors": "Yang Ronghui, Zuo Lingkun, Ma Hui, Zhou Ying, Zhou Ping, Wang Liyong, Wang Miao, Latif Mahrukh, Kong Lu", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "35685460", "url": "https://glygen.org/publication/PubMed/35685460" } ] }, { "title": "Mitochondrial double-stranded RNAs govern the stress response in chondrocytes to promote osteoarthritis development.", "journal": "Cell reports", "date": "2022-08-09", "authors": "Kim Sujin, Lee Keonyong, Choi Yong Seok, Ku Jayoung, Kim Hyeonkyeong, Kharbash Raisa, Yoon Jimin, Lee Yong Seuk, Kim Jin-Hong, Lee Yun Jong, Kim Yoosik", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "35947956", "url": "https://glygen.org/publication/PubMed/35947956" } ] }, { "title": "Protein kinase R dependent phosphorylation of \u03b1-synuclein regulates its membrane binding and aggregation.", "journal": "PNAS nexus", "date": "2022-11", "authors": "Reimer Lasse, Gram Hjalte, Jensen Nanna M\u00f8ller, Betzer Cristine, Yang Li, Jin Lorrain, Shi Min, Boudeffa Driss, Fusco Giuliana, De Simone Alfonso, Kirik Deniz, Lashuel Hilal A, Zhang Jing, Jensen Poul Henning", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "36712380", "url": "https://glygen.org/publication/PubMed/36712380" } ] }, { "title": "Inhibition of RNA-binding proteins with small molecules.", "journal": "Nature reviews. Chemistry", "date": "2020-09", "authors": "Wu Peng", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "37127961", "url": "https://glygen.org/publication/PubMed/37127961" } ] }, { "title": "HIV-1 Tat directly interacts with the interferon-induced, double-stranded RNA-dependent kinase, PKR.", "journal": "Virology", "date": "1995-11-10", "authors": "McMillan N A, Chun R F, Siderovski D P, Galabru J, Toone W M, Samuel C E, Mak T W, Hovanessian A G, Jeang K T, Williams B R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "7491766", "url": "https://glygen.org/publication/PubMed/7491766" } ] }, { "title": "TAR RNA-binding protein is an inhibitor of the interferon-induced protein kinase PKR.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1994-05-24", "authors": "Park H, Davies M V, Langland J O, Chang H W, Nam Y S, Tartaglia J, Paoletti E, Jacobs B L, Kaufman R J, Venkatesan S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "7515177", "url": "https://glygen.org/publication/PubMed/7515177" } ] }, { "title": "The interferon-inducible double-stranded RNA-activated protein kinase self-associates in vitro and in vivo.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1995-08-29", "authors": "Patel R C, Stanton P, McMillan N M, Williams B R, Sen G C", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "7545299", "url": "https://glygen.org/publication/PubMed/7545299" } ] }, { "title": "Expression and regulation by interferon of a double-stranded-RNA-specific adenosine deaminase from human cells: evidence for two forms of the deaminase.", "journal": "Molecular and cellular biology", "date": "1995-10", "authors": "Patterson J B, Samuel C E", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "7565688", "url": "https://glygen.org/publication/PubMed/7565688" } ] }, { "title": "Mechanism of interferon action: evidence for intermolecular autophosphorylation and autoactivation of the interferon-induced, RNA-dependent protein kinase PKR.", "journal": "Journal of virology", "date": "1993-12", "authors": "Thomis D C, Samuel C E", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "7693978", "url": "https://glygen.org/publication/PubMed/7693978" } ] }, { "title": "Nuclear localization of the interferon-inducible protein kinase PKR in human cells and transfected mouse cells.", "journal": "Experimental cell research", "date": "1995-05", "authors": "Jeffrey I W, Kadereit S, Meurs E F, Metzger T, Bachmann M, Schwemmle M, Hovanessian A G, Clemens M J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "7737357", "url": "https://glygen.org/publication/PubMed/7737357" } ] }, { "title": "Organization of the double-stranded RNA-activated protein kinase DAI and virus-associated VA RNAI in adenovirus-2-infected HeLa cells.", "journal": "Journal of cell science", "date": "1993-09", "authors": "Jim\u00e9nez-Garc\u00eda L F, Green S R, Mathews M B, Spector D L", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "7903669", "url": "https://glygen.org/publication/PubMed/7903669" } ] }, { "title": "The P58 cellular inhibitor complexes with the interferon-induced, double-stranded RNA-dependent protein kinase, PKR, to regulate its autophosphorylation and activity.", "journal": "The Journal of biological chemistry", "date": "1996-01-19", "authors": "Polyak S J, Tang N, Wambach M, Barber G N, Katze M G", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "8576172", "url": "https://glygen.org/publication/PubMed/8576172" } ] }, { "title": "Double-stranded (ds) RNA binding and not dimerization correlates with the activation of the dsRNA-dependent protein kinase (PKR).", "journal": "The Journal of biological chemistry", "date": "1996-01-19", "authors": "Wu S, Kaufman R J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "8576179", "url": "https://glygen.org/publication/PubMed/8576179" } ] }, { "title": "Characterization of the heparin-mediated activation of PKR, the interferon-inducible RNA-dependent protein kinase.", "journal": "Virology", "date": "1996-07-01", "authors": "George C X, Thomis D C, McCormack S J, Svahn C M, Samuel C E", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "8661426", "url": "https://glygen.org/publication/PubMed/8661426" } ] }, { "title": "Specific mutations near the amino terminus of double-stranded RNA-dependent protein kinase (PKR) differentially affect its double-stranded RNA binding and dimerization properties.", "journal": "The Journal of biological chemistry", "date": "1996-10-11", "authors": "Patel R C, Stanton P, Sen G C", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "8810342", "url": "https://glygen.org/publication/PubMed/8810342" } ] }, { "title": "E3, a hematopoietic-specific transcript directly regulated by the retinoic acid receptor alpha.", "journal": "Blood", "date": "1996", "authors": "Scott LM, Mueller L, Collins SJ", "evidence": [ { "database": "RefSeq", "id": "NP_001257935", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001257935" } ], "reference": [ { "type": "PubMed", "id": "8839844", "url": "https://glygen.org/publication/PubMed/8839844" } ] }, { "title": "The 58-kDa cellular inhibitor of the double stranded RNA-dependent protein kinase requires the tetratricopeptide repeat 6 and DnaJ motifs to stimulate protein synthesis in vivo.", "journal": "The Journal of biological chemistry", "date": "1996-11-08", "authors": "Tang N M, Ho C Y, Katze M G", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "8910500", "url": "https://glygen.org/publication/PubMed/8910500" } ] }, { "title": "Oncogenic potential of TAR RNA binding protein TRBP and its regulatory interaction with RNA-dependent protein kinase PKR.", "journal": "The EMBO journal", "date": "1997-02-03", "authors": "Benkirane M, Neuveut C, Chun R F, Smith S M, Samuel C E, Gatignol A, Jeang K T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "9034343", "url": "https://glygen.org/publication/PubMed/9034343" } ] }, { "title": "The Tat protein of human immunodeficiency virus type 1 is a substrate and inhibitor of the interferon-induced, virally activated protein kinase, PKR.", "journal": "The Journal of biological chemistry", "date": "1997-03-28", "authors": "Brand S R, Kobayashi R, Mathews M B", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "9079663", "url": "https://glygen.org/publication/PubMed/9079663" } ] }, { "title": "DNA-dependent protein kinase interacts with antigen receptor response element binding proteins NF90 and NF45.", "journal": "The Journal of biological chemistry", "date": "1998-01-23", "authors": "Ting N S, Kao P N, Chan D W, Lintott L G, Lees-Miller S P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "9442054", "url": "https://glygen.org/publication/PubMed/9442054" } ] }, { "title": "Ultrastructural localization of interferon-inducible double-stranded RNA-activated enzymes in human cells.", "journal": "Experimental cell research", "date": "1998-03-15", "authors": "Besse S, Rebouillat D, Marie I, Puvion-Dutilleul F, Hovanessian A G", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "9521856", "url": "https://glygen.org/publication/PubMed/9521856" } ] }, { "title": "Autophosphorylation in the activation loop is required for full kinase activity in vivo of human and yeast eukaryotic initiation factor 2alpha kinases PKR and GCN2.", "journal": "Molecular and cellular biology", "date": "1998", "authors": "Romano PR, Garcia-Barrio MT, Zhang X, Wang Q, Taylor DR, Zhang F, Herring C, Mathews MB, Qin J, Hinnebusch AG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "9528799", "url": "https://glygen.org/publication/PubMed/9528799" } ] }, { "title": "PACT, a protein activator of the interferon-induced protein kinase, PKR.", "journal": "The EMBO journal", "date": "1998", "authors": "Patel RC, Sen GC", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "9687506", "url": "https://glygen.org/publication/PubMed/9687506" } ] }, { "title": "Tumor suppressor p53 as a component of the tumor necrosis factor-induced, protein kinase PKR-mediated apoptotic pathway in human promonocytic U937 cells.", "journal": "The Journal of biological chemistry", "date": "1998-09-25", "authors": "Yeung M C, Lau A S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "9737981", "url": "https://glygen.org/publication/PubMed/9737981" } ] }, { "title": "Requirement of PKR dimerization mediated by specific hydrophobic residues for its activation by double-stranded RNA and its antigrowth effects in yeast.", "journal": "Molecular and cellular biology", "date": "1998-12", "authors": "Patel R C, Sen G C", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "9819388", "url": "https://glygen.org/publication/PubMed/9819388" } ] }, { "title": "The cellular inhibitor of the PKR protein kinase, P58(IPK), is an influenza virus-activated co-chaperone that modulates heat shock protein 70 activity.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Melville MW, Tan SL, Wambach M, Song J, Morimoto RI, Katze MG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "9920933", "url": "https://glygen.org/publication/PubMed/9920933" } ] } ], "pathway": [ { "id": "hsa:201254", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:201254", "resource": "KEGG Pathway" }, { "id": "R-HSA-606279", "name": "Deposition of new CENPA-containing nucleosomes at the centromere", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-606279", "resource": "Reactome", "description": "Deposition of new CENPA-containing nucleosomes at the centromere" }, { "id": "R-HSA-6783310", "name": "Fanconi Anemia Pathway", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783310", "resource": "Reactome", "description": "Fanconi Anemia Pathway" }, { "id": "R-HSA-9833482", "name": "PKR-mediated signaling", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482", "resource": "Reactome", "description": "PKR-mediated signaling" } ], "orthologs": [ { "uniprot_canonical_ac": "Q8C4X1-1", "protein_name": "Centromere protein X", "gene_name": "Cenpx", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MEGNSGFRKELVSRLLHLHFRDCKTKVSGDALQLMAEFLRIFVLEAAVRGVWQAQAEDLDVVEVDQLEKVLPQLLLDF", "length": 78 }, "evidence": [ { "id": "45928032", "url": "http://www.informatics.jax.org/homology/45928032", "database": "MGI" }, { "id": "A8MT69", "url": "https://omabrowser.org/oma/group/A8MT69/", "database": "OMA" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 8, "go_terms": [ { "name": "kinetochore assembly", "id": "GO:0051382", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051382", "evidence": [ { "database": "UniProtKB", "id": "A8MT69", "url": "https://www.uniprot.org/uniprot/A8MT69" } ], "pmid": "" }, { "name": "DNA repair", "id": "GO:0006281", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006281", "evidence": [ { "database": "UniProtKB", "id": "A8MT69", "url": "https://www.uniprot.org/uniprot/A8MT69" } ], "pmid": "" }, { "name": "resolution of meiotic recombination intermediates", "id": "GO:0000712", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000712", "evidence": [ { "database": "UniProtKB", "id": "A8MT69", "url": "https://www.uniprot.org/uniprot/A8MT69" } ], "pmid": "" }, { "name": "chromosome segregation", "id": "GO:0007059", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007059", "evidence": [ { "database": "UniProtKB", "id": "A8MT69", "url": "https://www.uniprot.org/uniprot/A8MT69" } ], "pmid": "" }, { "name": "cell division", "id": "GO:0051301", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051301", "evidence": [ { "database": "UniProtKB", "id": "A8MT69", "url": "https://www.uniprot.org/uniprot/A8MT69" } ], "pmid": "" }, { "name": "positive regulation of protein ubiquitination", "id": "GO:0031398", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031398", "evidence": [ { "database": "UniProtKB", "id": "A8MT69", "url": "https://www.uniprot.org/uniprot/A8MT69" } ], "pmid": "" }, { "name": "interstrand cross-link repair", "id": "GO:0036297", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0036297", "evidence": [ { "database": "UniProtKB", "id": "A8MT69", "url": "https://www.uniprot.org/uniprot/A8MT69" } ], "pmid": "" }, { "name": "replication fork processing", "id": "GO:0031297", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031297", "evidence": [ { "database": "UniProtKB", "id": "A8MT69", "url": "https://www.uniprot.org/uniprot/A8MT69" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "DNA binding", "id": "GO:0003677", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003677", "evidence": [ { "database": "UniProtKB", "id": "A8MT69", "url": "https://www.uniprot.org/uniprot/A8MT69" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 6, "go_terms": [ { "name": "Fanconi anaemia nuclear complex", "id": "GO:0043240", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043240", "evidence": [ { "database": "UniProtKB", "id": "A8MT69", "url": "https://www.uniprot.org/uniprot/A8MT69" } ], "pmid": "" }, { "name": "FANCM-MHF complex", "id": "GO:0071821", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071821", "evidence": [ { "database": "UniProtKB", "id": "A8MT69", "url": "https://www.uniprot.org/uniprot/A8MT69" } ], "pmid": "" }, { "name": "inner kinetochore", "id": "GO:0000939", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000939", "evidence": [ { "database": "UniProtKB", "id": "A8MT69", "url": "https://www.uniprot.org/uniprot/A8MT69" } ], "pmid": "" }, { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "A8MT69", "url": "https://www.uniprot.org/uniprot/A8MT69" } ], "pmid": "" }, { "name": "nucleoplasm", "id": "GO:0005654", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654", "evidence": [ { "database": "UniProtKB", "id": "A8MT69", "url": "https://www.uniprot.org/uniprot/A8MT69" } ], "pmid": "" }, { "name": "chromatin", "id": "GO:0000785", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000785", "evidence": [ { "database": "UniProtKB", "id": "A8MT69", "url": "https://www.uniprot.org/uniprot/A8MT69" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 192 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }