{ "uniprot_canonical_ac": "A6NJY4-1", "uniprot_ac": "A6NJY4", "uniprot_id": "T238L_HUMAN", "mass": { "chemical_mass": 8766.0, "monoisotopic_mass": 8766.0 }, "refseq": {}, "gene_names": [ { "name": "TMEM238L", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A6NJY4", "id": "A6NJY4" }, { "name": "FORCP", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/A6NJY4", "id": "A6NJY4" } ], "protein_names": [ { "name": "Transmembrane protein 238-like", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "A6NJY4" }, { "name": "FORCP", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "A6NJY4" }, { "name": "FOXA1-regulated conserved small protein", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "A6NJY4" } ], "function": [ { "annotation": "May play a role in inducing apoptosis during endoplasmic reticulum (ER) stress and in the inhibition of proliferation and tumorigenicity.", "evidence": [ { "database": "UniProtKB", "id": "A6NJY4", "url": "https://www.uniprot.org/uniprot/A6NJY4#function" }, { "database": "PubMed", "id": "33112233", "url": "https://glygen.org/publication/PubMed/33112233" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "A6NJY4", "url": "https://www.uniprot.org/uniprot/A6NJY4" } ], "common_name": "Human" } ], "gene": [ { "name": "TMEM238L", "url": "https://www.uniprot.org/uniprot/A6NJY4", "locus": { "chromosome": "17", "start_pos": 10794908, "end_pos": 10804099, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000263429", "url": "https://www.ensembl.org/id/ENSG00000263429" } ] } } ], "crossref": [ { "id": "ENSG00000263429", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000263429", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "TMEM238L", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=TMEM238L", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "44356", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=44356", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "A6NJY4", "url": "https://www.ebi.ac.uk/intact/interactors/id:A6NJY4*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR029365", "url": "https://www.ebi.ac.uk/interpro/entry/IPR029365", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "NX_A6NJY4", "url": "https://www.nextprot.org/entry/NX_A6NJY4", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "LLFWIIW", "url": "https://omabrowser.org/oma/group/LLFWIIW/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "PTHR28613", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR28613", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR28613:SF2", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR28613:SF2", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF15125", "url": "http://pfam.xfam.org/family/PF15125", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "A6NJY4", "url": "https://pharos.nih.gov/targets/A6NJY4", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_A6NJY4", "url": "http://purl.obolibrary.org/obo/PR_A6NJY4", "database": "PRO", "categories": [ "Protein" ] }, { "id": "A6NJY4", "url": "https://www.uniprot.org/uniprot/A6NJY4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A6NJY4-1", "url": "https://www.uniprot.org/uniprot/A6NJY4-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MLLGSLWGRCHPGRCALFLILALLLDAVGLVLLLLGILAPLSSWDFFIYTGALILALSLLLWIIWYSLNIEVSPEKLDL", "length": 79, "header": "sp|A6NJY4-1|T238L_HUMAN Isoform 1 of Transmembrane protein 238-like OS=Homo sapiens OX=9606 GN=TMEM238L PE=1 SV=3 CANONICAL=A6NJY4-1" }, "isoforms": [ { "isoform_ac": "A6NJY4-1", "url": "", "sequence": { "sequence": "MLLGSLWGRCHPGRCALFLILALLLDAVGLVLLLLGILAPLSSWDFFIYTGALILALSLLLWIIWYSLNIEVSPEKLDL", "length": 79, "header": "sp|A6NJY4-1|T238L_HUMAN Isoform 1 of Transmembrane protein 238-like OS=Homo sapiens OX=9606 GN=TMEM238L PE=1 SV=3 CANONICAL=A6NJY4-1" }, "locus": { "chromosome": "17", "start_pos": 10795812, "end_pos": 10795576, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000581851.2", "url": "https://www.ensembl.org/id/ENST00000581851.2" }, { "database": "Ensembl Peptide", "id": "ENSP00000490566.1", "url": "https://www.ensembl.org/id/ENSP00000490566.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.", "journal": "Genome Res.", "date": "2006", "authors": "Kimura K, Wakamatsu A, Suzuki Y, Ota T, Nishikawa T, Yamashita R, Yamamoto J, Sekine M, Tsuritani K, Wakaguri H, Ishii S, Sugiyama T, Saito K, Isono Y, Irie R, Kushida N, Yoneyama T, Otsuka R, Kanda K, Yokoi T, Kondo H, Wagatsuma M, Murakawa K, Ishida S, Ishibashi T, Takahashi-Fujii A, Tanase T, Nagai K, Kikuchi H, Nakai K, Isogai T, Sugano S", "evidence": [ { "database": "UniProtKB", "id": "A6NJY4", "url": "https://www.uniprot.org/uniprot/A6NJY4" } ], "reference": [ { "type": "PubMed", "id": "16344560", "url": "https://glygen.org/publication/PubMed/16344560" } ] }, { "title": "A small protein encoded by a putative lncRNA regulates apoptosis and tumorigenicity in human colorectal cancer cells.", "journal": "eLife", "date": "2020-10-28", "authors": "Li Xiao Ling, Pongor L\u0151rinc, Tang Wei, Das Sudipto, Muys Bruna R, Jones Matthew F, Lazar Sarah B, Dangelmaier Emily A, Hartford Corrine Cr, Grammatikakis Ioannis, Hao Qinyu, Sun Qinyu, Schetter Aaron, Martindale Jennifer L, Tang BinWu, Jenkins Lisa M, Robles Ana I, Walker Robert L, Ambs Stefan, Chari Raj, Shabalina Svetlana A, Gorospe Myriam, Hussain S Perwez, Harris Curtis C, Meltzer Paul S, Prasanth Kannanganattu V, Aladjem Mirit I, Andresson Thorkell, Lal Ashish", "evidence": [ { "database": "UniProtKB", "id": "A6NJY4", "url": "https://www.uniprot.org/uniprot/A6NJY4" } ], "reference": [ { "type": "PubMed", "id": "33112233", "url": "https://glygen.org/publication/PubMed/33112233" } ] }, { "title": "An Evolutionarily Conserved AU-Rich Element in the 3' Untranslated Region of a Transcript Misannotated as a Long Noncoding RNA Regulates RNA Stability.", "journal": "Mol. Cell. Biol.", "date": "2022", "authors": "Dangelmaier Emily A, Li Xiao Ling, Hartford Corrine Corrina R, King Julianna C, Zibitt Meira S, Chari Raj, Grammatikakis Ioannis, Lal Ashish", "evidence": [ { "database": "UniProtKB", "id": "A6NJY4", "url": "https://www.uniprot.org/uniprot/A6NJY4" } ], "reference": [ { "type": "PubMed", "id": "35274990", "url": "https://glygen.org/publication/PubMed/35274990" } ] } ], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "endoplasmic reticulum membrane", "id": "GO:0005789", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005789", "evidence": [ { "database": "UniProtKB", "id": "A6NJY4", "url": "https://www.uniprot.org/uniprot/A6NJY4" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress", "id": "GO:0070059", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070059", "evidence": [ { "database": "UniProtKB", "id": "A6NJY4", "url": "https://www.uniprot.org/uniprot/A6NJY4" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }