{ "uniprot_canonical_ac": "A6NGY5-1", "uniprot_ac": "A6NGY5", "uniprot_id": "O51F1_HUMAN", "mass": { "chemical_mass": 35849.0, "monoisotopic_mass": 35849.0 }, "refseq": {}, "gene_names": [ { "name": "OR51F1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A6NGY5", "id": "A6NGY5" }, { "name": "OR51F1P", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/A6NGY5", "id": "A6NGY5" } ], "protein_names": [ { "name": "Olfactory receptor 51F1", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "A6NGY5" } ], "function": [ { "annotation": "Odorant receptor.", "evidence": [ { "database": "UniProtKB", "id": "A6NGY5", "url": "https://www.uniprot.org/uniprot/A6NGY5#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "A6NGY5", "url": "https://www.uniprot.org/uniprot/A6NGY5" } ], "common_name": "Human" } ], "gene": [ { "name": "OR51F1", "url": "https://www.uniprot.org/uniprot/A6NGY5", "locus": { "chromosome": "11", "start_pos": 4768979, "end_pos": 4769938, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000280021", "url": "https://www.ensembl.org/id/ENSG00000280021" } ] } } ], "crossref": [ { "id": "ENSG00000280021", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000280021", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd15222", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd15222", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "OR51F1", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=OR51F1", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "256892", "url": "https://www.ncbi.nlm.nih.gov/gene/256892", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "15196", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=15196", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "IPR000276", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000276", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR000725", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000725", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR017452", "url": "https://www.ebi.ac.uk/interpro/entry/IPR017452", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:256892", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:256892", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "NX_A6NGY5", "url": "https://www.nextprot.org/entry/NX_A6NGY5", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "A6NGY5", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=A6NGY5", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "MLQNQDT", "url": "https://omabrowser.org/oma/group/MLQNQDT/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "4578140at2759", "url": "http://www.orthodb.org/?query=4578140at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR26450", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR26450", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR26450:SF46", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR26450:SF46", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF13853", "url": "http://pfam.xfam.org/family/PF13853", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "A6NGY5", "url": "https://pharos.nih.gov/targets/A6NGY5", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_A6NGY5", "url": "http://purl.obolibrary.org/obo/PR_A6NGY5", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-9752946", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9752946", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "A6NGY5", "url": "https://www.uniprot.org/uniprot/A6NGY5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A6NGY5-1", "url": "https://www.uniprot.org/uniprot/A6NGY5-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A6NLW9", "url": "https://www.uniprot.org/uniprot/A6NLW9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A6NLW9-1", "url": "https://www.uniprot.org/uniprot/A6NLW9-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MLQNQDTMEILSNSTSKFPTFLLTGIPGLESAHVWISIPFCCFYAIALSGNSVILFVIITQQSLHEPMYYFLFRLSATDLGLTVSSLSTTLGILWFEAREISLYSCIVQMFFLHGFTFMESGVLVATAFDRYVAICDPLRYTTILTNSRIIQMGLLMITRAIVLILPLLLLLKPLYFCRMNALSHSYCYHPDVIQLACSDIRANSICGLIDLILTTGIDTPCIVLSYILIIHSVLRIASPEEWHKVFSTCVSHVGAVAFFYIHMLSLSLVYRYGRSAPRVVHSVMANVYLLLPPVLNPIIDSVKTKQIRKAMLSLLLTK", "length": 319, "header": "sp|A6NGY5-1|O51F1_HUMAN Isoform 1 of Olfactory receptor 51F1 OS=Homo sapiens OX=9606 GN=OR51F1 PE=3 SV=1 CANONICAL=A6NGY5-1" }, "isoforms": [ { "isoform_ac": "A6NGY5-1", "url": "", "sequence": { "sequence": "MLQNQDTMEILSNSTSKFPTFLLTGIPGLESAHVWISIPFCCFYAIALSGNSVILFVIITQQSLHEPMYYFLFRLSATDLGLTVSSLSTTLGILWFEAREISLYSCIVQMFFLHGFTFMESGVLVATAFDRYVAICDPLRYTTILTNSRIIQMGLLMITRAIVLILPLLLLLKPLYFCRMNALSHSYCYHPDVIQLACSDIRANSICGLIDLILTTGIDTPCIVLSYILIIHSVLRIASPEEWHKVFSTCVSHVGAVAFFYIHMLSLSLVYRYGRSAPRVVHSVMANVYLLLPPVLNPIIDSVKTKQIRKAMLSLLLTK", "length": 319, "header": "sp|A6NGY5-1|O51F1_HUMAN Isoform 1 of Olfactory receptor 51F1 OS=Homo sapiens OX=9606 GN=OR51F1 PE=3 SV=1 CANONICAL=A6NGY5-1" }, "locus": {} }, { "isoform_ac": "A6NLW9-1", "url": "", "sequence": { "sequence": "MEILSNSTSKFPTFLLTGIPGLESAHVWISIPFCCFYAIALSGNSVILFVIITQQSLHEPMYYFLFRLSATDLGLTVSSLSTTLGILWFEAREISLYSCIVQMFFLHGFTFMESGVLVATAFDRYVAICDPLRYTTILTNSRIIQMGLLMITRAIVLILPLLLLLKPLYFCRMNALSHSYCYHPDVIQLACSDIRANSICGLIDLILTTGIDTPCIVLSYILIIHSVLRIASPEEWHKVFSTCVSHVGAVAFFYIHMLSLSLVYRYGRSAPRVVHSVMANVYLLLPPVLNPIIDSVKTKQIRKAMLSLLLTK", "length": 312, "header": "tr|A6NLW9-1|O51F1_HUMAN Computationally mapped isoform of Olfactory receptor 51F1 OS=Homo sapiens OX=9606 GN=OR51F1 PE=3 SV=1 CANONICAL=A6NGY5-1" }, "locus": { "chromosome": "11", "start_pos": 4769938, "end_pos": 4768982, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000624103", "url": "https://www.ensembl.org/id/ENST00000624103" }, { "database": "Ensembl Peptide", "id": "ENSP00000485387", "url": "https://www.ensembl.org/id/ENSP00000485387" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "evidence": [ { "id": "A6NGY5", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=A6NGY5" }, { "id": "28411811", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28411811" } ] } ], "phosphorylation": [], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "Different noses for different people.", "journal": "Nat. Genet.", "date": "2003", "authors": "Menashe I, Man O, Lancet D, Gilad Y", "evidence": [ { "database": "UniProtKB", "id": "A6NGY5", "url": "https://www.uniprot.org/uniprot/A6NGY5" } ], "reference": [ { "type": "PubMed", "id": "12730696", "url": "https://glygen.org/publication/PubMed/12730696" } ] }, { "title": "Profiling of olfactory receptor gene expression in whole human olfactory mucosa.", "journal": "PloS one", "date": "2014", "authors": "Verbeurgt C, Wilkin F, Tarabichi M, Gregoire F, Dumont JE, Chatelain P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9752946", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9752946" } ], "reference": [ { "type": "PubMed", "id": "24800820", "url": "https://glygen.org/publication/PubMed/24800820" } ] }, { "title": "The human olfactory transcriptome.", "journal": "BMC genomics", "date": "2016", "authors": "Olender T, Keydar I, Pinto JM, Tatarskyy P, Alkelai A, Chien MS, Fishilevich S, Restrepo D, Matsunami H, Gilad Y, Lancet D", "evidence": [ { "database": "Reactome", "id": "R-HSA-9752946", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9752946" } ], "reference": [ { "type": "PubMed", "id": "27515280", "url": "https://glygen.org/publication/PubMed/27515280" } ] }, { "title": "A novel strategy for global mapping of O-GlcNAc proteins and peptides using selective enzymatic deglycosylation, HILIC enrichment and mass spectrometry identification.", "journal": "Talanta", "date": "2017", "authors": "Shen B, Zhang W, Shi Z, Tian F, Deng Y, Sun C, Wang G, Qin W, Qian X", "evidence": [ { "database": "O-GlcNAc Database", "id": "A6NGY5", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=A6NGY5" } ], "reference": [ { "type": "PubMed", "id": "28411811", "url": "https://glygen.org/publication/PubMed/28411811" } ] }, { "title": "Structural instability and divergence from conserved residues underlie intracellular retention of mammalian odorant receptors.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2020", "authors": "Ikegami K, de March CA, Nagai MH, Ghosh S, Do M, Sharma R, Bruguera ES, Lu YE, Fukutani Y, Vaidehi N, Yohda M, Matsunami H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9752946", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9752946" } ], "reference": [ { "type": "PubMed", "id": "31974307", "url": "https://glygen.org/publication/PubMed/31974307" } ] }, { "title": "Single-cell analysis of olfactory neurogenesis and differentiation in adult humans.", "journal": "Nature neuroscience", "date": "2020", "authors": "Durante MA, Kurtenbach S, Sargi ZB, Harbour JW, Choi R, Kurtenbach S, Goss GM, Matsunami H, Goldstein BJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9752946", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9752946" } ], "reference": [ { "type": "PubMed", "id": "32066986", "url": "https://glygen.org/publication/PubMed/32066986" } ] } ], "pathway": [ { "id": "hsa:256892", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:256892", "resource": "KEGG Pathway" }, { "id": "R-HSA-9752946", "name": "Expression and translocation of olfactory receptors", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9752946", "resource": "Reactome", "description": "Expression and translocation of olfactory receptors" } ], "orthologs": [ { "uniprot_canonical_ac": "D3ZAF1-1", "protein_name": "Olfactory receptor", "gene_name": "Or51f1f", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MLQLQDNREFLSNFTSKLTTFLLTGIPGLESAHGWISIPFCCLYATALSGNSMILFIIVTQHSLHEPMYYFLSMLSATYLGLTVSTMSTTLRILWFQANEISLDLCIVQMFFLHGFTCIESGVLVAMAFDRYVAICNPLRYTMILTNSRIIQVVFLVMMRTLLLIIPLLLLLTPVSFCKRKALPHSYCYYPDVIKLACSDTRANDICGLVDLILTTGVDIPCIVLSYVLIIHSFLNIASSEGRHKAFSTCVSHIGAVAVFYIPMFSLSLVHRYGRSAPKIVHSMMANVYLLLPPVLNPIIYSVKTKQIRKAMLSLFFAK", "length": 319 }, "evidence": [ { "id": "45917323", "url": "http://www.informatics.jax.org/homology/45917323", "database": "MGI" }, { "id": "45917299", "url": "http://www.informatics.jax.org/homology/45917299", "database": "MGI" }, { "id": "45917334", "url": "http://www.informatics.jax.org/homology/45917334", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "E9PXW4-1", "protein_name": "Olfactory receptor", "gene_name": "Or51f1e", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MLQMQDNTEFLSNFTSKLSTFLLTGIPGLESAHGWISIPFCCLYATALSGNSMILFIIVTQHSLHEPMYYFLSVLSATDLGLTFSTMSTTLRILWFQANEISLDLCIVQMFFLHGFTCTESGVLVAMAFDRYVAICKPLRYTMILTNSRIIQIGFLVIMRTLLLIIPLLLLLKPVSFCKRNTLSHSYCYPDVIKLACSDTRANNICGLVDLILTTGLDIPCIVLSYILIIRSVLNIASSEERHKAFSTCVSHIAAVAVFYIPMFSLSLVHRYGRSVPKVVHTMMANVYLLLPPVLNPIIYSVKTKQIRKAILSLLFAK", "length": 318 }, "evidence": [ { "id": "45917299", "url": "http://www.informatics.jax.org/homology/45917299", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q8VG25-1", "protein_name": "Olfactory receptor", "gene_name": "Or51f1d", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MLQMQDNTEFLSNFTSKLPTFLLTGIPGLESAHGWISIPFCCLYATALSGNSMILFIIVTQHSLHEPMYYFLSVLSATDLGLTFSTMSTTLRILWFQANEISLDFCIVQMFFLHGFTCTESGVLVAMAFDRYVAIYKPLRYTMILMNSRIIQIGFLVIMHTLLLTVPLLLLLKPVSFCKRNTLSHSYCYHPDVIKLACSDTRANSICGLVDLILTTGVDIPCIVLSYILIIRSVLNIAFSEERHKAFSTCVSHIAAVAVFYIPTFSLSLVHRYGRSVPKVVHTMMANVYLLLPPVLNPIIYSVKTKQIRKAILSLLFAK", "length": 319 }, "evidence": [ { "id": "45917323", "url": "http://www.informatics.jax.org/homology/45917323", "database": "MGI" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "G protein-coupled receptor activity", "id": "GO:0004930", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004930", "evidence": [ { "database": "UniProtKB", "id": "A6NGY5", "url": "https://www.uniprot.org/uniprot/A6NGY5" } ], "pmid": "" }, { "name": "olfactory receptor activity", "id": "GO:0004984", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004984", "evidence": [ { "database": "UniProtKB", "id": "A6NGY5", "url": "https://www.uniprot.org/uniprot/A6NGY5" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "A6NGY5", "url": "https://www.uniprot.org/uniprot/A6NGY5" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 13, "end_pos": 15, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 13, "end_pos": 15 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 6 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }