{ "uniprot_canonical_ac": "A6NM76-1", "uniprot_ac": "A6NM76", "uniprot_id": "O6C76_HUMAN", "mass": { "chemical_mass": 35119.0, "monoisotopic_mass": 35119.0 }, "refseq": { "ac": "NP_001005183", "name": "olfactory receptor 6C76 isoform 1", "summary": "Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. [provided by RefSeq, Jul 2008].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001005183" }, "gene_names": [ { "name": "OR6C76", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A6NM76", "id": "A6NM76" }, { "name": "OR6C76", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001005183", "id": "NP_001005183" } ], "protein_names": [ { "name": "Olfactory receptor 6C76", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "A6NM76" }, { "name": "olfactory receptor 6C76 isoform 1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001005183", "id": "NP_001005183" }, { "name": "olfactory receptor 6C76", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001005183", "id": "NP_001005183" } ], "function": [ { "annotation": "Odorant receptor.", "evidence": [ { "database": "UniProtKB", "id": "A6NM76", "url": "https://www.uniprot.org/uniprot/A6NM76#function" } ] }, { "annotation": "Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. [provided by RefSeq, Jul 2008].", "evidence": [ { "database": "RefSeq", "id": "NP_001005183", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001005183" } ] } ], "disease": [], "snv": [ { "evidence": [ { "id": "rs1445249456", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1445249456" }, { "id": "rs1445249456", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1445249456#frequency_tab" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 258, "end_pos": 258, "sequence_org": "K", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (KTS->NTS).", "chr_id": "12", "chr_pos": "55427027", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "K258", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "A6NM76", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A6NM76" } ], "glycoeffect": [], "start_pos": 39, "end_pos": 39, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "G", "sequence_mut": "E", "comment": "Somatic mutation passed 1 out of 6 filters: num. of cancers (3).", "chr_id": "12", "chr_pos": "55426369", "ref_nt": "G", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "G39", "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] }, { "disease_id": "DOID:4159", "recommended_name": { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "skin cancer", "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells." }, "synonyms": [ { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "CA - skin cancer", "description": "" }, { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "malignant neoplasm of skin", "description": "" }, { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "melanoma and Non-melanoma skin cancer", "description": "" } ] }, { "disease_id": "DOID:1115", "recommended_name": { "id": "DOID:1115", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1115", "name": "sarcoma", "description": "A cell type cancer that has_material_basis_in abnormally proliferating cells derives from embryonic mesoderm." }, "synonyms": [ { "id": "DOID:1115", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1115", "name": "connective and soft tissue neoplasm", "description": "" }, { "id": "DOID:1115", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1115", "name": "tumor of soft tissue and skeleton", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs768848732", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs768848732" }, { "id": "rs768848732", "database": "NCI-TCGA", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs768848732" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 3, "end_pos": 3, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NRT->IRT).", "chr_id": "12", "chr_pos": "55426257", "ref_nt": "l", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N3", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs767739616", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs767739616" }, { "id": "rs767739616", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs767739616" }, { "id": "rs767739616", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs767739616#frequency_tab" }, { "id": "rs767739616", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs767739616" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 3, "end_pos": 3, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NRT->KRT).", "chr_id": "12", "chr_pos": "55426262", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N3", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs773481240", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs773481240" }, { "id": "rs773481240", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs773481240" }, { "id": "rs773481240", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs773481240" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 5, "end_pos": 5, "sequence_org": "T", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NRT->NRA).", "chr_id": "12", "chr_pos": "55426266", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T5", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs751291885", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs751291885" }, { "id": "rs751291885", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs751291885" }, { "id": "rs751291885", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs751291885#frequency_tab" }, { "id": "rs751291885", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs751291885" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 5, "end_pos": 5, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NRT->NRI).", "chr_id": "12", "chr_pos": "55426267", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T5", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs758932846", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs758932846" }, { "id": "rs758932846", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs758932846" }, { "id": "rs758932846", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs758932846#frequency_tab" }, { "id": "rs758932846", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs758932846" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 94, "end_pos": 94, "sequence_org": "C", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NAC->NAS).", "chr_id": "12", "chr_pos": "55426534", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "C94", "keywords": [ "ebi", "germline" ] } ], "mutagenesis": [], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "28.57", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000185821", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000185821" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "16.41", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000185821", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000185821" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "17.43", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000185821", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000185821" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "16.94", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000185821", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000185821" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "24.73", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000185821", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000185821" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "19.28", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000185821", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000185821" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "16.88", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000185821", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000185821" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "14.41", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000185821", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000185821" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "17.67", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000185821", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000185821" } ] } ], "expression_disease": [ { "significant": "No", "trend": "down", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "A6NM76", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A6NM76" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "A6NM76", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A6NM76" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "A6NM76", "url": "https://www.uniprot.org/uniprot/A6NM76" } ], "common_name": "Human" } ], "gene": [ { "name": "OR6C76", "url": "https://www.uniprot.org/uniprot/A6NM76", "locus": { "chromosome": "12", "start_pos": 55427192, "end_pos": 55426254, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000185821", "url": "https://www.ensembl.org/id/ENSG00000185821" } ] } } ], "crossref": [ { "id": "ENSG00000185821", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000185821", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "A6NM76", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A6NM76", "database": "BioMuta", "categories": [ "Variation" ] }, { "id": "cd15912", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd15912", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "OR6C76", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=OR6C76", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "390326", "url": "https://www.ncbi.nlm.nih.gov/gene/390326", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "31305", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=31305", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "IPR000276", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000276", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR000725", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000725", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR017452", "url": "https://www.ebi.ac.uk/interpro/entry/IPR017452", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR047132", "url": "https://www.ebi.ac.uk/interpro/entry/IPR047132", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:390326", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:390326", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "NX_A6NM76", "url": "https://www.nextprot.org/entry/NX_A6NM76", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "KICYQLV", "url": "https://omabrowser.org/oma/group/KICYQLV/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5401587at2759", "url": "http://www.orthodb.org/?query=5401587at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR26454", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR26454", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR26454:SF18", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR26454:SF18", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF13853", "url": "http://pfam.xfam.org/family/PF13853", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "A6NM76", "url": "https://pharos.nih.gov/targets/A6NM76", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_A6NM76", "url": "http://purl.obolibrary.org/obo/PR_A6NM76", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-9752946", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9752946", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001005183", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001005183", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A6NM76", "url": "https://www.uniprot.org/uniprot/A6NM76", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A6NM76-1", "url": "https://www.uniprot.org/uniprot/A6NM76-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MKNRTSVTDFILLGLTDNPQLQVVIFSFLFLTYVLSVTGNLTIISLTLLDSHLKTPMYFFLRNFSLEISFTSVCNPRFLISILTGDKSISYNACAAQLFFFIFLGSTEFFLLASMSYDCYVAICKPLHYTTIMSDRICYQLIISSWLAGFLVIFPPLAMGLQLDFCDSNVIDHFTCDSAPLLQISCTDTSTLELMSFILALFTLISTLILVILSYTYIIRTILRIPSAQQRKKAFSTCSSHVIVVSISYGSCIFMYVKTSAKEGVALTKGVAILNTSVAPMLNPFIYTLRNQQVKQAFKDVLRKISHKKKKH", "length": 312, "header": "sp|A6NM76-1|O6C76_HUMAN Isoform 1 of Olfactory receptor 6C76 OS=Homo sapiens OX=9606 GN=OR6C76 PE=3 SV=1 CANONICAL=A6NM76-1" }, "isoforms": [ { "isoform_ac": "A6NM76-1", "url": "", "sequence": { "sequence": "MKNRTSVTDFILLGLTDNPQLQVVIFSFLFLTYVLSVTGNLTIISLTLLDSHLKTPMYFFLRNFSLEISFTSVCNPRFLISILTGDKSISYNACAAQLFFFIFLGSTEFFLLASMSYDCYVAICKPLHYTTIMSDRICYQLIISSWLAGFLVIFPPLAMGLQLDFCDSNVIDHFTCDSAPLLQISCTDTSTLELMSFILALFTLISTLILVILSYTYIIRTILRIPSAQQRKKAFSTCSSHVIVVSISYGSCIFMYVKTSAKEGVALTKGVAILNTSVAPMLNPFIYTLRNQQVKQAFKDVLRKISHKKKKH", "length": 312, "header": "sp|A6NM76-1|O6C76_HUMAN Isoform 1 of Olfactory receptor 6C76 OS=Homo sapiens OX=9606 GN=OR6C76 PE=3 SV=1 CANONICAL=A6NM76-1" }, "locus": { "chromosome": "12", "start_pos": 55427189, "end_pos": 55426254, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000328314.3", "url": "https://www.ensembl.org/id/ENST00000328314.3" }, { "database": "Ensembl Peptide", "id": "ENSP00000328402.3", "url": "https://www.ensembl.org/id/ENSP00000328402.3" } ] } } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 3, "start_aa": "Asn", "end_pos": 3, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3", "evidence": [ { "id": "A6NM76", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A6NM76#ptm_processing" } ] } ], "phosphorylation": [], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_predicted" ], "publication": [ { "title": "Profiling of olfactory receptor gene expression in whole human olfactory mucosa.", "journal": "PloS one", "date": "2014", "authors": "Verbeurgt C, Wilkin F, Tarabichi M, Gregoire F, Dumont JE, Chatelain P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9752946", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9752946" } ], "reference": [ { "type": "PubMed", "id": "24800820", "url": "https://glygen.org/publication/PubMed/24800820" } ] }, { "title": "The human olfactory transcriptome.", "journal": "BMC genomics", "date": "2016", "authors": "Olender T, Keydar I, Pinto JM, Tatarskyy P, Alkelai A, Chien MS, Fishilevich S, Restrepo D, Matsunami H, Gilad Y, Lancet D", "evidence": [ { "database": "Reactome", "id": "R-HSA-9752946", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9752946" } ], "reference": [ { "type": "PubMed", "id": "27515280", "url": "https://glygen.org/publication/PubMed/27515280" } ] }, { "title": "Structural instability and divergence from conserved residues underlie intracellular retention of mammalian odorant receptors.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2020", "authors": "Ikegami K, de March CA, Nagai MH, Ghosh S, Do M, Sharma R, Bruguera ES, Lu YE, Fukutani Y, Vaidehi N, Yohda M, Matsunami H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9752946", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9752946" } ], "reference": [ { "type": "PubMed", "id": "31974307", "url": "https://glygen.org/publication/PubMed/31974307" } ] }, { "title": "Single-cell analysis of olfactory neurogenesis and differentiation in adult humans.", "journal": "Nature neuroscience", "date": "2020", "authors": "Durante MA, Kurtenbach S, Sargi ZB, Harbour JW, Choi R, Kurtenbach S, Goss GM, Matsunami H, Goldstein BJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9752946", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9752946" } ], "reference": [ { "type": "PubMed", "id": "32066986", "url": "https://glygen.org/publication/PubMed/32066986" } ] } ], "pathway": [ { "id": "hsa:390326", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:390326", "resource": "KEGG Pathway" }, { "id": "R-HSA-9752946", "name": "Expression and translocation of olfactory receptors", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9752946", "resource": "Reactome", "description": "Expression and translocation of olfactory receptors" } ], "orthologs": [ { "uniprot_canonical_ac": "A0A8I5ZP76-1", "protein_name": "Olfactory receptor", "gene_name": "Or6c76b", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MRNRTSVTYFILLGLTDDPELQVVIFFFLFLTYMLSITGNLTIITLTLLDSHLKTPMYFFLRNFSFLEISFTSVCNPRFLVSILTKDKSISYNACVAQLFFFIFLGSTEFFLLASMSYDRYVAICKPLHYTTIISNKICHQLIISSWLAGFLVIFPPLAMGLELDFCDSNIIDHFTCDSAPLLQISCTDTSTLELMSFILALITLMTTLMLIILSYTCILRTILKFPSAKQREKAFATCSSHMIVVSISYGSCIFMYVKTSAKAGVALTKGVAMLNTSVAPMLNPFIYTLRNQQVKQAFKDLVRRKLASKC", "length": 311 }, "evidence": [ { "id": "45916908", "url": "http://www.informatics.jax.org/homology/45916908", "database": "MGI" }, { "id": "45916902", "url": "http://www.informatics.jax.org/homology/45916902", "database": "MGI" }, { "id": "A6NM76", "url": "https://omabrowser.org/oma/group/A6NM76/", "database": "OMA" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "D3ZQZ1-1", "protein_name": "Olfactory receptor", "gene_name": "Or6c66b", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MPNKTAITEFILLGLTDDPELQILIFFFLLTTYLLSVSGNMTIITLTLSNILLKTPMYFFLRNFSFLEILFTTVCIPRFLISIATGNKAISYNACMAQVFFLIFLGATEFFLLAAMSYDRYVAICKPLHYTTIISNKVCNQLVIASWSAGFLIVFPPVIMGIQLEFCDSNIIDHFACDSSPMLQIACTDTKILELMAFFLAVFTLIVTLALVILSYTLILRAILKIPSAEQRKKAFSTCSSHMIVVSISYGSCIFMYVKTSARDGVVLSKGVAMLNTSVAPMLNPFIYTLRNQQVKQAFKDFVKILLPSNKH", "length": 312 }, "evidence": [ { "id": "45916931", "url": "http://www.informatics.jax.org/homology/45916931", "database": "MGI" }, { "id": "45916935", "url": "http://www.informatics.jax.org/homology/45916935", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "F1SQE8-1", "protein_name": "Olfactory receptor", "gene_name": "LOC106507488", "tax_id": 9823, "organism": "Sus scrofa", "sequence": { "sequence": "MRNRTSVTEFILLGLTDNPELQAVIFFFLLLTYVLSVTGNLTIIVLTLLHSHLKTPMYFFLRNFSFLEISFTSVCNPRFLVSILTGDKSISYNACAAQLFFFILLGSTEFFLLASMSYDRYVAICKPLHYPTIMSHKVCYQLVGSSWLAGFLVIFPPLTMGLQLDFCDTNVIDHFTCDSAPLLHISCTDTSTLELMSFALAVLTLMSTLTLVILSYCYILRTMLRIPSAQQRKKAFSTCSSHMIVVSISYGSCIFMYVKTSAKEGVALTKGVAVLNTSVAPMLNPFIYTLRNQQVKQAFKDLTRKILSSKTLT", "length": 313 }, "evidence": [ { "id": "A6NM76", "url": "https://omabrowser.org/oma/group/A6NM76/", "database": "OMA" } ], "common_name": "Pig" }, { "uniprot_canonical_ac": "Q7TRH5-1", "protein_name": "Olfactory receptor", "gene_name": "Or6c76b", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MRNRTSVTYFILLGLTDDPELEVVIFFFLFLTYLLSITGNLTIITLTLLDSHLKTPMYFFLRNFSFLEISFTSVCNPRFLVSILTKDKSISYNACVAQLFFFIFLGSTEFFLLASMSYDRYVAICKPLHYTTIISNKICHQLIISSWLAGFLVIFPPLAMGLELDFCDSNIIDHFTCDSAPLLQISCTDTSTLELMSFILALITLMTTLMLIILSYICILRTILKFPSAKQREKAFSTCSSHMIVISISYGSCIFMYVKTSAKAGVALTKGVAMLNTSVAPMLNPFIYTLRNQQVKQAFKDLVRRKLASK", "length": 310 }, "evidence": [ { "id": "45916902", "url": "http://www.informatics.jax.org/homology/45916902", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q7TRH6-1", "protein_name": "Olfactory receptor", "gene_name": "Or6c76", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MRNRTSVTYFILLGLTDDPELQVVIFFFLFLTYLLSITGNLTIITLTLLDSHLKTPMYFFLRNFSFLEISFTSVCNPRFLVSILTKDKSISYNACAAQLFFFIFLGSTEFFLLASMSYDRYVAICKPLHYTTIISNKICHQLIISSWLAGFLVVFPPLAMGLDLDFCDSNTIDHFTCDSAPLLQISCTDTSTLELMSFILALITLMTTLMLIILSYTCILRTILKFPSAKQREKAFSTCSSHMIVVSISYGSCIFMYVKTSAKAGVALTKGVAMLNTSVAPMLNPFIYTLRNQQVKQAFKDLVRKKLASKLLI", "length": 313 }, "evidence": [ { "id": "45916908", "url": "http://www.informatics.jax.org/homology/45916908", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q7TRH8-1", "protein_name": "Olfactory receptor", "gene_name": "Or6c66", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MKNRTSVSEFILLGLTSDPKLNILIFIFLFITYILSITGNLTIITLTLIDSHLKTPMYFFLRNFSFLEISFTTVSIPRFLVSIVTGDMTISYNSCMAQVFFFILLGSTEFFLLTAMSYDRYVAICKPLHYTTIMNSRVCMQLIVSSWLAGFLIIFPPVIMGLQLDFCDSNIIDHFTCDSSPMLLISCTDTAFLELLAFFLAVFTLMVTLTLVILSYSFILRTILRIPSAEQRKKAFSTCSSHMIVVSISYGSCIFMYVKTSAKEGVALTKGIAVLNTSVAPMLNPFIYSLRNKQVKESFRNLIKKCISNKI", "length": 311 }, "evidence": [ { "id": "45916931", "url": "http://www.informatics.jax.org/homology/45916931", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q7TRH9-1", "protein_name": "Olfactory receptor", "gene_name": "Or6c66b", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MKNRTSVSEFILLGLTNDPKLNILIFVFLFITYILSITGNLTIITLTLIDSHLKTPMYFFLRNFSFLEISFTTVSIPRFLVSIVTGDMTISYSSCLAQEFFFILLGATEFFLLTAMSYDRYVAICKPLHYTTIMSSRVCMQLIVSSWLAGFLIIFPPVIMGLQLDFCDSNIIDHFTCDSSPLLLISCTDTAFLELFAFFLAVLTLIVTLTLVILSYSFILRTILRIPSAEQRKKAFSTCSSHMIVVSISYGSCIFMYVKTSAKEGVTLTKGIAVLNTSVAPMLNPFIYTLRNKQVKEAFKTLIKKRFSNKI", "length": 311 }, "evidence": [ { "id": "45916935", "url": "http://www.informatics.jax.org/homology/45916935", "database": "MGI" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "G protein-coupled receptor activity", "id": "GO:0004930", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004930", "evidence": [ { "database": "UniProtKB", "id": "A6NM76", "url": "https://www.uniprot.org/uniprot/A6NM76" } ], "pmid": "" }, { "name": "olfactory receptor activity", "id": "GO:0004984", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004984", "evidence": [ { "database": "UniProtKB", "id": "A6NM76", "url": "https://www.uniprot.org/uniprot/A6NM76" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "A6NM76", "url": "https://www.uniprot.org/uniprot/A6NM76" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 275, "end_pos": 277, "annotation": "n_glycosylation_sequon" }, { "start_pos": 3, "end_pos": 5, "annotation": "n_glycosylation_sequon" }, { "start_pos": 40, "end_pos": 42, "annotation": "n_glycosylation_sequon" }, { "start_pos": 63, "end_pos": 65, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [ 3 ], "o_linked_sites": [], "snv_sites": [ 3, 5, 39, 94, 258 ], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 275, "end_pos": 277 }, { "start_pos": 3, "end_pos": 5 }, { "start_pos": 40, "end_pos": 42 }, { "start_pos": 63, "end_pos": 65 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 1 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 1 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 7 }, { "field": "total_sites", "count": 5 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 6 }, { "field": "total_sites", "count": 4 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }