{
    "uniprot_canonical_ac": "A6NDZ8-1",
    "uniprot_ac": "A6NDZ8",
    "uniprot_id": "MB3L4_HUMAN",
    "mass": {
        "chemical_mass": 23121.0,
        "monoisotopic_mass": 23121.0
    },
    "refseq": {
        "ac": "NP_001157891",
        "name": "putative methyl-CpG-binding domain protein 3-like 4",
        "summary": "This gene encodes a member of a family of proteins that are related to methyl-CpG-binding proteins but lack the methyl-CpG binding domain. There is no definitive support for transcription of this locus, and the transcript structure is inferred from other family members. [provided by RefSeq, Aug 2009].",
        "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001157891"
    },
    "gene_names": [
        {
            "name": "MBD3L4",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "https://www.uniprot.org/uniprot/A6NDZ8",
            "id": "A6NDZ8"
        },
        {
            "name": "MBD3L4",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001157891",
            "id": "NP_001157891"
        }
    ],
    "protein_names": [
        {
            "name": "Putative methyl-CpG-binding domain protein 3-like 4",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "",
            "id": "A6NDZ8"
        },
        {
            "name": "MBD3-like 4; MBD3-like protein 4",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001157891",
            "id": "NP_001157891"
        },
        {
            "name": "MBD3-like protein 4",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "A6NDZ8"
        },
        {
            "name": "putative methyl-CpG-binding domain protein 3-like 4",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001157891",
            "id": "NP_001157891"
        }
    ],
    "function": [
        {
            "annotation": "This gene encodes a member of a family of proteins that are related to methyl-CpG-binding proteins but lack the methyl-CpG binding domain. There is no definitive support for transcription of this locus, and the transcript structure is inferred from other family members. [provided by RefSeq, Aug 2009].",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_001157891",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001157891"
                }
            ]
        }
    ],
    "disease": [],
    "snv": [],
    "mutagenesis": [],
    "expression_tissue": [],
    "expression_disease": [],
    "species": [
        {
            "name": "Homo sapiens",
            "taxid": 9606,
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "A6NDZ8",
                    "url": "https://www.uniprot.org/uniprot/A6NDZ8"
                }
            ],
            "common_name": "Human"
        }
    ],
    "gene": [
        {
            "name": "MBD3L4",
            "url": "https://www.uniprot.org/uniprot/A6NDZ8",
            "locus": {
                "chromosome": "19",
                "start_pos": 7037749,
                "end_pos": 7040179,
                "strand": "+",
                "evidence": [
                    {
                        "database": "Ensembl Gene",
                        "id": "ENSG00000205718",
                        "url": "https://www.ensembl.org/id/ENSG00000205718"
                    }
                ]
            }
        }
    ],
    "crossref": [
        {
            "id": "MBD3L4",
            "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=MBD3L4",
            "database": "GeneCards",
            "categories": [
                "Gene Annotation",
                "Organism-specific"
            ]
        },
        {
            "id": "653656",
            "url": "https://www.ncbi.nlm.nih.gov/gene/653656",
            "database": "GeneID",
            "categories": [
                "Genome Annotation"
            ]
        },
        {
            "id": "37206",
            "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=37206",
            "database": "HGNC",
            "categories": [
                "Organism-specific"
            ]
        },
        {
            "id": "IPR025884",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR025884",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR032343",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR032343",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "hsa:653656",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:653656",
            "database": "KEGG Pathway",
            "categories": [
                "Enzyme and Pathway"
            ]
        },
        {
            "id": "NX_A6NDZ8",
            "url": "https://www.nextprot.org/entry/NX_A6NDZ8",
            "database": "neXtProt",
            "categories": [
                "Protein",
                "Organism-specific"
            ]
        },
        {
            "id": "HLELCAY",
            "url": "https://omabrowser.org/oma/group/HLELCAY/",
            "database": "OMA",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "4849303at2759",
            "url": "http://www.orthodb.org/?query=4849303at2759",
            "database": "OrthoDB",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PF14048",
            "url": "http://pfam.xfam.org/family/PF14048",
            "database": "Pfam",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PF16564",
            "url": "http://pfam.xfam.org/family/PF16564",
            "database": "Pfam",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "A6NDZ8",
            "url": "https://pharos.nih.gov/targets/A6NDZ8",
            "database": "PHAROS",
            "categories": [
                "Organism-specific"
            ]
        },
        {
            "id": "NP_001157891",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001157891",
            "database": "RefSeq",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "A6NDZ8",
            "url": "https://www.uniprot.org/uniprot/A6NDZ8",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "A6NDZ8-1",
            "url": "https://www.uniprot.org/uniprot/A6NDZ8-1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        }
    ],
    "sequence": {
        "sequence": "MGEPAFTSFPSPPVLGKLKRNMMPWALQKKREIHMAKAHRRRAARSALPMRLTSCIFRRPVTRIRSHPDNQVRRRKGDEHLEKPQQLCAYRRLQALQPCSSQGEGSSPLHLESVLSILAPGTAGESLDRAGAERVRIPLEPTPGRFPAVAGGPTPGMGCQLPPPLSGQLVTPADIRRQARRVKKARERLAKALQADRLARQAEMLTCR",
        "length": 208,
        "header": "sp|A6NDZ8-1|MB3L4_HUMAN Isoform 1 of Putative methyl-CpG-binding domain protein 3-like 4  OS=Homo sapiens OX=9606 GN=MBD3L4 PE=5 SV=1 CANONICAL=A6NDZ8-1"
    },
    "isoforms": [
        {
            "isoform_ac": "A6NDZ8-1",
            "url": "",
            "sequence": {
                "sequence": "MGEPAFTSFPSPPVLGKLKRNMMPWALQKKREIHMAKAHRRRAARSALPMRLTSCIFRRPVTRIRSHPDNQVRRRKGDEHLEKPQQLCAYRRLQALQPCSSQGEGSSPLHLESVLSILAPGTAGESLDRAGAERVRIPLEPTPGRFPAVAGGPTPGMGCQLPPPLSGQLVTPADIRRQARRVKKARERLAKALQADRLARQAEMLTCR",
                "length": 208,
                "header": "sp|A6NDZ8-1|MB3L4_HUMAN Isoform 1 of Putative methyl-CpG-binding domain protein 3-like 4  OS=Homo sapiens OX=9606 GN=MBD3L4 PE=5 SV=1 CANONICAL=A6NDZ8-1"
            },
            "locus": {
                "chromosome": "19",
                "start_pos": 7040144,
                "end_pos": 7037864,
                "strand": "+",
                "evidence": [
                    {
                        "database": "Ensembl Transcript",
                        "id": "ENST00000381394.9",
                        "url": "https://www.ensembl.org/id/ENST00000381394.9"
                    },
                    {
                        "database": "Ensembl Peptide",
                        "id": "ENSP00000370801.4",
                        "url": "https://www.ensembl.org/id/ENSP00000370801.4"
                    }
                ]
            }
        }
    ],
    "glycosylation": [],
    "phosphorylation": [],
    "glycation": [],
    "keywords": [],
    "publication": [],
    "pathway": [
        {
            "id": "hsa:653656",
            "name": "",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:653656",
            "resource": "KEGG Pathway"
        }
    ],
    "orthologs": [
        {
            "uniprot_canonical_ac": "A6NE82-1",
            "protein_name": "Putative methyl-CpG-binding domain protein 3-like 3",
            "gene_name": "MBD3L3",
            "tax_id": 9606,
            "organism": "Homo sapiens",
            "sequence": {
                "sequence": "MGEPAFTSFPSPPVLGKLKRNMMPWALQKKREIHMAKAHRRRAARSALPMRLTSCIFRRPVTRIRSHPDNQVRRRKGDEHLEKPQQLCAYRRLQALQPCSSQGEGSSPLHLESVLSILAPGTAGESLDRAGAERVRSPLEPTPGRFPAVAGGPTPGMGCQLPPPLSGQLVTPADIRRQARRVKKARERLAKALQADRLARQAEMLTCR",
                "length": 208
            },
            "evidence": [
                {
                    "id": "45934557",
                    "url": "http://www.informatics.jax.org/homology/45934557",
                    "database": "MGI"
                }
            ],
            "common_name": "Human"
        },
        {
            "uniprot_canonical_ac": "A6NJ08-1",
            "protein_name": "Putative methyl-CpG-binding domain protein 3-like 5",
            "gene_name": "MBD3L5",
            "tax_id": 9606,
            "organism": "Homo sapiens",
            "sequence": {
                "sequence": "MGEPAFTSFPSPPVLGKLKRNMMPWALQKKREIHMAKAHRRRAARSALPMRLTSCIFRRPVTRIRSHPDNQVRRRKGDEHLEKPQQLCAYRRLQALQPCSSQGEGSSPLHLESVLSILAPGTAGESLDRAGAERVRIPLEPTPGRFPAVAGGPTPGMGCQLPPPLSGQLVTPADIRRQARRVKKARERLAKALQADRLARQAEMLTGG",
                "length": 208
            },
            "evidence": [
                {
                    "id": "45934557",
                    "url": "http://www.informatics.jax.org/homology/45934557",
                    "database": "MGI"
                }
            ],
            "common_name": "Human"
        },
        {
            "uniprot_canonical_ac": "D3ZHU7-1",
            "protein_name": "Uncharacterized protein",
            "gene_name": "Mbd3l2",
            "tax_id": 10116,
            "organism": "Rattus norvegicus",
            "sequence": {
                "sequence": "MEEPSGNSVSSQPLLGRLTRNMIPNKLQKTRKIRVAQSKTKTKRRSGGTFKDPLRRTSCIFPQPVTLITSYSENKTRYRRDEAKLQKPEQLCALQRLENLQVGEEDRNLSCPLKLANPVETIVQGMQDEANNQSGDKDQLTPGQVTSDQPPCLETTEQGALQLSPSFSSQGVTMPVPLRLSPSYCLQEVTTADIQRQAWKVKKARKRLAEALEADRLARQAENMRE",
                "length": 226
            },
            "evidence": [
                {
                    "id": "A6NDZ8",
                    "url": "https://omabrowser.org/oma/group/A6NDZ8/",
                    "database": "OMA"
                }
            ],
            "common_name": "Rat"
        },
        {
            "uniprot_canonical_ac": "Q3UXB0-1",
            "protein_name": "Methyl-CpG binding domain protein 3-like 2",
            "gene_name": "Mbd3l2",
            "tax_id": 10090,
            "organism": "Mus musculus",
            "sequence": {
                "sequence": "MEETSRNSVSSQPLIGSLTRSMILNKLQKRRETQIVPKKIKAKHRTGVTSKDSMRMTSCIFAKPVTTITSYPENETRYRREEDKLTKPKQLCALKRLKKHQVGENKQDLSCQLKLTNPVERIALGMRDETNDQSGVKGQLTPGEVTSVQTPCLEKNEQMAFQLSPFFSSPGVTMPVRLHLSPSYFIQEVTIADILSQIWKVKKARKRLEVALEADSLARQAENMGEQR",
                "length": 228
            },
            "evidence": [
                {
                    "id": "45934557",
                    "url": "http://www.informatics.jax.org/homology/45934557",
                    "database": "MGI"
                },
                {
                    "id": "A6NDZ8",
                    "url": "https://omabrowser.org/oma/group/A6NDZ8/",
                    "database": "OMA"
                }
            ],
            "common_name": "Mouse"
        },
        {
            "uniprot_canonical_ac": "Q8NHZ7-1",
            "protein_name": "Methyl-CpG-binding domain protein 3-like 2",
            "gene_name": "MBD3L2",
            "tax_id": 9606,
            "organism": "Homo sapiens",
            "sequence": {
                "sequence": "MGEPAFTSFPSLPVLGKLKRNMMPWALQKKREIHMAKAHRRRAARSALPMRLTSCIFRRPVTRIRSHPDNQVRRRKGDEHLEKPQQLCAYRRLQALQPCSSQGEGSSPLHLESVLSILAPGTAGESLDRAGAERVRSPLEPTPGRFPAVAGGPTPGMGCQLPPPLSGQLVTPADIRRQARRVKKARERLAKALQADRLARRAEMLTGG",
                "length": 208
            },
            "evidence": [
                {
                    "id": "45934557",
                    "url": "http://www.informatics.jax.org/homology/45934557",
                    "database": "MGI"
                }
            ],
            "common_name": "Human"
        }
    ],
    "go_annotation": {
        "categories": [
            {
                "name": "Biological Process",
                "total": 2,
                "go_terms": [
                    {
                        "name": "negative regulation of transcription by RNA polymerase II",
                        "id": "GO:0000122",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000122",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "A6NDZ8",
                                "url": "https://www.uniprot.org/uniprot/A6NDZ8"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "DNA methylation-dependent heterochromatin formation",
                        "id": "GO:0006346",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006346",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "A6NDZ8",
                                "url": "https://www.uniprot.org/uniprot/A6NDZ8"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            },
            {
                "name": "Cellular Component",
                "total": 1,
                "go_terms": [
                    {
                        "name": "nucleus",
                        "id": "GO:0005634",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "A6NDZ8",
                                "url": "https://www.uniprot.org/uniprot/A6NDZ8"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            },
            {
                "name": "Molecular Function",
                "total": 1,
                "go_terms": [
                    {
                        "name": "methyl-CpG binding",
                        "id": "GO:0008327",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008327",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "A6NDZ8",
                                "url": "https://www.uniprot.org/uniprot/A6NDZ8"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            }
        ]
    },
    "pro_annotation": [],
    "site_annotation": [],
    "ptm_annotation": [],
    "interactions": [],
    "reactions": [],
    "reaction_participants": [],
    "reaction_enzymes": [],
    "biomarkers": [],
    "synthesized_glycans": [],
    "cluster_types": [
        {
            "name": "homologset.mgi",
            "label": "MGI Homologs"
        },
        {
            "name": "homologset.oma",
            "label": "OMA Homologs"
        }
    ],
    "sequence_features": {
        "n_linked_sites": [],
        "o_linked_sites": [],
        "snv_sites": [],
        "glycation_sites": [],
        "phosphorylation_sites": [],
        "sequon_annotation_sites": []
    },
    "section_stats": [
        {
            "table_id": "glycosylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported_with_glycan",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_predicted",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_automatic_literature_mining",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "phosphorylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_non_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "publication",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                }
            ],
            "sort_fields": []
        }
    ]
}