{ "uniprot_canonical_ac": "A6NNC1-1", "uniprot_ac": "A6NNC1", "uniprot_id": "P12LL_HUMAN", "mass": { "chemical_mass": 94058.0, "monoisotopic_mass": 94058.0 }, "refseq": {}, "gene_names": [], "protein_names": [ { "name": "Putative POM121-like protein 1-like", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "A6NNC1" } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "A6NNC1", "url": "https://www.uniprot.org/uniprot/A6NNC1" } ], "common_name": "Human" } ], "gene": [ { "name": "", "url": "https://www.uniprot.org/uniprot/A6NNC1", "locus": {} } ], "crossref": [ { "id": "IPR043220", "url": "https://www.ebi.ac.uk/interpro/entry/IPR043220", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "NX_A6NNC1", "url": "https://www.nextprot.org/entry/NX_A6NNC1", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "A6NNC1", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=A6NNC1", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "PTHR15566", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR15566", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR15566:SF4", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR15566:SF4", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF15229", "url": "http://pfam.xfam.org/family/PF15229", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "A6NNC1", "url": "https://pharos.nih.gov/targets/A6NNC1", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "A6NNC1", "url": "https://www.uniprot.org/uniprot/A6NNC1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A6NNC1-1", "url": "https://www.uniprot.org/uniprot/A6NNC1-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MPEQDKDPRVQENPDDQRTVPEVTGDARSAFWPLRDNGGPSPFVPRPGPLQTDLHAQSSEIRYNHTSQTSWTSSSTKRNAISSSYSSTGGLPGLKQRRGPASSRCQLTLSYSKTVSEDRPQAVSSGHTRCEKGADTAPGQTIAPTGGSPRSQDSRPRRRKIPLLPRRRGEPLMLPPPLELGYRVTAEDLHLEKETAFQRINSALHVEDKAIPDCRPSRPSHTLSSLATGASGGPPVSKAPTMDAQQDRPKSQDSLGLLAPLASAAEVPSTAPVSGKKHRPPGPLFSSSDPLPATSYHSRDTAQVTSLIPATFTAASRDAGMRRTRSAPAAATAAPPPSTLNNTSGSLLNAVDGGPSHFLASATAAARAQRSEVRYNQRSQTSRTRSCLKRNASSSSSSHSSTEGLQELKRRRGPASSHCQLAHSSSNTVSEDGPQAVSSGHRCENKAGTAPGQTLAPRGGSPRSQASRPHINSALYVEDKAISDCRPSRPSHTLSSLATGASGGPPVSKAPTMDAQQDRPKSQDCLGLVAPLASAAEVPSTAPVSGKKHRPPGPLFSSSDPLPATSSHSRDSAQVTSLIPATFTAASRDAGMRRTRPGTSAPAAAAAALPPSTLNPTSGSLLNAVDGGPSHFLASATAAARAQRSEVRYNQRSQTSRTRSCLKRNASSSSHSSTEGLQELKRRRGPASSHCQLAHSSSNTVSEDGPQAVSSGHRCENKAGTAPGQTLAPRGGYPRSQASRPRINSALHVEDKAISDCRPSRPSHTLSSLATGASGGPPVSKAPTMDAQQDRPKSQDCLGLLAPLASAAEVSSTAPVSGKKHRPPGPLFSSSDPLPATSSHSGDSAQDTSLIPAPFTPASRDAGIRRMFRVRNCLRGLGLFLLVFSFFFLLTWASFSF", "length": 897, "header": "sp|A6NNC1-1|P12LL_HUMAN Isoform 1 of Putative POM121-like protein 1-like OS=Homo sapiens OX=9606 GN= PE=5 SV=3 CANONICAL=A6NNC1-1" }, "isoforms": [ { "isoform_ac": "A6NNC1-1", "url": "", "sequence": { "sequence": "MPEQDKDPRVQENPDDQRTVPEVTGDARSAFWPLRDNGGPSPFVPRPGPLQTDLHAQSSEIRYNHTSQTSWTSSSTKRNAISSSYSSTGGLPGLKQRRGPASSRCQLTLSYSKTVSEDRPQAVSSGHTRCEKGADTAPGQTIAPTGGSPRSQDSRPRRRKIPLLPRRRGEPLMLPPPLELGYRVTAEDLHLEKETAFQRINSALHVEDKAIPDCRPSRPSHTLSSLATGASGGPPVSKAPTMDAQQDRPKSQDSLGLLAPLASAAEVPSTAPVSGKKHRPPGPLFSSSDPLPATSYHSRDTAQVTSLIPATFTAASRDAGMRRTRSAPAAATAAPPPSTLNNTSGSLLNAVDGGPSHFLASATAAARAQRSEVRYNQRSQTSRTRSCLKRNASSSSSSHSSTEGLQELKRRRGPASSHCQLAHSSSNTVSEDGPQAVSSGHRCENKAGTAPGQTLAPRGGSPRSQASRPHINSALYVEDKAISDCRPSRPSHTLSSLATGASGGPPVSKAPTMDAQQDRPKSQDCLGLVAPLASAAEVPSTAPVSGKKHRPPGPLFSSSDPLPATSSHSRDSAQVTSLIPATFTAASRDAGMRRTRPGTSAPAAAAAALPPSTLNPTSGSLLNAVDGGPSHFLASATAAARAQRSEVRYNQRSQTSRTRSCLKRNASSSSHSSTEGLQELKRRRGPASSHCQLAHSSSNTVSEDGPQAVSSGHRCENKAGTAPGQTLAPRGGYPRSQASRPRINSALHVEDKAISDCRPSRPSHTLSSLATGASGGPPVSKAPTMDAQQDRPKSQDCLGLLAPLASAAEVSSTAPVSGKKHRPPGPLFSSSDPLPATSSHSGDSAQDTSLIPAPFTPASRDAGIRRMFRVRNCLRGLGLFLLVFSFFFLLTWASFSF", "length": 897, "header": "sp|A6NNC1-1|P12LL_HUMAN Isoform 1 of Putative POM121-like protein 1-like OS=Homo sapiens OX=9606 GN= PE=5 SV=3 CANONICAL=A6NNC1-1" }, "locus": {} } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 496, "start_aa": "Ser", "end_pos": 496, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser496", "evidence": [ { "id": "A6NNC1", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=A6NNC1" }, { "id": "38253038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/38253038" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 502, "start_aa": "Ser", "end_pos": 502, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser502", "evidence": [ { "id": "A6NNC1", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=A6NNC1" }, { "id": "38253038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/38253038" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 508, "start_aa": "Ser", "end_pos": 508, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser508", "evidence": [ { "id": "A6NNC1", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=A6NNC1" }, { "id": "38253038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/38253038" } ] } ], "phosphorylation": [], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "Studying the O-GlcNAcome of human placentas using banked tissue samples.", "journal": "Glycobiology", "date": "2024-01-22", "authors": "Luna Sarai, Malard Florian, Pereckas Michaela, Aoki Mayumi, Aoki Kazahiro, Olivier-Van Stichelen Stephanie", "evidence": [ { "database": "O-GlcNAc Database", "id": "A6NNC1", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=A6NNC1" } ], "reference": [ { "type": "PubMed", "id": "38253038", "url": "https://glygen.org/publication/PubMed/38253038" } ] }, { "title": "Identification of multiple transcribed sequences from the spinal muscular atrophy region of human chromosome 5.", "journal": "Biochem. Biophys. Res. Commun.", "date": "1995", "authors": "Pizzuti A, Colosimo A, Ratti A, Capon F, Gennarelli M, Silani V, Ghezzi C, Lo Cicero S, Calabrese G, Palka G", "evidence": [ { "database": "UniProtKB", "id": "A6NNC1", "url": "https://www.uniprot.org/uniprot/A6NNC1" } ], "reference": [ { "type": "PubMed", "id": "7818533", "url": "https://glygen.org/publication/PubMed/7818533" } ] }, { "title": "Novel transcribed sequences represented in the complex genomic region 5q13.", "journal": "Biochim. Biophys. Acta", "date": "1996", "authors": "Morrison K E, Qureshi S J, Anderson S, Borrett J P, Theodosiou A, Rodrigues N, Blake D, Nesbit A, Davies K E, Porteous D J, Brookes A J", "evidence": [ { "database": "UniProtKB", "id": "A6NNC1", "url": "https://www.uniprot.org/uniprot/A6NNC1" } ], "reference": [ { "type": "PubMed", "id": "8764824", "url": "https://glygen.org/publication/PubMed/8764824" } ] } ], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "A6NNC1", "url": "https://www.uniprot.org/uniprot/A6NNC1" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 341, "end_pos": 343, "annotation": "n_glycosylation_sequon" }, { "start_pos": 342, "end_pos": 344, "annotation": "n_glycosylation_sequon" }, { "start_pos": 391, "end_pos": 393, "annotation": "n_glycosylation_sequon" }, { "start_pos": 64, "end_pos": 66, "annotation": "n_glycosylation_sequon" }, { "start_pos": 665, "end_pos": 667, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [ 496, 502, 508 ], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 341, "end_pos": 343 }, { "start_pos": 342, "end_pos": 344 }, { "start_pos": 391, "end_pos": 393 }, { "start_pos": 64, "end_pos": 66 }, { "start_pos": 665, "end_pos": 667 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 3 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 3 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }