{ "uniprot_canonical_ac": "A6NFZ4-1", "uniprot_ac": "A6NFZ4", "uniprot_id": "FA24A_HUMAN", "mass": { "chemical_mass": 11258.0, "monoisotopic_mass": 11258.0 }, "refseq": { "ac": "NP_001025059", "name": "protein FAM24A precursor", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001025059" }, "gene_names": [ { "name": "FAM24A", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A6NFZ4", "id": "A6NFZ4" }, { "name": "FAM24A", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001025059", "id": "NP_001025059" } ], "protein_names": [ { "name": "Protein FAM24A", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "A6NFZ4" }, { "name": "protein FAM24A precursor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001025059", "id": "NP_001025059" }, { "name": "protein FAM24A", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001025059", "id": "NP_001025059" } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "36.1", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000203795", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000203795" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "41.27", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000203795", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000203795" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "16.41", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000203795", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000203795" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "17.43", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000203795", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000203795" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "16.94", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000203795", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000203795" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "31.32", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000203795", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000203795" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "18.06", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000203795", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000203795" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "21.77", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000203795", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000203795" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "21.25", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000203795", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000203795" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "18.06", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000203795", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000203795" } ] } ], "expression_disease": [ { "significant": "No", "trend": "up", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "A6NFZ4", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A6NFZ4" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "A6NFZ4", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A6NFZ4" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "A6NFZ4", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A6NFZ4" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "A6NFZ4", "url": "https://www.uniprot.org/uniprot/A6NFZ4" } ], "common_name": "Human" } ], "gene": [ { "name": "FAM24A", "url": "https://www.uniprot.org/uniprot/A6NFZ4", "locus": { "chromosome": "10", "start_pos": 122913111, "end_pos": 122910610, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000203795", "url": "https://www.ensembl.org/id/ENSG00000203795" } ] } } ], "crossref": [ { "id": "ENSG00000203795", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000203795", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "FAM24A", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=FAM24A", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "118670", "url": "https://www.ncbi.nlm.nih.gov/gene/118670", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "23470", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=23470", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "IPR028122", "url": "https://www.ebi.ac.uk/interpro/entry/IPR028122", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:118670", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:118670", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "NX_A6NFZ4", "url": "https://www.nextprot.org/entry/NX_A6NFZ4", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "CLYFKIA", "url": "https://omabrowser.org/oma/group/CLYFKIA/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5205474at2759", "url": "http://www.orthodb.org/?query=5205474at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR35860", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR35860", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR35860:SF1", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR35860:SF1", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF15193", "url": "http://pfam.xfam.org/family/PF15193", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "A6NFZ4", "url": "https://pharos.nih.gov/targets/A6NFZ4", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_A6NFZ4", "url": "http://purl.obolibrary.org/obo/PR_A6NFZ4", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_001025059", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001025059", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A6NFZ4", "url": "https://www.uniprot.org/uniprot/A6NFZ4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A6NFZ4-1", "url": "https://www.uniprot.org/uniprot/A6NFZ4-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MAKMFDLRTKIMIGIGSSLLVAAMVLLSVVFCLYFKVAKALKAAKDPDAVAVKNHNPDKVCWATNSQAKATTMESCPSLQCCEGCRMHASSDSLPPCCCDINEGL", "length": 105, "header": "sp|A6NFZ4-1|FA24A_HUMAN Isoform 1 of Protein FAM24A OS=Homo sapiens OX=9606 GN=FAM24A PE=3 SV=1 CANONICAL=A6NFZ4-1" }, "isoforms": [ { "isoform_ac": "A6NFZ4-1", "url": "", "sequence": { "sequence": "MAKMFDLRTKIMIGIGSSLLVAAMVLLSVVFCLYFKVAKALKAAKDPDAVAVKNHNPDKVCWATNSQAKATTMESCPSLQCCEGCRMHASSDSLPPCCCDINEGL", "length": 105, "header": "sp|A6NFZ4-1|FA24A_HUMAN Isoform 1 of Protein FAM24A OS=Homo sapiens OX=9606 GN=FAM24A PE=3 SV=1 CANONICAL=A6NFZ4-1" }, "locus": { "chromosome": "10", "start_pos": 122912951, "end_pos": 122911635, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000368894.2", "url": "https://www.ensembl.org/id/ENST00000368894.2" }, { "database": "Ensembl Peptide", "id": "ENSP00000357889.1", "url": "https://www.ensembl.org/id/ENSP00000357889.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [ { "id": "hsa:118670", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:118670", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "B1WBS9-1", "protein_name": "Protein FAM24A", "gene_name": "Fam24a", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MFDLRTKVMIGIASTLLIAAIVLITVVFCLYLKISKALKCAREVESCMDPTKAVSEKMIRGKPIIADPCRPLQCCDNCSLFKDVGAMPPCFCGTNEGL", "length": 98 }, "evidence": [ { "id": "45933760", "url": "http://www.informatics.jax.org/homology/45933760", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q8CF27-1", "protein_name": "Protein FAM24A", "gene_name": "Fam24a", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MFDLRTKVMIGIASTLLIAAIMLITLVFCLYQKISKALKLAKEPECCIDPCKDPNEKIIRAKPIIAETCRNLPCCDDCSIYKDVGSLPPCYCVTNEGL", "length": 98 }, "evidence": [ { "id": "45933760", "url": "http://www.informatics.jax.org/homology/45933760", "database": "MGI" }, { "id": "A6NFZ4", "url": "https://omabrowser.org/oma/group/A6NFZ4/", "database": "OMA" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q8N5W8-1", "protein_name": "Protein FAM24B", "gene_name": "FAM24B", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MPVIAGGILAALLLLIVVVLCLYFKIHNALKAAKEPEAVAVKNHNPDKVWWAKNSQAKTIATESCPALQCCEGYRMCASFDSLPPCCCDINEGL", "length": 94 }, "evidence": [ { "id": "45933761", "url": "http://www.informatics.jax.org/homology/45933761", "database": "MGI" }, { "id": "45933760", "url": "http://www.informatics.jax.org/homology/45933760", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q9DAL9-1", "protein_name": "Protein FAM24A-like", "gene_name": "", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MYKPFDLRTIITIIIGCGILTAMFLLIGLVLCLYSKISKALKSPGIAKEADDECYIDPCKDPHESIILANSIPAEACHSYQANTIAVASCGPLQCCNVCGVYADVNSLPPCLCSIREGL", "length": 119 }, "evidence": [ { "id": "45933761", "url": "http://www.informatics.jax.org/homology/45933761", "database": "MGI" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "extracellular region", "id": "GO:0005576", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576", "evidence": [ { "database": "UniProtKB", "id": "A6NFZ4", "url": "https://www.uniprot.org/uniprot/A6NFZ4" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }