{ "uniprot_canonical_ac": "A6NH21-1", "uniprot_ac": "A6NH21", "uniprot_id": "SERC4_HUMAN", "mass": { "chemical_mass": 56870.0, "monoisotopic_mass": 56870.0 }, "refseq": { "ac": "NP_001244960", "name": "serine incorporator 4 isoform 1", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001244960" }, "gene_names": [ { "name": "SERINC4", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A6NH21", "id": "A6NH21" }, { "name": "SERINC4", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001244960", "id": "NP_001244960" } ], "protein_names": [ { "name": "Serine incorporator 4", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "A6NH21" }, { "name": "serine incorporator 4 isoform 1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001244960", "id": "NP_001244960" } ], "function": [ { "annotation": "Incorporates a polar amino acid serine into membranes and facilitates the synthesis of two serine-derived lipids, phosphatidylserine and sphingolipids.", "evidence": [ { "database": "UniProtKB", "id": "A6NH21", "url": "https://www.uniprot.org/uniprot/A6NH21#function" }, { "database": "PubMed", "id": "16120614", "url": "https://glygen.org/publication/PubMed/16120614" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "56.28", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000184716", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000184716" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "50.06", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000184716", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000184716" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "61.4", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000184716", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000184716" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "72.66", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000184716", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000184716" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "63.66", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000184716", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000184716" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "59.6", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000184716", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000184716" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "32.54", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000184716", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000184716" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "58.12", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000184716", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000184716" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "55.29", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000184716", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000184716" } ] } ], "expression_disease": [ { "significant": "No", "trend": "up", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "A6NH21", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A6NH21" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "A6NH21", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A6NH21" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "No", "trend": "down", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "A6NH21", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A6NH21" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "A6NH21", "url": "https://www.uniprot.org/uniprot/A6NH21" } ], "common_name": "Human" } ], "gene": [ { "name": "SERINC4", "url": "https://www.uniprot.org/uniprot/A6NH21", "locus": { "chromosome": "15", "start_pos": 43794162, "end_pos": 43800220, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000184716", "url": "https://www.ensembl.org/id/ENSG00000184716" } ] } } ], "crossref": [ { "id": "ENSG00000184716", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000184716", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "SERINC4", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=SERINC4", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "619189", "url": "https://www.ncbi.nlm.nih.gov/gene/619189", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "32237", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=32237", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "IPR005016", "url": "https://www.ebi.ac.uk/interpro/entry/IPR005016", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:619189", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:619189", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "614550", "url": "http://www.omim.org/entry/614550", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_A6NH21", "url": "https://www.nextprot.org/entry/NX_A6NH21", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "IHNFWFL", "url": "https://omabrowser.org/oma/group/IHNFWFL/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "53161at2759", "url": "http://www.orthodb.org/?query=53161at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR10383", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10383", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR10383:SF5", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10383:SF5", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF03348", "url": "http://pfam.xfam.org/family/PF03348", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "A6NH21", "url": "https://pharos.nih.gov/targets/A6NH21", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_A6NH21", "url": "http://purl.obolibrary.org/obo/PR_A6NH21", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-977347", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977347", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001244960", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001244960", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A6NH21", "url": "https://www.uniprot.org/uniprot/A6NH21", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A6NH21-1", "url": "https://www.uniprot.org/uniprot/A6NH21-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A6NH21-2", "url": "https://www.uniprot.org/uniprot/A6NH21-2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A6NM42", "url": "https://www.uniprot.org/uniprot/A6NM42", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A6NM42-1", "url": "https://www.uniprot.org/uniprot/A6NM42-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F8WBD8", "url": "https://www.uniprot.org/uniprot/F8WBD8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F8WBD8-1", "url": "https://www.uniprot.org/uniprot/F8WBD8-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H7C188", "url": "https://www.uniprot.org/uniprot/H7C188", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H7C188-1", "url": "https://www.uniprot.org/uniprot/H7C188-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H7C303", "url": "https://www.uniprot.org/uniprot/H7C303", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H7C303-1", "url": "https://www.uniprot.org/uniprot/H7C303-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MVGAKAGPSPGTSLGLAQQHSGGSSVLVKSPFCQVCCCGPAPCASCCHSRWPSLTASTCSRLFYILLHVGASAICCLLLSRTVVERVWGKTHRIQMPSGLCAHLFGLSDCPVLSGSGAVYRVCAGTATFHLLQAVLLVHLHSPTSPRAQLHNSFWLLKLLFLLGLCAIAFCIPDEHLFPAWHYIGICGGFAFILLQLVLITAFAHSWNKNWQTGAAQDCSWFLAVLLATLGFYSMAGVGAVLLFHYYTHPAGCLLNKMLLSLHLCFCGLISFLSIAPCIRLKQPRSGLLQASVISCYIMYLTFSALSSRPPERVILQGQNHTLCLPGLSKMEPQTPDISLAMLSASIMYACVLFACNEASYLAEVFGPLWIVKVYSYEFQKPSLCFCCPETVEADKGQRGGAARPADQETPPAPPVQVQHLSYNYSAFHFVFFLASLYVMVTLTNWFSYEGAELEKTFIKGSWATFWVKVASCWACVLLYLGLLLAPLCWPPTQKPQPLILRRRRHRIISPDNKYPPV", "length": 518, "header": "sp|A6NH21-1|SERC4_HUMAN Isoform 1 of Serine incorporator 4 OS=Homo sapiens OX=9606 GN=SERINC4 PE=2 SV=1 CANONICAL=A6NH21-1" }, "isoforms": [ { "isoform_ac": "A6NH21-1", "url": "", "sequence": { "sequence": "MVGAKAGPSPGTSLGLAQQHSGGSSVLVKSPFCQVCCCGPAPCASCCHSRWPSLTASTCSRLFYILLHVGASAICCLLLSRTVVERVWGKTHRIQMPSGLCAHLFGLSDCPVLSGSGAVYRVCAGTATFHLLQAVLLVHLHSPTSPRAQLHNSFWLLKLLFLLGLCAIAFCIPDEHLFPAWHYIGICGGFAFILLQLVLITAFAHSWNKNWQTGAAQDCSWFLAVLLATLGFYSMAGVGAVLLFHYYTHPAGCLLNKMLLSLHLCFCGLISFLSIAPCIRLKQPRSGLLQASVISCYIMYLTFSALSSRPPERVILQGQNHTLCLPGLSKMEPQTPDISLAMLSASIMYACVLFACNEASYLAEVFGPLWIVKVYSYEFQKPSLCFCCPETVEADKGQRGGAARPADQETPPAPPVQVQHLSYNYSAFHFVFFLASLYVMVTLTNWFSYEGAELEKTFIKGSWATFWVKVASCWACVLLYLGLLLAPLCWPPTQKPQPLILRRRRHRIISPDNKYPPV", "length": 518, "header": "sp|A6NH21-1|SERC4_HUMAN Isoform 1 of Serine incorporator 4 OS=Homo sapiens OX=9606 GN=SERINC4 PE=2 SV=1 CANONICAL=A6NH21-1" }, "locus": { "chromosome": "15", "start_pos": 43799986, "end_pos": 43795003, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000319327.7", "url": "https://www.ensembl.org/id/ENST00000319327.7" }, { "database": "Ensembl Peptide", "id": "ENSP00000319796.6", "url": "https://www.ensembl.org/id/ENSP00000319796.6" } ] } }, { "isoform_ac": "A6NH21-2", "url": "", "sequence": { "sequence": "MSISSQHGITLASVEALHSSYCSWCLLQLLPIPGTRTEQPRSGLLQASVISCYIMYLTFSALSSRPPERVILQGQNHTLCLPGLSKMEPQTPDISLAMLSASIMYACVLFACNEASYLAEVFGPLWIVKVYSYEFQKPSLCFCCPETVEADKGQRGGAARPADQETPPAPPVQVQHLSYNYSAFHFVFFLASLYVMVTLTNWFSYEGAELEKTFIKGSWATFWVKVASCWACVLLYLGLLLAPLCWPPTQKPQPLILRRRRHRIISPDNKYPPV", "length": 274, "header": "sp|A6NH21-2|SERC4_HUMAN Isoform 2 of Serine incorporator 4 OS=Homo sapiens OX=9606 GN=SERINC4 PE=2 SV=1 CANONICAL=A6NH21-1" }, "locus": {} }, { "isoform_ac": "A6NM42-1", "url": "", "sequence": { "sequence": "MVGAKAGPSPGTSLGLAQQHSGGSSVLVKSPFCQVCCCGPAPCASCCHSRWPSLTASTCSRLFYILLHVGASAICCLLLSRTVVERVWGKTHRIQMPSGLCAHLFGLSDCPVLSGSGAVYRVCAGTATFHLLQAVLLVHLHSPTSPRAQLHNSFWLLKLLFLLGLCAIAFCIPDEHLFPAWHYIGICGGFAFILLQLVLITAFAHSWNKNWQTGAAQDCSWFLAVLLATLGFYSMAGVGAVLLFHYYTHPAGCLLNKMLLSLHLCFCGLISFLSIAPCIRLTMRPPTWLRYLDPCGLSRFTAMSFRSPHCVSAALKQWRQTKGKGVGLRGQLTKKPLQLLQSKSSIFPTTILPSTSSSSLPHSMSWLPLPTGSAMREQNWKRPSSRVAGPPSGSRLPHAGPAYSSIWGCYWHHSVGPPPRNPSPLS", "length": 426, "header": "tr|A6NM42-1|A6NM42_HUMAN Computationally mapped isoform of Serine incorporator 4 OS=Homo sapiens OX=9606 GN=SERINC4 PE=3 SV=1 CANONICAL=A6NH21-1" }, "locus": { "chromosome": "15", "start_pos": 43799986, "end_pos": 43795056, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000299969.10", "url": "https://www.ensembl.org/id/ENST00000299969.10" }, { "database": "Ensembl Peptide", "id": "ENSP00000299969.6", "url": "https://www.ensembl.org/id/ENSP00000299969.6" } ] } }, { "isoform_ac": "F8WBD8-1", "url": "", "sequence": { "sequence": "MVGAKAGPSPGTSLGLAQQHSGGSSVLVKSPFCQQVSTSLPCICSTPRCAAVGLLLVPAAATLGGPLSPHPLAAACSTSSSMWGPQQSAASCCQGQ", "length": 96, "header": "tr|F8WBD8-1|SERC4_HUMAN Computationally mapped isoform of Serine incorporator 4 OS=Homo sapiens OX=9606 GN=SERINC4 PE=2 SV=1 CANONICAL=A6NH21-1" }, "locus": { "chromosome": "15", "start_pos": 43799986, "end_pos": 43799342, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000457418.5", "url": "https://www.ensembl.org/id/ENST00000457418.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000402868.1", "url": "https://www.ensembl.org/id/ENSP00000402868.1" } ] } }, { "isoform_ac": "H7C188-1", "url": "", "sequence": { "sequence": "XMPSGLCAHLFGLSDCPVLSGSGAVYRVCAGTATFHLLQAVLLVHLHSPTSPRAQLHNSFWLLKLLFLLGLCAIAFCIPDEHLFPAWHYIGICGGFAFILLQLVLITAFAHSWNKNWQTGAAQDCSWFLAVLLATLGFYSMAGVGAVLLFHYYTHPAGCLLNKMLLSLHLCFCGLISFLSIAPCIRLSGATPLWPPTSFCHQLLYHVSDFLCTVQPSSRESNPSRTESHPVPAWPE", "length": 236, "header": "tr|H7C188-1|H7C188_HUMAN Computationally mapped isoform of Serine incorporator 4 OS=Homo sapiens OX=9606 GN=SERINC4 PE=3 SV=1 CANONICAL=A6NH21-1" }, "locus": { "chromosome": "15", "start_pos": 43799133, "end_pos": 43796696, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000448553.5", "url": "https://www.ensembl.org/id/ENST00000448553.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000399074.1", "url": "https://www.ensembl.org/id/ENSP00000399074.1" } ] } }, { "isoform_ac": "H7C303-1", "url": "", "sequence": { "sequence": "XSGLCAHLFGLSDCPVLSGSGAVYRVCAGTATFHLLQAVLLVHLHSPTSPRAQLHNSMALHWHLWRLCIHPTAVGAYYSFCPFLEQELQ", "length": 89, "header": "tr|H7C303-1|H7C303_HUMAN Computationally mapped isoform of Serine incorporator 4 OS=Homo sapiens OX=9606 GN=SERINC4 PE=3 SV=2 CANONICAL=A6NH21-1" }, "locus": { "chromosome": "15", "start_pos": 43799127, "end_pos": 43796224, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000412697.1", "url": "https://www.ensembl.org/id/ENST00000412697.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000408781.1", "url": "https://www.ensembl.org/id/ENSP00000408781.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "Human serine racemase: moleular cloning, genomic organization and functional analysis.", "journal": "Gene", "date": "2000", "authors": "De Miranda J, Santoro A, Engelender S, Wolosker H", "evidence": [ { "database": "Reactome", "id": "R-HSA-977347", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977347" } ], "reference": [ { "type": "PubMed", "id": "11054547", "url": "https://glygen.org/publication/PubMed/11054547" } ] }, { "title": "Cofactors of serine racemase that physiologically stimulate the synthesis of the N-methyl-D-aspartate (NMDA) receptor coagonist D-serine.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2002", "authors": "De Miranda J, Panizzutti R, Foltyn VN, Wolosker H", "evidence": [ { "database": "Reactome", "id": "R-HSA-977347", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977347" } ], "reference": [ { "type": "PubMed", "id": "12393813", "url": "https://glygen.org/publication/PubMed/12393813" } ] }, { "title": "Characterization of human phosphoserine aminotransferase involved in the phosphorylated pathway of L-serine biosynthesis.", "journal": "The Biochemical journal", "date": "2003", "authors": "Baek JY, Jun DY, Taub D, Kim YH", "evidence": [ { "database": "Reactome", "id": "R-HSA-977347", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977347" } ], "reference": [ { "type": "PubMed", "id": "12633500", "url": "https://glygen.org/publication/PubMed/12633500" } ] }, { "title": "Characterization and localization of a human serine racemase.", "journal": "Brain research. Molecular brain research", "date": "2004", "authors": "Xia M, Liu Y, Figueroa DJ, Chiu CS, Wei N, Lawlor AM, Lu P, Sur C, Koblan KS, Connolly TM", "evidence": [ { "database": "Reactome", "id": "R-HSA-977347", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977347" } ], "reference": [ { "type": "PubMed", "id": "15193426", "url": "https://glygen.org/publication/PubMed/15193426" } ] }, { "title": "Serine racemase modulates intracellular D-serine levels through an alpha,beta-elimination activity.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Foltyn VN, Bendikov I, De Miranda J, Panizzutti R, Dumin E, Shleper M, Li P, Toney MD, Kartvelishvily E, Wolosker H", "evidence": [ { "database": "Reactome", "id": "R-HSA-977347", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977347" } ], "reference": [ { "type": "PubMed", "id": "15536068", "url": "https://glygen.org/publication/PubMed/15536068" } ] }, { "title": "Serinc, an activity-regulated protein family, incorporates serine into membrane lipid synthesis.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Inuzuka M, Hayakawa M, Ingi T", "evidence": [ { "database": "UniProtKB", "id": "A6NH21", "url": "https://www.uniprot.org/uniprot/A6NH21" } ], "reference": [ { "type": "PubMed", "id": "16120614", "url": "https://glygen.org/publication/PubMed/16120614" } ] }, { "title": "Novel mutations in 3-phosphoglycerate dehydrogenase (PHGDH) are distributed throughout the protein and result in altered enzyme kinetics.", "journal": "Human mutation", "date": "2009", "authors": "Tabatabaie L, de Koning TJ, Geboers AJ, van den Berg IE, Berger R, Klomp LW", "evidence": [ { "database": "Reactome", "id": "R-HSA-977347", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977347" } ], "reference": [ { "type": "PubMed", "id": "19235232", "url": "https://glygen.org/publication/PubMed/19235232" } ] }, { "title": "SERINC3 and SERINC5 restrict HIV-1 infectivity and are counteracted by Nef.", "journal": "Nature", "date": "2015", "authors": "Usami Y, Wu Y, Gottlinger HG", "evidence": [ { "database": "Reactome", "id": "R-HSA-977347", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977347" } ], "reference": [ { "type": "PubMed", "id": "26416733", "url": "https://glygen.org/publication/PubMed/26416733" } ] }, { "title": "Spotlight on HIV-1 Nef: SERINC3 and SERINC5 Identified as Restriction Factors Antagonized by the Pathogenesis Factor.", "journal": "Viruses", "date": "2015", "authors": "Fackler OT", "evidence": [ { "database": "Reactome", "id": "R-HSA-977347", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977347" } ], "reference": [ { "type": "PubMed", "id": "26703715", "url": "https://glygen.org/publication/PubMed/26703715" } ] }, { "title": "Human L-3-phosphoserine phosphatase: sequence, expression and evidence for a phosphoenzyme intermediate.", "journal": "FEBS letters", "date": "1997", "authors": "Collet JF, Gerin I, Rider MH, Veiga-da-Cunha M, Van Schaftingen E", "evidence": [ { "database": "Reactome", "id": "R-HSA-977347", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977347" } ], "reference": [ { "type": "PubMed", "id": "9188776", "url": "https://glygen.org/publication/PubMed/9188776" } ] } ], "pathway": [ { "id": "hsa:619189", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:619189", "resource": "KEGG Pathway" }, { "id": "R-HSA-977347", "name": "Serine biosynthesis", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977347", "resource": "Reactome", "description": "Serine biosynthesis" } ], "orthologs": [ { "uniprot_canonical_ac": "Q5XK03-1", "protein_name": "Serine incorporator 4", "gene_name": "Serinc4", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MMGAKVVTGRSTTQGLAQQHGGVSNVVETPFNQASCCGPVSWTSGCHSLTESRCSRLLYILLHVGASAICCLLLSKTVVERVWGKAHGIQMPSVLCAHLFGSSDCPVLSGSGAVYRVCAGTATFHLLQAVLLVRLHSPTNPRAQLHNSFWSLKLLFLLGLCVVAFCIPDEDLFPAWHYIGICGGFTFILLQLVLITAFAQSWNKNWQTGAAQDCSWLLGVSLATLGFYSMAGVGAVLLFHQYTHPDGCLLNKMLLSLHLCFCGLLSLLSIAPCIRRKQPNSGLLQASIISCYIMYLTFSALSSRPPETITFQGQNHTLCLPGRNKMEPQIPDTSVAVFSAGIMYACVLFACNEASYLAELFGPLWIIKVYKYEFQKPSVCFCCPQTVEPEDGQRSRARSADQETPPAAQVQSQHLSYSYSGFHFAFFLASLYVMVTLTNWFSYEEAELEKTFTKGSWATFWVKVASCWACVLLYLGLLLAPLLAPHSESPPP", "length": 492 }, "evidence": [ { "id": "45927590", "url": "http://www.informatics.jax.org/homology/45927590", "database": "MGI" }, { "id": "A6NH21", "url": "https://omabrowser.org/oma/group/A6NH21/", "database": "OMA" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "A6NH21", "url": "https://www.uniprot.org/uniprot/A6NH21" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "phospholipid biosynthetic process", "id": "GO:0008654", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008654", "evidence": [ { "database": "UniProtKB", "id": "A6NH21", "url": "https://www.uniprot.org/uniprot/A6NH21" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 320, "end_pos": 322, "annotation": "n_glycosylation_sequon" }, { "start_pos": 424, "end_pos": 426, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 320, "end_pos": 322 }, { "start_pos": 424, "end_pos": 426 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 10 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }