{ "uniprot_canonical_ac": "A6NKQ9-1", "uniprot_ac": "A6NKQ9", "uniprot_id": "CGB1_HUMAN", "mass": { "chemical_mass": 20468.0, "monoisotopic_mass": 20468.0 }, "refseq": { "ac": "NP_203695", "name": "choriogonadotropin subunit beta variant 1 isoform 1 precursor", "summary": "The beta subunit of chorionic gonadotropin (CGB) is encoded by six highly homologous and structurally similar genes that are arranged in tandem and inverted pairs on chromosome 19q13.3, and contiguous with the luteinizing hormone beta (LHB) subunit gene. The CGB genes are primarily distinguished by differences in the 5' untranscribed region. This gene was originally thought to be one of the two pseudogenes (CGB1 and CGB2) of CGB subunit, however, detection of CGB1 and CGB2 transcripts in vivo, and their presence on the polysomes, suggested that these transcripts are translated. To date, a protein product corresponding to CGB1 has not been isolated. The deduced sequence of the hypothetical protein of 132 aa does not share any similarity with that of functional CGB subunits (PMID:8954017). However, a 155 aa protein, translated from a different frame, is about the same size, and shares 98% identity with other CGB subunits. [provided by RefSeq, Jul 2008].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_203695" }, "gene_names": [ { "name": "CGB1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A6NKQ9", "id": "A6NKQ9" }, { "name": "CGB1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_203695", "id": "NP_203695" } ], "protein_names": [ { "name": "Choriogonadotropin subunit beta variant 1", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "A6NKQ9" }, { "name": "choriogonadotropin subunit beta variant 1 isoform 1 precursor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_203695", "id": "NP_203695" }, { "name": "chorionic gonadotropin, beta polypeptide 1; chorionic gonadotropin beta subunit 1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_203695", "id": "NP_203695" } ], "function": [ { "annotation": "The beta subunit of chorionic gonadotropin (CGB) is encoded by six highly homologous and structurally similar genes that are arranged in tandem and inverted pairs on chromosome 19q13.3, and contiguous with the luteinizing hormone beta (LHB) subunit gene. The CGB genes are primarily distinguished by differences in the 5' untranscribed region. This gene was originally thought to be one of the two pseudogenes (CGB1 and CGB2) of CGB subunit, however, detection of CGB1 and CGB2 transcripts in vivo, and their presence on the polysomes, suggested that these transcripts are translated. To date, a protein product corresponding to CGB1 has not been isolated. The deduced sequence of the hypothetical protein of 132 aa does not share any similarity with that of functional CGB subunits (PMID:8954017). However, a 155 aa protein, translated from a different frame, is about the same size, and shares 98% identity with other CGB subunits. [provided by RefSeq, Jul 2008].", "evidence": [ { "database": "RefSeq", "id": "NP_203695", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_203695" } ] }, { "annotation": "The presence of CGB1 and CGB2 transcripts in 41% of analyzed ovarian cancer cases, is reported. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_203695", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_203695" }, { "database": "PubMed", "id": "23774837", "url": "https://glygen.org/publication/PubMed/23774837" } ] }, { "annotation": "These data provide new insight into the roles and mechanisms of b-hCG in regulating Epithelial ovarian cancer (EOC metastasis through ERK/MMP2 signaling pathway and may become a new target for therapeutic intervention.", "evidence": [ { "database": "RefSeq", "id": "NP_203695", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_203695" }, { "database": "PubMed", "id": "30582718", "url": "https://glygen.org/publication/PubMed/30582718" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "39.88", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000267335", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000267335" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "16.41", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000267335", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000267335" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "17.43", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000267335", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000267335" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "16.94", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000267335", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000267335" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "35.82", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000267335", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000267335" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "31", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000267335", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000267335" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "21.55", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000267335", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000267335" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "32.56", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000267335", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000267335" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "38.57", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000267335", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000267335" } ] } ], "expression_disease": [ { "significant": "No", "trend": "up", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "A6NKQ9", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A6NKQ9" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "A6NKQ9", "url": "https://www.uniprot.org/uniprot/A6NKQ9" } ], "common_name": "Human" } ], "gene": [ { "name": "CGB1", "url": "https://www.uniprot.org/uniprot/A6NKQ9", "locus": { "chromosome": "19", "start_pos": 49035569, "end_pos": 49036895, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000267631", "url": "https://www.ensembl.org/id/ENSG00000267631" } ] } } ], "crossref": [ { "id": "ENSG00000267335", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000267335", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "ENSG00000267631", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000267631", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd00069", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00069", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "CGB1", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=CGB1", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "ENSG00000267335", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=ENSG00000267335", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "114335", "url": "https://www.ncbi.nlm.nih.gov/gene/114335", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "16721", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=16721", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "A6NKQ9", "url": "https://www.ebi.ac.uk/intact/interactors/id:A6NKQ9*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR001545", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001545", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR006208", "url": "https://www.ebi.ac.uk/interpro/entry/IPR006208", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR018245", "url": "https://www.ebi.ac.uk/interpro/entry/IPR018245", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR029034", "url": "https://www.ebi.ac.uk/interpro/entry/IPR029034", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:114335", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:114335", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "608823", "url": "http://www.omim.org/entry/608823", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_A6NKQ9", "url": "https://www.nextprot.org/entry/NX_A6NKQ9", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "A6NKQ9", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=A6NKQ9", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "EACPFCI", "url": "https://omabrowser.org/oma/group/EACPFCI/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "FCRPINA", "url": "https://omabrowser.org/oma/group/FCRPINA/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "2945053at2759", "url": "http://www.orthodb.org/?query=2945053at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR11515", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11515", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11515:SF25", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11515:SF25", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00007", "url": "http://pfam.xfam.org/family/PF00007", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "A6NKQ9", "url": "https://pharos.nih.gov/targets/A6NKQ9", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_A6NKQ9", "url": "http://purl.obolibrary.org/obo/PR_A6NKQ9", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_203695", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_203695", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A6NKQ9", "url": "https://www.uniprot.org/uniprot/A6NKQ9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A6NKQ9-1", "url": "https://www.uniprot.org/uniprot/A6NKQ9-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A6NKQ9-2", "url": "https://www.uniprot.org/uniprot/A6NKQ9-2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "K7ELM3", "url": "https://www.uniprot.org/uniprot/K7ELM3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "K7ELM3-1", "url": "https://www.uniprot.org/uniprot/K7ELM3-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "S4R385", "url": "https://www.uniprot.org/uniprot/S4R385", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "S4R385-1", "url": "https://www.uniprot.org/uniprot/S4R385-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MSTFPVLAEDIPLRERHVKGRVDPHFRAPKMEMFQRLLLLLLLSMGGTWASKEPLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMTRVLQGVLPALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQDSSSSKAPPPSLPSPSRLPGP", "length": 187, "header": "sp|A6NKQ9-1|CGB1_HUMAN Isoform 1 of Choriogonadotropin subunit beta variant 1 OS=Homo sapiens OX=9606 GN=CGB1 PE=2 SV=3 CANONICAL=A6NKQ9-1" }, "isoforms": [ { "isoform_ac": "A6NKQ9-1", "url": "", "sequence": { "sequence": "MSTFPVLAEDIPLRERHVKGRVDPHFRAPKMEMFQRLLLLLLLSMGGTWASKEPLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMTRVLQGVLPALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQDSSSSKAPPPSLPSPSRLPGP", "length": 187, "header": "sp|A6NKQ9-1|CGB1_HUMAN Isoform 1 of Choriogonadotropin subunit beta variant 1 OS=Homo sapiens OX=9606 GN=CGB1 PE=2 SV=3 CANONICAL=A6NKQ9-1" }, "locus": {} }, { "isoform_ac": "A6NKQ9-2", "url": "", "sequence": { "sequence": "MSKRLLLLLLLSMGGTWASKEPLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMTRVLQGVLPALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQDSSSSKAPPPSLPSPSRLPGP", "length": 155, "header": "sp|A6NKQ9-2|CGB1_HUMAN Isoform 2 of Choriogonadotropin subunit beta variant 1 OS=Homo sapiens OX=9606 GN=CGB1 PE=2 SV=3 CANONICAL=A6NKQ9-1" }, "locus": { "chromosome": "19", "start_pos": 49036711, "end_pos": 49035613, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000301407.8", "url": "https://www.ensembl.org/id/ENST00000301407.8" }, { "database": "Ensembl Peptide", "id": "ENSP00000301407.6", "url": "https://www.ensembl.org/id/ENSP00000301407.6" } ] } }, { "isoform_ac": "K7ELM3-1", "url": "", "sequence": { "sequence": "MGGTWASKEPLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMTRVLQGVLPALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQDSSSSKA", "length": 129, "header": "tr|K7ELM3-1|CGB1_HUMAN Computationally mapped isoform of Choriogonadotropin subunit beta variant 1 OS=Homo sapiens OX=9606 GN=CGB1 PE=2 SV=8 CANONICAL=A6NKQ9-1" }, "locus": { "chromosome": "19", "start_pos": 49036276, "end_pos": 49035655, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000601167.1", "url": "https://www.ensembl.org/id/ENST00000601167.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000472896.2", "url": "https://www.ensembl.org/id/ENSP00000472896.2" } ] } }, { "isoform_ac": "S4R385-1", "url": "", "sequence": { "sequence": "MSKGLLLLLLLSMGGTWASKEPLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMTRVLQGVLPALPQVVCNY", "length": 77, "header": "tr|S4R385-1|S4R385_HUMAN Computationally mapped isoform of Glycoprotein hormone subunit beta domain-containing protein OS=Homo sapiens OX=9606 GN= PE=3 SV=1 CANONICAL=A6NKQ9-1" }, "locus": { "chromosome": "19", "start_pos": 49036711, "end_pos": 49023147, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000604577.1", "url": "https://www.ensembl.org/id/ENST00000604577.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000474022.1", "url": "https://www.ensembl.org/id/ENSP00000474022.1" } ] } } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 63, "start_aa": "Asn", "end_pos": 63, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn63", "evidence": [ { "id": "A6NKQ9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A6NKQ9#ptm_processing" }, { "id": "23090970", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23090970" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" }, { "id": "24190977", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24190977" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 80, "start_aa": "Asn", "end_pos": 80, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn80", "evidence": [ { "id": "A6NKQ9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A6NKQ9#ptm_processing" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "evidence": [ { "id": "A6NKQ9", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=A6NKQ9" }, { "id": "29485866", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29485866" } ] } ], "phosphorylation": [], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported", "glycoprotein_predicted", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "Chorionic gonadotropin has a recent origin within primates and an evolutionary history of selection.", "journal": "Mol. Biol. Evol.", "date": "2002", "authors": "Maston GA, Ruvolo M", "evidence": [ { "database": "UniProtKB", "id": "A6NKQ9", "url": "https://www.uniprot.org/uniprot/A6NKQ9" } ], "reference": [ { "type": "PubMed", "id": "11861891", "url": "https://glygen.org/publication/PubMed/11861891" } ] }, { "title": "Expression of beta-subunit of HCG genes during normal and failed pregnancy.", "journal": "Hum. Reprod.", "date": "2005", "authors": "Rull K, Laan M", "evidence": [ { "database": "UniProtKB", "id": "A6NKQ9", "url": "https://www.uniprot.org/uniprot/A6NKQ9" } ], "reference": [ { "type": "PubMed", "id": "16123088", "url": "https://glygen.org/publication/PubMed/16123088" } ] }, { "title": "Fine-scale quantification of HCG beta gene transcription in human trophoblastic and non-malignant non-trophoblastic tissues.", "journal": "Mol. Hum. Reprod.", "date": "2008", "authors": "Rull K, Hallast P, Uuskula L, Jackson J, Punab M, Salumets A, Campbell RK, Laan M", "evidence": [ { "database": "UniProtKB", "id": "A6NKQ9", "url": "https://www.uniprot.org/uniprot/A6NKQ9" } ], "reference": [ { "type": "PubMed", "id": "18048458", "url": "https://glygen.org/publication/PubMed/18048458" } ] }, { "title": "Quantification of the N-glycosylated secretome by super-SILAC during breast cancer progression and in human blood samples.", "journal": "Molecular & cellular proteomics : MCP", "date": "2013", "authors": "Boersema PJ, Geiger T, Wisniewski JR, Mann M", "evidence": [ { "database": "GlyGen", "id": "GLY_000143", "url": "https://data.glygen.org/GLY_000143" } ], "reference": [ { "type": "PubMed", "id": "23090970", "url": "https://glygen.org/publication/PubMed/23090970" } ] }, { "title": "Human chorionic gonadotropin beta subunit genes CGB1 and CGB2 are transcriptionally active in ovarian cancer.", "journal": "International journal of molecular sciences", "date": "2013", "authors": "Kubiczak M, Walkowiak GP, Nowak-Markwitz E, Jankowska A", "evidence": [ { "database": "RefSeq", "id": "NP_203695", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_203695" } ], "reference": [ { "type": "PubMed", "id": "23774837", "url": "https://glygen.org/publication/PubMed/23774837" } ] }, { "title": "N-linked glycosylation enrichment for in-depth cell surface proteomics of diffuse large B-cell lymphoma subtypes.", "journal": "Molecular & cellular proteomics : MCP", "date": "2014", "authors": "Deeb SJ, Cox J, Schmidt-Supprian M, Mann M", "evidence": [ { "database": "GlyGen", "id": "GLY_000143", "url": "https://data.glygen.org/GLY_000143" } ], "reference": [ { "type": "PubMed", "id": "24190977", "url": "https://glygen.org/publication/PubMed/24190977" } ] }, { "title": "O-GlcNAc Transferase Recognizes Protein Substrates Using an Asparagine Ladder in the Tetratricopeptide Repeat (TPR) Superhelix.", "journal": "Journal of the American Chemical Society", "date": "2018", "authors": "Levine ZG, Fan C, Melicher MS, Orman M, Benjamin T, Walker S", "evidence": [ { "database": "O-GlcNAc Database", "id": "A6NKQ9", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=A6NKQ9" } ], "reference": [ { "type": "PubMed", "id": "29485866", "url": "https://glygen.org/publication/PubMed/29485866" } ] }, { "title": "beta-hCG promotes epithelial ovarian cancer metastasis through ERK/MMP2 signaling pathway.", "journal": "Cell cycle (Georgetown, Tex.)", "date": "2019", "authors": "Wu W, Gao H, Li X, Peng S, Yu J, Liu N, Zhan G, Zhu Y, Wang K, Guo X", "evidence": [ { "database": "RefSeq", "id": "NP_203695", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_203695" } ], "reference": [ { "type": "PubMed", "id": "30582718", "url": "https://glygen.org/publication/PubMed/30582718" } ] } ], "pathway": [ { "id": "hsa:114335", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:114335", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "O09108-1", "protein_name": "Lutropin subunit beta", "gene_name": "Lhb", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MERLQGLLLWLLLSPSVVWASRGPLRPLCRPVNATLAAENEFCPVCITFTTSICAGYCPSMVRVLPAALPPVPQPVCTYRELAFASVRLPGCPPGVDPIVSFPVALSCRCGPCRLSSSDCGGPRTQPMACDLPHLPGLLLL", "length": 141 }, "evidence": [ { "id": "45920636", "url": "http://www.informatics.jax.org/homology/45920636", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "P01229-1", "protein_name": "Lutropin subunit beta", "gene_name": "LHB", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MEMLQGLLLLLLLSMGGAWASREPLRPWCHPINAILAVEKEGCPVCITVNTTICAGYCPTMMRVLQAVLPPLPQVVCTYRDVRFESIRLPGCPRGVDPVVSFPVALSCRCGPCRRSTSDCGGPKDHPLTCDHPQLSGLLFL", "length": 141 }, "evidence": [ { "id": "45920636", "url": "http://www.informatics.jax.org/homology/45920636", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "P01230-1", "protein_name": "Lutropin subunit beta", "gene_name": "Lhb", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MERLQGLLLWLLLSPSVVWASRGPLRPLCRPVNATLAAENEFCPVCITFTTSICAGYCPSMVRVLPAALPPVPQPVCTYRELRFASVRLPGCPPGVDPIVSFPVALSCRCGPCRLSSSDCGGPRTQPMTCDLPHLPGLLLF", "length": 141 }, "evidence": [ { "id": "45920636", "url": "http://www.informatics.jax.org/homology/45920636", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "P0DN86-1", "protein_name": "Choriogonadotropin subunit beta 3", "gene_name": "CGB3", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MEMFQGLLLLLLLSMGGTWASKEPLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMTRVLQGVLPALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQDSSSSKAPPPSLPSPSRLPGPSDTPILPQ", "length": 165 }, "evidence": [ { "id": "45920636", "url": "http://www.informatics.jax.org/homology/45920636", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "P0DN87-1", "protein_name": "Choriogonadotropin subunit beta 7", "gene_name": "CGB7", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MEMFQGLLLLLLLSMGGTWASREMLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMTRVLQGVLPALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQASSSSKAPPPSLPSPSRLPGPSDTPILPQ", "length": 165 }, "evidence": [ { "id": "45920636", "url": "http://www.informatics.jax.org/homology/45920636", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q6NT52-1", "protein_name": "Choriogonadotropin subunit beta variant 2", "gene_name": "CGB2", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MSKGLLLLLLLSMGGTWASKEPLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMTRVLQGVLPALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQASSSSKAPPPSLPSPSRLPGPSDTPILPQ", "length": 163 }, "evidence": [ { "id": "45920636", "url": "http://www.informatics.jax.org/homology/45920636", "database": "MGI" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 3, "go_terms": [ { "name": "extracellular region", "id": "GO:0005576", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576", "evidence": [ { "database": "UniProtKB", "id": "A6NKQ9", "url": "https://www.uniprot.org/uniprot/A6NKQ9" } ], "pmid": "" }, { "name": "extracellular space", "id": "GO:0005615", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005615", "evidence": [ { "database": "UniProtKB", "id": "A6NKQ9", "url": "https://www.uniprot.org/uniprot/A6NKQ9" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "A6NKQ9", "url": "https://www.uniprot.org/uniprot/A6NKQ9" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "hormone activity", "id": "GO:0005179", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005179", "evidence": [ { "database": "UniProtKB", "id": "A6NKQ9", "url": "https://www.uniprot.org/uniprot/A6NKQ9" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "G protein-coupled receptor signaling pathway", "id": "GO:0007186", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007186", "evidence": [ { "database": "UniProtKB", "id": "A6NKQ9", "url": "https://www.uniprot.org/uniprot/A6NKQ9" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 63, "end_pos": 65, "annotation": "n_glycosylation_sequon" }, { "start_pos": 80, "end_pos": 82, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "sequence_features": { "n_linked_sites": [ 63, 80 ], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 63, "end_pos": 65 }, { "start_pos": 80, "end_pos": 82 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 2 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 1 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 1 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 8 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }