{ "uniprot_canonical_ac": "A1L4H1-1", "uniprot_ac": "A1L4H1", "uniprot_id": "SRCRL_HUMAN", "mass": { "chemical_mass": 165743.0, "monoisotopic_mass": 165743.0 }, "refseq": { "ac": "NP_001138422", "name": "soluble scavenger receptor cysteine-rich domain-containing protein SSC5D isoform 1 precursor", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001138422" }, "gene_names": [ { "name": "SSC5D", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A1L4H1", "id": "A1L4H1" }, { "name": "S5D-SRCRB", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001138422", "id": "NP_001138422" }, { "name": "SSC5D", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001138422", "id": "NP_001138422" } ], "protein_names": [ { "name": "Soluble scavenger receptor cysteine-rich domain-containing protein SSC5D", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "A1L4H1" }, { "name": "SSc5D", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "A1L4H1" }, { "name": "Soluble scavenger protein with 5 SRCR domains", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "A1L4H1" }, { "name": "soluble scavenger receptor cysteine-rich domain-containing protein SSC5D isoform 1 precursor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001138422", "id": "NP_001138422" }, { "name": "soluble scavenger with 5 domains; soluble scavenger receptor cysteine-rich domain-containing protein SSC5D; scavenger receptor cysteine-rich glycoprotein; soluble scavenger protein with 5 SRCR domains; scavenger receptor cysteine rich domain containing (5 domains); scavenger receptor cysteine rich family, 5 domains", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001138422", "id": "NP_001138422" } ], "function": [ { "annotation": "Binds to extracellular matrix proteins. Binds to pathogen-associated molecular patterns (PAMPs) present on the cell walls of Gram-positive and Gram-negative bacteria and fungi, behaving as a pattern recognition receptor (PRR). Induces bacterial and fungal aggregation and subsequent inhibition of PAMP-induced cytokine release. Does not possess intrinsic bactericidal activity. May play a role in the innate defense and homeostasis of certain epithelial surfaces (By similarity).", "evidence": [ { "database": "UniProtKB", "id": "A1L4H1", "url": "https://www.uniprot.org/uniprot/A1L4H1#function" } ] } ], "disease": [], "snv": [ { "evidence": [ { "id": "rs1172762669", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1172762669" }, { "id": "rs1172762669", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1172762669" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 760, "end_pos": 760, "sequence_org": "S", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (SVS->NVS); o-glyco-site-loss (S->N).", "chr_id": "19", "chr_pos": "55500389", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S760", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1384662220", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1384662220" }, { "id": "rs1384662220", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1384662220#frequency_tab" }, { "id": "rs1384662220", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1384662220" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 1000, "end_pos": 1000, "sequence_org": "T", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (TRT->NRT).", "chr_id": "19", "chr_pos": "55517275", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T1000", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs978620110", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs978620110" }, { "id": "rs978620110", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs978620110#frequency_tab" }, { "id": "rs978620110", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs978620110" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 1025, "end_pos": 1025, "sequence_org": "D", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (DSS->NSS).", "chr_id": "19", "chr_pos": "55517349", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "D1025", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1252134990", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1252134990" }, { "id": "rs1252134990", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1252134990#frequency_tab" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 1169, "end_pos": 1169, "sequence_org": "P", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NPT->NHT).", "chr_id": "19", "chr_pos": "55517782", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "P1169", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1289054121", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1289054121" }, { "id": "rs1289054121", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1289054121" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 1169, "end_pos": 1169, "sequence_org": "P", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NPT->NTT).", "chr_id": "19", "chr_pos": "55517781", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "P1169", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1477223355", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1477223355" }, { "id": "rs1477223355", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1477223355" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 1290, "end_pos": 1290, "sequence_org": "T", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (TTT->NTT).", "chr_id": "19", "chr_pos": "55518145", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T1290", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs201151273", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs201151273" }, { "id": "rs201151273", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs201151273" }, { "id": "rs201151273", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs201151273#frequency_tab" }, { "id": "rs201151273", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs201151273" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 130, "end_pos": 130, "sequence_org": "D", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (DST->NST).", "chr_id": "19", "chr_pos": "55489908", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "D130", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs781395924", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs781395924" }, { "id": "rs781395924", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs781395924" }, { "id": "rs781395924", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs781395924#frequency_tab" }, { "id": "rs781395924", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs781395924" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 1445, "end_pos": 1445, "sequence_org": "T", "sequence_mut": "P", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->P).", "chr_id": "19", "chr_pos": "55518609", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T1445", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1486395573", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1486395573" }, { "id": "rs1486395573", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1486395573#frequency_tab" }, { "id": "rs1486395573", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1486395573" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 1458, "end_pos": 1458, "sequence_org": "T", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->N).", "chr_id": "19", "chr_pos": "55518649", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T1458", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1396465530", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1396465530" }, { "id": "rs1396465530", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1396465530#frequency_tab" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 1458, "end_pos": 1458, "sequence_org": "T", "sequence_mut": "P", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->P).", "chr_id": "19", "chr_pos": "55518648", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T1458", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1458521829", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1458521829" }, { "id": "rs1458521829", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1458521829" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 1558, "end_pos": 1558, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->I).", "chr_id": "19", "chr_pos": "55518949", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T1558", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1352490093", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1352490093" }, { "id": "rs1352490093", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1352490093" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 157, "end_pos": 157, "sequence_org": "T", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->K).", "chr_id": "19", "chr_pos": "55489990", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T157", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1599911003", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1599911003" }, { "id": "rs1599911003", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1599911003" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 168, "end_pos": 168, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAS->DAS).", "chr_id": "19", "chr_pos": "55490324", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N168", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1261535420", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1261535420" }, { "id": "rs1261535420", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1261535420" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 172, "end_pos": 172, "sequence_org": "K", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (KKS->NKS).", "chr_id": "19", "chr_pos": "55490338", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "K172", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1458083058", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1458083058" }, { "id": "rs1458083058", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1458083058#frequency_tab" }, { "id": "rs1458083058", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1458083058" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 288, "end_pos": 288, "sequence_org": "D", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (DHS->NHS).", "chr_id": "19", "chr_pos": "55491047", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "D288", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1415879047", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1415879047" }, { "id": "rs1415879047", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1415879047#frequency_tab" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 378, "end_pos": 378, "sequence_org": "T", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NET->NEA).", "chr_id": "19", "chr_pos": "55493831", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T378", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs748703264", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs748703264" }, { "id": "rs748703264", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs748703264" }, { "id": "rs748703264", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs748703264#frequency_tab" }, { "id": "rs748703264", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs748703264" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 378, "end_pos": 378, "sequence_org": "T", "sequence_mut": "M", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NET->NEM).", "chr_id": "19", "chr_pos": "55493832", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T378", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs748703264", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs748703264" }, { "id": "rs748703264", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs748703264" }, { "id": "rs748703264", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs748703264#frequency_tab" }, { "id": "rs748703264", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs748703264" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 378, "end_pos": 378, "sequence_org": "T", "sequence_mut": "R", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NET->NER).", "chr_id": "19", "chr_pos": "55493832", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T378", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1199675929", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1199675929" }, { "id": "rs1199675929", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1199675929#frequency_tab" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 420, "end_pos": 420, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NNS->KNS).", "chr_id": "19", "chr_pos": "55494656", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N420", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1356175343", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1356175343" }, { "id": "rs1356175343", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1356175343#frequency_tab" }, { "id": "rs1356175343", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1356175343" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 422, "end_pos": 422, "sequence_org": "S", "sequence_mut": "F", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NNS->NNF).", "chr_id": "19", "chr_pos": "55494661", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S422", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1170558904", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1170558904" }, { "id": "rs1170558904", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1170558904#frequency_tab" }, { "id": "rs1170558904", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1170558904" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 422, "end_pos": 422, "sequence_org": "S", "sequence_mut": "P", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NNS->NNP).", "chr_id": "19", "chr_pos": "55494660", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S422", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1206866487", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1206866487" }, { "id": "rs1206866487", "database": "NCI-TCGA", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1206866487" }, { "id": "rs1206866487", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1206866487#frequency_tab" }, { "id": "rs1206866487", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1206866487" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 558, "end_pos": 558, "sequence_org": "A", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NCA->NCT).", "chr_id": "19", "chr_pos": "55498164", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "A558", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1221939607", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1221939607" }, { "id": "rs1221939607", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1221939607#frequency_tab" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 581, "end_pos": 581, "sequence_org": "S", "sequence_mut": "R", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->R).", "chr_id": "19", "chr_pos": "55499853", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S581", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs919707900", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs919707900" }, { "id": "rs919707900", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs919707900" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 607, "end_pos": 607, "sequence_org": "S", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (SVT->NVT).", "chr_id": "19", "chr_pos": "55499930", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S607", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs372485783", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs372485783" }, { "id": "rs372485783", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs372485783#frequency_tab" }, { "id": "rs372485783", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs372485783" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 640, "end_pos": 640, "sequence_org": "T", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->N).", "chr_id": "19", "chr_pos": "55500029", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T640", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "A1L4H1", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A1L4H1" }, { "id": "rs1042519956", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1042519956" }, { "id": "rs1042519956", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1042519956#frequency_tab" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 649, "end_pos": 649, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "T", "sequence_mut": "M", "comment": "Somatic mutation passed 1 out of 6 filters: o-glyco-site-loss (T->M).", "chr_id": "19", "chr_pos": "55500056", "ref_nt": "C", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "T649", "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease", "ebi" ] }, { "evidence": [ { "id": "rs780568013", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs780568013" }, { "id": "rs780568013", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs780568013" }, { "id": "rs780568013", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs780568013" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 693, "end_pos": 693, "sequence_org": "T", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->A).", "chr_id": "19", "chr_pos": "55500187", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T693", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1480845802", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1480845802" }, { "id": "rs1480845802", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1480845802" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 693, "end_pos": 693, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->I).", "chr_id": "19", "chr_pos": "55500188", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T693", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs536432551", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs536432551" }, { "id": "rs536432551", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs536432551" }, { "id": "rs536432551", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs536432551#frequency_tab" }, { "id": "rs536432551", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs536432551" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 694, "end_pos": 694, "sequence_org": "S", "sequence_mut": "P", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->P).", "chr_id": "19", "chr_pos": "55500190", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "0.001198", "site_lbl": "S694", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "A1L4H1", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A1L4H1" }, { "id": "rs61747393", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs61747393" }, { "id": "rs61747393", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs61747393" }, { "id": "rs61747393", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs61747393" }, { "id": "rs61747393", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs61747393#frequency_tab" }, { "id": "rs61747393", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs61747393" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 699, "end_pos": 699, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "T", "sequence_mut": "M", "comment": "Somatic mutation passed 1 out of 6 filters: o-glyco-site-loss (T->M).", "chr_id": "19", "chr_pos": "55500206", "ref_nt": "C", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "T699", "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease", "ebi", "germline" ] }, { "evidence": [ { "id": "A1L4H1", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A1L4H1" } ], "glycoeffect": [], "start_pos": 708, "end_pos": 708, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "R", "sequence_mut": "W", "comment": "Somatic mutation passed 1 out of 6 filters: num. of cancers (3).", "chr_id": "19", "chr_pos": "55500232", "ref_nt": "C", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "R708", "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] }, { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] }, { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs1435736460", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1435736460" }, { "id": "rs1435736460", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1435736460" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 758, "end_pos": 758, "sequence_org": "S", "sequence_mut": "F", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->F).", "chr_id": "19", "chr_pos": "55500383", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S758", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1381305841", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1381305841" }, { "id": "rs1381305841", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1381305841" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 884, "end_pos": 884, "sequence_org": "T", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->A).", "chr_id": "19", "chr_pos": "55501066", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T884", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1177552507", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1177552507" }, { "id": "rs1177552507", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1177552507#frequency_tab" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 884, "end_pos": 884, "sequence_org": "T", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->N).", "chr_id": "19", "chr_pos": "55501067", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T884", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs760358777", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs760358777" }, { "id": "rs760358777", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs760358777" }, { "id": "rs760358777", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs760358777#frequency_tab" }, { "id": "rs760358777", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs760358777" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 939, "end_pos": 939, "sequence_org": "T", "sequence_mut": "M", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->M).", "chr_id": "19", "chr_pos": "55513041", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T939", "keywords": [ "ebi", "germline" ] } ], "mutagenesis": [], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "71.15", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000179954", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000179954" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "72.05", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000179954", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000179954" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "80.24", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000179954", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000179954" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "88.93", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000179954", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000179954" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "74.43", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000179954", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000179954" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "75.99", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000179954", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000179954" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "70.17", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000179954", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000179954" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "64.02", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000179954", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000179954" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "77.34", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000179954", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000179954" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "77.66", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000179954", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000179954" } ] } ], "expression_disease": [ { "significant": "Yes", "trend": "down", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "A1L4H1", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A1L4H1" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "A1L4H1", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A1L4H1" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "A1L4H1", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A1L4H1" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "A1L4H1", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A1L4H1" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "A1L4H1", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A1L4H1" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "No", "trend": "down", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "A1L4H1", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A1L4H1" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "A1L4H1", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A1L4H1" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "A1L4H1", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A1L4H1" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "A1L4H1", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A1L4H1" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "A1L4H1", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A1L4H1" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "A1L4H1", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A1L4H1" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "A1L4H1", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A1L4H1" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "A1L4H1", "url": "https://www.uniprot.org/uniprot/A1L4H1" } ], "common_name": "Human" } ], "gene": [ { "name": "SSC5D", "url": "https://www.uniprot.org/uniprot/A1L4H1", "locus": { "chromosome": "19", "start_pos": 55519099, "end_pos": 55488404, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000179954", "url": "https://www.ensembl.org/id/ENSG00000179954" } ] } } ], "crossref": [ { "id": "ENSG00000179954", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000179954", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "A1L4H1", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A1L4H1", "database": "BioMuta", "categories": [ "Variation" ] }, { "id": "SSC5D", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=SSC5D", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "284297", "url": "https://www.ncbi.nlm.nih.gov/gene/284297", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "26641", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=26641", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "A1L4H1", "url": "https://www.ebi.ac.uk/intact/interactors/id:A1L4H1*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR001190", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001190", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR017448", "url": "https://www.ebi.ac.uk/interpro/entry/IPR017448", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036772", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036772", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:284297", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:284297", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "618194", "url": "http://www.omim.org/entry/618194", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_A1L4H1", "url": "https://www.nextprot.org/entry/NX_A1L4H1", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "A1L4H1", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=A1L4H1", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "WTWDTPS", "url": "https://omabrowser.org/oma/group/WTWDTPS/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5265355at2759", "url": "http://www.orthodb.org/?query=5265355at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR48071", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR48071", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR48071:SF21", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR48071:SF21", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00530", "url": "http://pfam.xfam.org/family/PF00530", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "A1L4H1", "url": "https://pharos.nih.gov/targets/A1L4H1", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR:000050601", "url": "https://proconsortium.org/app/entry/PR:000050601", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000050602", "url": "https://proconsortium.org/app/entry/PR:000050602", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000050603", "url": "https://proconsortium.org/app/entry/PR:000050603", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000050604", "url": "https://proconsortium.org/app/entry/PR:000050604", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000050605", "url": "https://proconsortium.org/app/entry/PR:000050605", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000050606", "url": "https://proconsortium.org/app/entry/PR:000050606", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000050607", "url": "https://proconsortium.org/app/entry/PR:000050607", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000050608", "url": "https://proconsortium.org/app/entry/PR:000050608", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000050609", "url": "https://proconsortium.org/app/entry/PR:000050609", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000050610", "url": "https://proconsortium.org/app/entry/PR:000050610", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000050611", "url": "https://proconsortium.org/app/entry/PR:000050611", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000050612", "url": "https://proconsortium.org/app/entry/PR:000050612", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000050613", "url": "https://proconsortium.org/app/entry/PR:000050613", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000050614", "url": "https://proconsortium.org/app/entry/PR:000050614", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000050615", "url": "https://proconsortium.org/app/entry/PR:000050615", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000050616", "url": "https://proconsortium.org/app/entry/PR:000050616", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000050617", "url": "https://proconsortium.org/app/entry/PR:000050617", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000050618", "url": "https://proconsortium.org/app/entry/PR:000050618", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR_A1L4H1", "url": "http://purl.obolibrary.org/obo/PR_A1L4H1", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-3000471", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000471", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001138422", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001138422", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A1L4H1", "url": "DISABLED", "database": "UniCarbKB", "categories": [ "Glycoproteomics" ] }, { "id": "A1L4H1", "url": "https://www.uniprot.org/uniprot/A1L4H1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A1L4H1-1", "url": "https://www.uniprot.org/uniprot/A1L4H1-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A1L4H1-2", "url": "https://www.uniprot.org/uniprot/A1L4H1-2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "K7EPL3", "url": "https://www.uniprot.org/uniprot/K7EPL3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "K7EPL3-1", "url": "https://www.uniprot.org/uniprot/K7EPL3-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "M0QZ17", "url": "https://www.uniprot.org/uniprot/M0QZ17", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "M0QZ17-1", "url": "https://www.uniprot.org/uniprot/M0QZ17-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MRVLACLLAALVGIQAVERLRLADGPHGCAGRLEVWHGGRWGTVCDDGWDLRDAAVACRQLGCGGALAAPGGAFFGEGAGPVWLSELACRGNEGQLGLCHHRGWKAHICSHEEDAGVVCAGQRVANSRDDSTSPLDGAPWPGLLLELSPSTEEPLVTHAPRPAGNPQNASRKKSPRPKQAKSTRAPLLTTGAPRQERLRLVSGPHRCAGRLEVWHGGRWGTVCDDGWDLRDAAVACRELGCGGALAAPGGARFGPGAGPVWMDDVGCGGGEQALRDCPRSPWGRSNCDHSEDAGLVCTGPAPRLRLADGPHGCAGRLEVWHGGRWGSVCDDAWDLRDAAVACRELGCGGALAAPGGAFFGEGSGPIILDDLRCRGNETALRFCPARPWGQHDCHHREDAGAVCDGMPLGYVPPTAPTDSNNSTPREAASRPPSTMTSQAPGTAGVSPPPASPTVLWEPGPEAGSPQLRLVAGPSKCSGRLEVWHDQRWGTVCDDSWDMRDSAVVCRELGCGGPQQPDPAAGRFGWGAGPIWLDDVGCVGTEASLSDCPAAPWGKHNCAHNEDVGVTCTGPPGLDSISDPFSWSWIPGLGRDRDAWLPGELATKPSASVTASVLEKTTTKAPGKMPKSTKKWVTKNAKRPTTQPPVMPTTKHSRAQSPPDLTSQTTAALTTEASRRPTSEFTRRPTTEAPQRWTSHTTATLTPQAPRERTTKTMAMLTTQGPQEMTSESTIKSIPQASLEPSAEIPEGSPESPKDPAPSPSVSTTGESGLFRVRLADGPNRCAGRLEVWHAGRWGTVCDDNWDLRDATVACWELGCGKVRPRVGKTHYGPGTGPIWLDDMGCKGSEASLSDCPSGAWGKHNCDHEEDVGLTCTGYTDYDDYPPWTWDPTSREDLAKGTTTAGVPGHTLPWRTTRRPGSSSPAIRRLPDTGSKDGYKLPWTWDTPSGRGLAEGTPTAGKLGPTLGAGTTRSPGSPPTLRVHGDTGSPRKPWPERRPPRPAATRTAPPTPSPGPSASPGPPGPALTSDSSRELTPHSALTSEATSDAPDTSPPTPDPASRTNPDLILTSPDFALSTPDSSVVPALTPEPSPTPLPTLPKELTSDPSTPSEVTSLSPTSEQVPESDTTPDLDTTPYSSTVSEYSRSPDPSPSPHPTTTPDPTMAPDPITTLNPTVTPHFPTTPHPTTTPHPTTITHSTMIPDPTTTPQPFTTITHSTMIPDPTTTPQPFTTMQPTTTPHSTTPHPTTTPHPTTITHSTMIPDPTTTPQPFTTMQPTTMPHPTTTPHPTTTPHPTTTPHPTTTPHPTMTPDPTTTPYPTTTPDPTTTPHPTTPDPSSTPVITTVSLPTSLGTELSSPTLAPTVKPSLHPQLTFTAPAPHTSTSQIPTLEPSPALESSPSRSSTATSMDPLSTEDFKPPRSQSPNLTPPPTHTPHSASDLTVSPDPLLSPTAHPLDHPPLDPLTLGPTPGQSPGPHGPCVAPTPPVRVMACEPPALVELVAAVRDVGGQLQRLTQVVEQERQERQALLLGLTQLVEAARGLGQLGEAVKRLAEMAWTTSMPAPTTTTPEEEERPLRGDV", "length": 1573, "header": "sp|A1L4H1-1|SRCRL_HUMAN Isoform 1 of Soluble scavenger receptor cysteine-rich domain-containing protein SSC5D OS=Homo sapiens OX=9606 GN=SSC5D PE=1 SV=3 CANONICAL=A1L4H1-1" }, "isoforms": [ { "isoform_ac": "A1L4H1-1", "url": "", "sequence": { "sequence": "MRVLACLLAALVGIQAVERLRLADGPHGCAGRLEVWHGGRWGTVCDDGWDLRDAAVACRQLGCGGALAAPGGAFFGEGAGPVWLSELACRGNEGQLGLCHHRGWKAHICSHEEDAGVVCAGQRVANSRDDSTSPLDGAPWPGLLLELSPSTEEPLVTHAPRPAGNPQNASRKKSPRPKQAKSTRAPLLTTGAPRQERLRLVSGPHRCAGRLEVWHGGRWGTVCDDGWDLRDAAVACRELGCGGALAAPGGARFGPGAGPVWMDDVGCGGGEQALRDCPRSPWGRSNCDHSEDAGLVCTGPAPRLRLADGPHGCAGRLEVWHGGRWGSVCDDAWDLRDAAVACRELGCGGALAAPGGAFFGEGSGPIILDDLRCRGNETALRFCPARPWGQHDCHHREDAGAVCDGMPLGYVPPTAPTDSNNSTPREAASRPPSTMTSQAPGTAGVSPPPASPTVLWEPGPEAGSPQLRLVAGPSKCSGRLEVWHDQRWGTVCDDSWDMRDSAVVCRELGCGGPQQPDPAAGRFGWGAGPIWLDDVGCVGTEASLSDCPAAPWGKHNCAHNEDVGVTCTGPPGLDSISDPFSWSWIPGLGRDRDAWLPGELATKPSASVTASVLEKTTTKAPGKMPKSTKKWVTKNAKRPTTQPPVMPTTKHSRAQSPPDLTSQTTAALTTEASRRPTSEFTRRPTTEAPQRWTSHTTATLTPQAPRERTTKTMAMLTTQGPQEMTSESTIKSIPQASLEPSAEIPEGSPESPKDPAPSPSVSTTGESGLFRVRLADGPNRCAGRLEVWHAGRWGTVCDDNWDLRDATVACWELGCGKVRPRVGKTHYGPGTGPIWLDDMGCKGSEASLSDCPSGAWGKHNCDHEEDVGLTCTGYTDYDDYPPWTWDPTSREDLAKGTTTAGVPGHTLPWRTTRRPGSSSPAIRRLPDTGSKDGYKLPWTWDTPSGRGLAEGTPTAGKLGPTLGAGTTRSPGSPPTLRVHGDTGSPRKPWPERRPPRPAATRTAPPTPSPGPSASPGPPGPALTSDSSRELTPHSALTSEATSDAPDTSPPTPDPASRTNPDLILTSPDFALSTPDSSVVPALTPEPSPTPLPTLPKELTSDPSTPSEVTSLSPTSEQVPESDTTPDLDTTPYSSTVSEYSRSPDPSPSPHPTTTPDPTMAPDPITTLNPTVTPHFPTTPHPTTTPHPTTITHSTMIPDPTTTPQPFTTITHSTMIPDPTTTPQPFTTMQPTTTPHSTTPHPTTTPHPTTITHSTMIPDPTTTPQPFTTMQPTTMPHPTTTPHPTTTPHPTTTPHPTTTPHPTMTPDPTTTPYPTTTPDPTTTPHPTTPDPSSTPVITTVSLPTSLGTELSSPTLAPTVKPSLHPQLTFTAPAPHTSTSQIPTLEPSPALESSPSRSSTATSMDPLSTEDFKPPRSQSPNLTPPPTHTPHSASDLTVSPDPLLSPTAHPLDHPPLDPLTLGPTPGQSPGPHGPCVAPTPPVRVMACEPPALVELVAAVRDVGGQLQRLTQVVEQERQERQALLLGLTQLVEAARGLGQLGEAVKRLAEMAWTTSMPAPTTTTPEEEERPLRGDV", "length": 1573, "header": "sp|A1L4H1-1|SRCRL_HUMAN Isoform 1 of Soluble scavenger receptor cysteine-rich domain-containing protein SSC5D OS=Homo sapiens OX=9606 GN=SSC5D PE=1 SV=3 CANONICAL=A1L4H1-1" }, "locus": { "chromosome": "19", "start_pos": 55518995, "end_pos": 55488590, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000389623.11", "url": "https://www.ensembl.org/id/ENST00000389623.11" }, { "database": "Ensembl Peptide", "id": "ENSP00000374274.4", "url": "https://www.ensembl.org/id/ENSP00000374274.4" } ] } }, { "isoform_ac": "A1L4H1-2", "url": "", "sequence": { "sequence": "MRVLACLLAALVGIQAVERLRLADGPHGCAGRLEVWHGGRWGTVCDDGWDLRDAAVACRQLGCGGALAAPGGAFFGEGAGPVWLSELACRGNEGQLGLCHHRGWKAHICSHEEDAGVVCAGQRVANSRDDSTSPLDGAPWPGLLLELSPSTEEPLVTHAPRPAGNPQNASRKKSPRPKQAKSTRAPLLTTGAPRQERLRLVSGPHRCAGRLEVWHGGRWGTVCDDGWDLRDAAVACRELGCGGALAAPGGARFGPGAGPVWMDDVGCGGGEQALRDCPRSPWGRSNCDHSEDAGLVCTGPAPRLRLADGPHGCAGRLEVWHGGRWGSVCDDAWDLRDAAVACRELGCGGALAAPGGAFFGEGSGPIILDDLRCRGNETALRFCPARPWGQHDCHHREDAGAVCDGMPLGYVPPTAPTDSNNSTPREAASRPPSTMTSQAPGTAGVSPPPASPTVLWEPGPEAGSPQLRLVAGPSKCSGRLEVWHDQRWGTVCDDSWDMRDSAVVCRELGCGGPQQPDPAAGRFGWGAGPIWLDDVGCVGTEASLSDCPAAPWGKHNCAHNEDVGVTCTGPPGLDSISDPFSWSWIPGLGRDRDAWLPGELATKPSASVTASVLEKTTTKAPGKMPKSTKKWVTKNAKRPTTQPPVMPTTKHSRAQSPPDLTSQTTAALTTEASRRPTSEFTRRPTTEAPQRWTSHTTATLTPQAPRERTTKTMAMLTTQGPQEMTSESTIKSIPQASLEPSAEIPEGSPESPKDPAPSPSVSTTGESGLFRVRLADGPNRCAGRLEVWHAGRWGTVCDDNWDLRDATVACWELGCGKVRPRVGKTHYGPGTGPIWLDDMGCKGSEASLSDCPSGAWGKHNCDHEEDVGLTCTGYTDYDDYPPWTWDPTSREDLAKGTTTAGVPGHTLPWRTTRRPGSSSPAIRRLPDTEPEAGAPRGDAPRSRTARVAAPP", "length": 951, "header": "sp|A1L4H1-2|SRCRL_HUMAN Isoform 2 of Soluble scavenger receptor cysteine-rich domain-containing protein SSC5D OS=Homo sapiens OX=9606 GN=SSC5D PE=1 SV=3 CANONICAL=A1L4H1-1" }, "locus": { "chromosome": "19", "start_pos": 55504183, "end_pos": 55488590, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000587166.5", "url": "https://www.ensembl.org/id/ENST00000587166.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000467252.1", "url": "https://www.ensembl.org/id/ENSP00000467252.1" } ] } }, { "isoform_ac": "K7EPL3-1", "url": "", "sequence": { "sequence": "DAGAVCDGMPLGYVPPTAPTDSNNSTPREAASRPPSTMTSQAPGTAGVSPPPASPTVLWEPGPEAGPPGLDSISDPFSWSWIPGLGRDRDAWLPGELATKPSASVTASVLEKTTTKAP", "length": 118, "header": "tr|K7EPL3-1|SRCRL_HUMAN Computationally mapped isoform of Soluble scavenger receptor cysteine-rich domain-containing protein SSC5D OS=Homo sapiens OX=9606 GN=SSC5D PE=1 SV=2 CANONICAL=A1L4H1-1" }, "locus": { "chromosome": "19", "start_pos": 55499973, "end_pos": 55493891, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000589020.1", "url": "https://www.ensembl.org/id/ENST00000589020.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000467434.2", "url": "https://www.ensembl.org/id/ENSP00000467434.2" } ] } }, { "isoform_ac": "M0QZ17-1", "url": "", "sequence": { "sequence": "MRVLACLLAALVGIQAVERLRLADGPHGCAGRLEVWHGGRWGTVCDDGWDLRDAAVACRQLGCGGALAAPGGAFFGEGAGPVWLSELACR", "length": 90, "header": "tr|M0QZ17-1|M0QZ17_HUMAN Computationally mapped isoform of Scavenger receptor cysteine rich family member with 5 domains OS=Homo sapiens OX=9606 GN=SSC5D PE=1 SV=1 CANONICAL=A1L4H1-1" }, "locus": { "chromosome": "19", "start_pos": 55489571, "end_pos": 55488590, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000594321.5", "url": "https://www.ensembl.org/id/ENST00000594321.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000470226.1", "url": "https://www.ensembl.org/id/ENSP00000470226.1" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G57317CE", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 1047, "start_aa": "Thr", "end_pos": 1047, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1047", "evidence": [ { "id": "A1L4H1", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G73004SD", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 1047, "start_aa": "Thr", "end_pos": 1047, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1047", "evidence": [ { "id": "A1L4H1", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 1445, "start_aa": "Thr", "end_pos": 1445, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1445", "evidence": [ { "id": "A1L4H1", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 1458, "start_aa": "Thr", "end_pos": 1458, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1458", "evidence": [ { "id": "A1L4H1", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 1462, "start_aa": "Thr", "end_pos": 1462, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1462", "evidence": [ { "id": "A1L4H1", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G58001LT", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 1462, "start_aa": "Thr", "end_pos": 1462, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1462", "evidence": [ { "id": "A1L4H1", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 1466, "start_aa": "Ser", "end_pos": 1466, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser1466", "evidence": [ { "id": "A1L4H1", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G29063QY", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 1558, "start_aa": "Thr", "end_pos": 1558, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1558", "evidence": [ { "id": "A1L4H1", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G53434XO", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 1558, "start_aa": "Thr", "end_pos": 1558, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1558", "evidence": [ { "id": "A1L4H1", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G73004SD", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 1558, "start_aa": "Thr", "end_pos": 1558, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1558", "evidence": [ { "id": "A1L4H1", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 157, "start_aa": "Thr", "end_pos": 157, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr157", "evidence": [ { "id": "A1L4H1", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 168, "start_aa": "Asn", "end_pos": 168, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn168", "evidence": [ { "id": "A1L4H1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A1L4H1#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 376, "start_aa": "Asn", "end_pos": 376, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn376", "evidence": [ { "id": "A1L4H1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A1L4H1#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 420, "start_aa": "Asn", "end_pos": 420, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn420", "evidence": [ { "id": "A1L4H1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A1L4H1#ptm_processing" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 453, "start_aa": "Thr", "end_pos": 453, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr453", "evidence": [ { "id": "A1L4H1", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 581, "start_aa": "Ser", "end_pos": 581, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser581", "evidence": [ { "id": "A1L4H1", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 640, "start_aa": "Thr", "end_pos": 640, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr640", "evidence": [ { "id": "A1L4H1", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=A1L4H1" }, { "id": "28411811", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28411811" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 649, "start_aa": "Thr", "end_pos": 649, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr649", "evidence": [ { "id": "A1L4H1", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=A1L4H1" }, { "id": "28411811", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28411811" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "WTSHTTATLTPQAPR", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 692, "start_aa": "Trp", "end_pos": 706, "end_aa": "Arg", "evidence": [ { "id": "A1L4H1", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 693, "start_aa": "Thr", "end_pos": 693, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr693", "evidence": [ { "id": "A1L4H1", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 694, "start_aa": "Ser", "end_pos": 694, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser694", "evidence": [ { "id": "A1L4H1", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 696, "start_aa": "Thr", "end_pos": 696, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr696", "evidence": [ { "id": "A1L4H1", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 697, "start_aa": "Thr", "end_pos": 697, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr697", "evidence": [ { "id": "A1L4H1", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 699, "start_aa": "Thr", "end_pos": 699, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr699", "evidence": [ { "id": "A1L4H1", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 701, "start_aa": "Thr", "end_pos": 701, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr701", "evidence": [ { "id": "A1L4H1", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G53434XO", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 758, "start_aa": "Ser", "end_pos": 758, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser758", "evidence": [ { "id": "A1L4H1", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 760, "start_aa": "Ser", "end_pos": 760, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser760", "evidence": [ { "id": "A1L4H1", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 764, "start_aa": "Thr", "end_pos": 764, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr764", "evidence": [ { "id": "A1L4H1", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 884, "start_aa": "Thr", "end_pos": 884, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr884", "evidence": [ { "id": "A1L4H1", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 939, "start_aa": "Thr", "end_pos": 939, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr939", "evidence": [ { "id": "A1L4H1", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] } ], "phosphorylation": [], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported_with_glycan", "glycoprotein_predicted" ], "publication": [ { "title": "Precision mapping of the human O-GalNAc glycoproteome through SimpleCell technology", "journal": "EMBO J", "date": "2013", "authors": "Steentoft C., Vakhrushev S.Y., Joshi H.J., Kong Y., Vester-Christensen M.B., Schjoldager K.T., Lavrsen K., Dabelsteen S., Pedersen N.B., Marcos-Silva L., Gupta R., Bennett E.P., Mandel U., Brunak S., Wandall H.H., Levery S.B., Clausen H.", "evidence": [ { "database": "UniCarbKB", "id": "A1L4H1", "url": "" } ], "reference": [ { "type": "DOI", "id": "10.1038/emboj.2013.79", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "title": "Uptake and fate of class B scavenger receptor ligands in HepG2 cells.", "journal": "European journal of biochemistry", "date": "1999", "authors": "Rhainds D, Falstrault L, Tremblay C, Brissette L", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000471", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000471" } ], "reference": [ { "type": "PubMed", "id": "10103054", "url": "https://glygen.org/publication/PubMed/10103054" } ] }, { "title": "The binding of oxidized low density lipoprotein to mouse CD36 is mediated in part by oxidized phospholipids that are associated with both the lipid and protein moieties of the lipoprotein.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Boullier A, Gillotte KL, Horkko S, Green SR, Friedman P, Dennis EA, Witztum JL, Steinberg D, Quehenberger O", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000471", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000471" } ], "reference": [ { "type": "PubMed", "id": "10734051", "url": "https://glygen.org/publication/PubMed/10734051" } ] }, { "title": "Macrophage scavenger receptor CD36 is the major receptor for LDL modified by monocyte-generated reactive nitrogen species.", "journal": "The Journal of clinical investigation", "date": "2000", "authors": "Podrez EA, Febbraio M, Sheibani N, Schmitt D, Silverstein RL, Hajjar DP, Cohen PA, Frazier WA, Hoff HF, Hazen SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000471", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000471" } ], "reference": [ { "type": "PubMed", "id": "10772654", "url": "https://glygen.org/publication/PubMed/10772654" } ] }, { "title": "Oxidized LDL-induced NF-kappa B activation and subsequent expression of proinflammatory genes are defective in monocyte-derived macrophages from CD36-deficient patients.", "journal": "Arteriosclerosis, thrombosis, and vascular biology", "date": "2000", "authors": "Janabi M, Yamashita S, Hirano K, Sakai N, Hiraoka H, Matsumoto K, Zhang Z, Nozaki S, Matsuzawa Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000471", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000471" } ], "reference": [ { "type": "PubMed", "id": "10938017", "url": "https://glygen.org/publication/PubMed/10938017" } ] }, { "title": "Reconstituted discoidal ApoE-phospholipid particles are ligands for the scavenger receptor BI. The amino-terminal 1-165 domain of ApoE suffices for receptor binding.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Li X, Kan HY, Lavrentiadou S, Krieger M, Zannis V", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000471", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000471" } ], "reference": [ { "type": "PubMed", "id": "11861652", "url": "https://glygen.org/publication/PubMed/11861652" } ] }, { "title": "CD36 mediates the cardiovascular action of growth hormone-releasing peptides in the heart.", "journal": "Circulation research", "date": "2002", "authors": "Bodart V, Febbraio M, Demers A, McNicoll N, Pohankova P, Perreault A, Sejlitz T, Escher E, Silverstein RL, Lamontagne D, Ong H", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000471", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000471" } ], "reference": [ { "type": "PubMed", "id": "11988484", "url": "https://glygen.org/publication/PubMed/11988484" } ] }, { "title": "Identification of a novel family of oxidized phospholipids that serve as ligands for the macrophage scavenger receptor CD36.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Podrez EA, Poliakov E, Shen Z, Zhang R, Deng Y, Sun M, Finton PJ, Shan L, Gugiu B, Fox PL, Hoff HF, Salomon RG, Hazen SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000471", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000471" } ], "reference": [ { "type": "PubMed", "id": "12105195", "url": "https://glygen.org/publication/PubMed/12105195" } ] }, { "title": "Lipid free apolipoprotein E binds to the class B Type I scavenger receptor I (SR-BI) and enhances cholesteryl ester uptake from lipoproteins.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Bultel-Brienne S, Lestavel S, Pilon A, Laffont I, Tailleux A, Fruchart JC, Siest G, Clavey V", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000471", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000471" } ], "reference": [ { "type": "PubMed", "id": "12138091", "url": "https://glygen.org/publication/PubMed/12138091" } ] }, { "title": "Binding and internalization of lipopolysaccharide by Cla-1, a human orthologue of rodent scavenger receptor B1.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Vishnyakova TG, Bocharov AV, Baranova IN, Chen Z, Remaley AT, Csako G, Eggerman TL, Patterson AP", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000471", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000471" } ], "reference": [ { "type": "PubMed", "id": "12651854", "url": "https://glygen.org/publication/PubMed/12651854" } ] }, { "title": "Endocytosis of oxidized low density lipoprotein through scavenger receptor CD36 utilizes a lipid raft pathway that does not require caveolin-1.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Zeng Y, Tao N, Chung KN, Heuser JE, Lublin DM", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000471", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000471" } ], "reference": [ { "type": "PubMed", "id": "12947091", "url": "https://glygen.org/publication/PubMed/12947091" } ] }, { "title": "High density lipoprotein uptake by scavenger receptor SR-BII.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Eckhardt ER, Cai L, Sun B, Webb NR, van der Westhuyzen DR", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000471", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000471" } ], "reference": [ { "type": "PubMed", "id": "14726519", "url": "https://glygen.org/publication/PubMed/14726519" } ] }, { "title": "Serum amyloid A binding to CLA-1 (CD36 and LIMPII analogous-1) mediates serum amyloid A protein-induced activation of ERK1/2 and p38 mitogen-activated protein kinases.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Baranova IN, Vishnyakova TG, Bocharov AV, Kurlander R, Chen Z, Kimelman ML, Remaley AT, Csako G, Thomas F, Eggerman TL, Patterson AP", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000471", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000471" } ], "reference": [ { "type": "PubMed", "id": "15576377", "url": "https://glygen.org/publication/PubMed/15576377" } ] }, { "title": "CD36 is a sensor of diacylglycerides.", "journal": "Nature", "date": "2005", "authors": "Hoebe K, Georgel P, Rutschmann S, Du X, Mudd S, Crozat K, Sovath S, Shamel L, Hartung T, Zahringer U, Beutler B", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000471", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000471" } ], "reference": [ { "type": "PubMed", "id": "15690042", "url": "https://glygen.org/publication/PubMed/15690042" } ] }, { "title": "Endocytosis is not required for the selective lipid uptake mediated by murine SR-BI.", "journal": "Biochimica et biophysica acta", "date": "2005", "authors": "Nieland TJ, Ehrlich M, Krieger M, Kirchhausen T", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000471", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000471" } ], "reference": [ { "type": "PubMed", "id": "15866482", "url": "https://glygen.org/publication/PubMed/15866482" } ] }, { "title": "CD36 involvement in orosensory detection of dietary lipids, spontaneous fat preference, and digestive secretions.", "journal": "The Journal of clinical investigation", "date": "2005", "authors": "Laugerette F, Passilly-Degrace P, Patris B, Niot I, Febbraio M, Montmayeur JP, Besnard P", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000471", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000471" } ], "reference": [ { "type": "PubMed", "id": "16276419", "url": "https://glygen.org/publication/PubMed/16276419" } ] }, { "title": "High density lipoprotein endocytosis by scavenger receptor SR-BII is clathrin-dependent and requires a carboxyl-terminal dileucine motif.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Eckhardt ER, Cai L, Shetty S, Zhao Z, Szanto A, Webb NR, Van der Westhuyzen DR", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000471", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000471" } ], "reference": [ { "type": "PubMed", "id": "16368683", "url": "https://glygen.org/publication/PubMed/16368683" } ] }, { "title": "SR-BI-mediated high density lipoprotein (HDL) endocytosis leads to HDL resecretion facilitating cholesterol efflux.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Pagler TA, Rhode S, Neuhofer A, Laggner H, Strobl W, Hinterndorfer C, Volf I, Pavelka M, Eckhardt ER, van der Westhuyzen DR, Schutz GJ, Stangl H", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000471", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000471" } ], "reference": [ { "type": "PubMed", "id": "16488891", "url": "https://glygen.org/publication/PubMed/16488891" } ] }, { "title": "Oxidized phosphatidylserine-CD36 interactions play an essential role in macrophage-dependent phagocytosis of apoptotic cells.", "journal": "The Journal of experimental medicine", "date": "2006", "authors": "Greenberg ME, Sun M, Zhang R, Febbraio M, Silverstein R, Hazen SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000471", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000471" } ], "reference": [ { "type": "PubMed", "id": "17101731", "url": "https://glygen.org/publication/PubMed/17101731" } ] }, { "title": "The inhibition of endocytosis affects HDL-lipid uptake mediated by the human scavenger receptor class B type I.", "journal": "Molecular membrane biology", "date": "2007", "authors": "Zhang Y, Ahmed AM, Tran TL, Lin J, McFarlane N, Boreham DR, Igdoura SA, Truant R, Trigatti BL", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000471", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000471" } ], "reference": [ { "type": "PubMed", "id": "17710648", "url": "https://glygen.org/publication/PubMed/17710648" } ] }, { "title": "Distinct mechanisms for OxLDL uptake and cellular trafficking by class B scavenger receptors CD36 and SR-BI.", "journal": "Journal of lipid research", "date": "2007", "authors": "Sun B, Boyanovsky BB, Connelly MA, Shridas P, van der Westhuyzen DR, Webb NR", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000471", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000471" } ], "reference": [ { "type": "PubMed", "id": "17876058", "url": "https://glygen.org/publication/PubMed/17876058" } ] }, { "title": "Cellular trafficking of lipoteichoic acid and Toll-like receptor 2 in relation to signaling: role of CD14 and CD36.", "journal": "Journal of leukocyte biology", "date": "2008", "authors": "Nilsen NJ, Deininger S, Nonstad U, Skjeldal F, Husebye H, Rodionov D, von Aulock S, Hartung T, Lien E, Bakke O, Espevik T", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000471", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000471" } ], "reference": [ { "type": "PubMed", "id": "18458151", "url": "https://glygen.org/publication/PubMed/18458151" } ] }, { "title": "CD36 N-terminal cytoplasmic domain is not required for the internalization of oxidized low-density lipoprotein.", "journal": "Bioscience reports", "date": "2008", "authors": "McDermott-Roe C, Martin J, Collot-Teixeira S, McGregor JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000471", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000471" } ], "reference": [ { "type": "PubMed", "id": "18558917", "url": "https://glygen.org/publication/PubMed/18558917" } ] }, { "title": "Evolutionarily conserved recognition and innate immunity to fungal pathogens by the scavenger receptors SCARF1 and CD36.", "journal": "The Journal of experimental medicine", "date": "2009", "authors": "Means TK, Mylonakis E, Tampakakis E, Colvin RA, Seung E, Puckett L, Tai MF, Stewart CR, Pukkila-Worley R, Hickman SE, Moore KJ, Calderwood SB, Hacohen N, Luster AD, El Khoury J", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000471", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000471" } ], "reference": [ { "type": "PubMed", "id": "19237602", "url": "https://glygen.org/publication/PubMed/19237602" } ] }, { "title": "Molecular cloning and analysis of SSc5D, a new member of the scavenger receptor cysteine-rich superfamily.", "journal": "Mol. Immunol.", "date": "2009", "authors": "Gon\u00e7alves Carine M, Castro M\u00f3nica A A, Henriques Telmo, Oliveira Marta I, Pinheiro Hugo C, Oliveira Carla, Sreenu Vattipally B, Evans Edward J, Davis Simon J, Moreira Alexandra, Carmo Alexandre M", "evidence": [ { "database": "UniProtKB", "id": "A1L4H1", "url": "https://www.uniprot.org/uniprot/A1L4H1" } ], "reference": [ { "type": "PubMed", "id": "19535143", "url": "https://glygen.org/publication/PubMed/19535143" } ] }, { "title": "Uptake of oxidized low density lipoprotein by CD36 occurs by an actin-dependent pathway distinct from macropinocytosis.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Collins RF, Touret N, Kuwata H, Tandon NN, Grinstein S, Trimble WS", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000471", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000471" } ], "reference": [ { "type": "PubMed", "id": "19740737", "url": "https://glygen.org/publication/PubMed/19740737" } ] }, { "title": "Precision mapping of the human O-GalNAc glycoproteome through SimpleCell technology.", "journal": "The EMBO journal", "date": "2013", "authors": "Steentoft C, Vakhrushev SY, Joshi HJ, Kong Y, Vester-Christensen MB, Schjoldager KT, Lavrsen K, Dabelsteen S, Pedersen NB, Marcos-Silva L, Gupta R, Bennett EP, Mandel U, Brunak S, Wandall HH, Levery SB, Clausen H", "evidence": [ { "database": "UniCarbKB", "id": "A1L4H1", "url": "" } ], "reference": [ { "type": "PubMed", "id": "23584533", "url": "https://glygen.org/publication/PubMed/23584533" } ] }, { "title": "The Scavenger Receptor SSc5D Physically Interacts with Bacteria through the SRCR-Containing N-Terminal Domain.", "journal": "Frontiers in immunology", "date": "2016", "authors": "Bessa Pereira C, Bockova M, Santos RF, Santos AM, Martins de Araujo M, Oliveira L, Homola J, Carmo AM", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000471", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000471" } ], "reference": [ { "type": "PubMed", "id": "27790215", "url": "https://glygen.org/publication/PubMed/27790215" } ] }, { "title": "A novel strategy for global mapping of O-GlcNAc proteins and peptides using selective enzymatic deglycosylation, HILIC enrichment and mass spectrometry identification.", "journal": "Talanta", "date": "2017", "authors": "Shen B, Zhang W, Shi Z, Tian F, Deng Y, Sun C, Wang G, Qin W, Qian X", "evidence": [ { "database": "O-GlcNAc Database", "id": "A1L4H1", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=A1L4H1" } ], "reference": [ { "type": "PubMed", "id": "28411811", "url": "https://glygen.org/publication/PubMed/28411811" } ] }, { "title": "Mapping the O-glycoproteome using site-specific extraction of O-linked glycopeptides (EXoO).", "journal": "Molecular systems biology", "date": "2018", "authors": "Yang W, Ao M, Hu Y, Li QK, Zhang H", "evidence": [ { "database": "UniCarbKB", "id": "A1L4H1", "url": "" } ], "reference": [ { "type": "PubMed", "id": "30459171", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "title": "Next-generation unnatural monosaccharides reveal that ESRRB O-GlcNAcylation regulates pluripotency of mouse embryonic stem cells.", "journal": "Nature communications", "date": "2019", "authors": "Hao Y, Fan X, Shi Y, Zhang C, Sun DE, Qin K, Qin W, Zhou W, Chen X", "evidence": [ { "database": "O-GlcNAc Database", "id": "A1L4H1", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=A1L4H1" } ], "reference": [ { "type": "PubMed", "id": "31492838", "url": "https://glygen.org/publication/PubMed/31492838" } ] }, { "title": "CD36 gene transfer confers capacity for phagocytosis of cells undergoing apoptosis.", "journal": "The Journal of experimental medicine", "date": "1995", "authors": "Ren Y, Silverstein RL, Allen J, Savill J", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000471", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000471" } ], "reference": [ { "type": "PubMed", "id": "7536797", "url": "https://glygen.org/publication/PubMed/7536797" } ] }, { "title": "CD36 is a receptor for oxidized low density lipoprotein.", "journal": "The Journal of biological chemistry", "date": "1993", "authors": "Endemann G, Stanton LW, Madden KS, Bryant CM, White RT, Protter AA", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000471", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000471" } ], "reference": [ { "type": "PubMed", "id": "7685021", "url": "https://glygen.org/publication/PubMed/7685021" } ] }, { "title": "Cloning of a rat adipocyte membrane protein implicated in binding or transport of long-chain fatty acids that is induced during preadipocyte differentiation. Homology with human CD36.", "journal": "The Journal of biological chemistry", "date": "1993", "authors": "Abumrad NA, el-Maghrabi MR, Amri EZ, Lopez E, Grimaldi PA", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000471", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000471" } ], "reference": [ { "type": "PubMed", "id": "7688729", "url": "https://glygen.org/publication/PubMed/7688729" } ] }, { "title": "Murine SR-BI, a high density lipoprotein receptor that mediates selective lipid uptake, is N-glycosylated and fatty acylated and colocalizes with plasma membrane caveolae.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Babitt J, Trigatti B, Rigotti A, Smart EJ, Anderson RG, Xu S, Krieger M", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000471", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000471" } ], "reference": [ { "type": "PubMed", "id": "9148942", "url": "https://glygen.org/publication/PubMed/9148942" } ] }, { "title": "Characterization of CLA-1, a human homologue of rodent scavenger receptor BI, as a receptor for high density lipoprotein and apoptotic thymocytes.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Murao K, Terpstra V, Green SR, Kondratenko N, Steinberg D, Quehenberger O", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000471", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000471" } ], "reference": [ { "type": "PubMed", "id": "9211901", "url": "https://glygen.org/publication/PubMed/9211901" } ] }, { "title": "Apolipoproteins of HDL can directly mediate binding to the scavenger receptor SR-BI, an HDL receptor that mediates selective lipid uptake.", "journal": "Journal of lipid research", "date": "1997", "authors": "Xu S, Laccotripe M, Huang X, Rigotti A, Zannis VI, Krieger M", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000471", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000471" } ], "reference": [ { "type": "PubMed", "id": "9254056", "url": "https://glygen.org/publication/PubMed/9254056" } ] }, { "title": "CLA-1 is an 85-kD plasma membrane glycoprotein that acts as a high-affinity receptor for both native (HDL, LDL, and VLDL) and modified (OxLDL and AcLDL) lipoproteins.", "journal": "Arteriosclerosis, thrombosis, and vascular biology", "date": "1997", "authors": "Calvo D, Gomez-Coronado D, Lasuncion MA, Vega MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000471", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000471" } ], "reference": [ { "type": "PubMed", "id": "9409200", "url": "https://glygen.org/publication/PubMed/9409200" } ] }, { "title": "CD36 is required for phagocytosis of apoptotic cells by human macrophages that use either a phosphatidylserine receptor or the vitronectin receptor (alpha v beta 3).", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1998", "authors": "Fadok VA, Warner ML, Bratton DL, Henson PM", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000471", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000471" } ], "reference": [ { "type": "PubMed", "id": "9834113", "url": "https://glygen.org/publication/PubMed/9834113" } ] } ], "pathway": [ { "id": "hsa:284297", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:284297", "resource": "KEGG Pathway" }, { "id": "R-HSA-3000471", "name": "Scavenging by Class B Receptors", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000471", "resource": "Reactome", "description": "Scavenging by Class B Receptors" } ], "orthologs": [ { "uniprot_canonical_ac": "D3ZPK4-1", "protein_name": "Scavenger receptor cysteine rich family member with 5 domains", "gene_name": "Ssc5d", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MRVLACLLAMLVGIQAIERLRLADGPHGCAGRLEVWYSGRWGTVCDDGWDLRDAAVACRVLGCGGALAAPGGAFFGEGTGPVWLSELACRGSEGQLGICPHRGWKAHICSHEEDAGVVCVGQRAANSREDSVSLLDGDPWLALSGELSPSSEEPPITHAPQPAASSQNGPRKKNPRPPKQVKSTRAPVLTNGAPRQERLRLVSGPHGCAGRLEVWHGGRWGTVCDDGWDLRDAAVACRELGCGGALAAPGGARFGPGEGPVWMDDVGCGGGEEALRDCPRSPWGRSNCDHTEDAGLVCTGPAPRLRLADGPHGCAGRLEVWHGGRWGSVCDDAWDLRDAAVACRELGCGGALAAPGGAFFGEGAGPIILDDLRCRGNETALRFCPARPWGQHDCHHREDAGAVCDGMPLGGDVQPTAPAVDSNRTTPRLQSTSVGHTPGPAGSWPPPASPTAPPEPGPEAGSPQLRLVAGPSRCSGRLEVWHDGRWGTVCDDSWDMRDSAVVCRELGCGGPRQPDPAAGRFGWGAGPIWLDDVGCVGTEASLSECPAASWGKHNCAHNEDVGVTCTGTPGLDTISDPFSWSWLPGLGRDQDAWLPGELATKPSASLTSSVLQKTTKAPGKVPKSTKKWVTKNAKRPTTQPPGIPITKRPRVPGTPTSLSPTPRTSELPKRLTAEAPRRQTSHTTERLTPRVPWEWTSETAASLSTQGPQEVTSEATTAQTPQTSLEPFGENPEGSLESSQDPAATPTAGVPVPSGPFRVRLADGPNRCAGRLEVWHAGLWGTVCDDSWDLRDATVACWELGCGKVRPRVGKTHYGPGTGPIWLDDMGCKGSETSLSDCPSGTWGKHNCDHEEDVVLTCTGYTGDDDYPSWTWDPTSEEDLTKRTTVATQPGHTPSWATTTNPEVLSPATQSLPDIDDQGSYELSWTWDTPSGRSLSKGTPTTTKPGSTVTTSTRKSPGHPFPAPRARANTGLPRKPKPERRTLQPTSARTTHTTSSPASYTSPEPSGSQQTSGSWPQLFPDLASKQEGTSTPPKTSPLTPGLPSPTNFALSTTDASLLPTRPPELSGSPTSNSPEGLTSDSPMLLEVSSLSPTSELTPGSDMTPDLGTAPKIIPESSESSDLPTSPSTHTQPFTASYPTSIPHPTTIPHPTTTPHPRAPSHPTTIPQLNTTSYPTMALQPTTNPQHPGSPHPTTSPQPPTNTHSSSTSATPTKSLPSSPETEFSSPTPQPRVKPSLHPDLTFVGVPPTGKSQMQNLEFSLASESGPSRPSPAPSMDPLSTEVFKPPRSQTLHSVSEPMVTADLAISSMAHPSDQPPPDRLAQGPTSNHNPGPFGPCVSSVPPVRVMACEPPALVELVAAVREVGDQLQRLTRVLEQDRQERQVLGLGLVKLVEAAQGLGQLSETVKRLAEVAWPPSTPVPTTTTTEEEERPLRGDV", "length": 1436 }, "evidence": [ { "id": "45929673", "url": "http://www.informatics.jax.org/homology/45929673", "database": "MGI" }, { "id": "A1L4H1", "url": "https://omabrowser.org/oma/group/A1L4H1/", "database": "OMA" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q8BV57-1", "protein_name": "Soluble scavenger receptor cysteine-rich domain-containing protein SSC5D", "gene_name": "Ssc5d", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MRGLACLLAMLVGIQAIERLRLADGPHGCAGRLEVWHSGRWGTVCDDGWDLRDAEVACRVLGCGGALAAPGGAFFGEGTGPVWLSELNCRGNEGQLGICPHRGWKAHICSHEEDAGVVCVGQRAANSREDSMSLLDGDPWLALSGELSPSSEEPPITHAPQPAASSQNGPRKKNPRPPKQTKSTRAPVLTNGAPHQERLRLVSGPHGCAGRLEVWHGGRWGTVCDDGWDLRDAAVACRELGCGGALAAPGGARFGPGEGPVWMDDVGCGGGEEALRDCPRSPWGRSNCDHTEDAGLVCTGPAPRIRLADGPHGCAGRLEVWHGGRWGSVCDDAWDLRDAAVACKELGCGGALAAPGGAFFGEGTGPIILDDLRCRGNETALRFCPARPWGQHDCHHREDAGAVCDGMPLGAVQPTVPAVDSNSTAHRLLSTSVGQMPGPAGPWPPSASPTAPPEPGPEAGSPQLRLVAGPSRCSGRLEVWHDGRWGTVCDDSWDMRDSAVVCRELGCGRPRQPDPAAGRFGWGAGPIWLDDVGCMGTEASLSECPAASWGKHNCAHNEDVGVTCTGTPGLDTISDPFSWSWLPGLGRDQDAWLPGELTTKPSASLTSSVPQKPTKVPGKAPKSTKKWVTKNARRPTTQPPGMPTTKHSRAPGTPTSLHPTARTSELPKRLTTEAPHRQTSHTTVRLTPRVPWEWTSEPVVSQSTQGPQEVTSEATTTENPQTSLEPSGENTEGSLESSQDPATTPTAGVPVPSGPFRVRLADGPNRCAGRLEVWHAGLWGTVCDDSWDIRDATVACWELGCGKVRPRVGKTHYGPGTGPIWLDDMGCKGSEMSLSDCPSGAWGKHNCDHEEDVVLTCTGYTGDDDYPSWTWDPTSGEDLTKGTTVAARPGHTLSWATTTNTEVPSPATQNLPDTDDQGGYESSWTWDTPSGRGLFKGTPTTTKPGSTVTTSTSKSPGHPFPAPRARAGSPRKPTPERRPLPTSATTSSPASSSSPEPSGSRQTSGSWPQLIPDSKQEGTSSSPKPSLLTPGLPSPATFALSTPNTSLLPTRSPELSGSPTPTSPEGLTSASSMLSEVSRLSPTSELTPGPDTTPAPEIIPESSDSSDLPMNTRTPTQPFTASHPTSIPQLNTTSYPTIAPQPTTNPQQPRSPHPATSPQPPTNTHPSSTPATPTESLPSSRKTELSSPTKPRLNSELTFEEAPSTDASQTQNLELFLASESGPSSPSPASNLDPLPTDAFKPPRSQTLHSASDHLTQGPTPNHNPDPFGPCVSPLPPVRVMACEPPALVELVGAVREVGDQLQRLTWVLEQDRQERQVLALGLAQLVEAAQGLGQLSETVKRLAEVAWPPSTPVPMTTTTEEEERPLRGDV", "length": 1371 }, "evidence": [ { "id": "45929673", "url": "http://www.informatics.jax.org/homology/45929673", "database": "MGI" }, { "id": "A1L4H1", "url": "https://omabrowser.org/oma/group/A1L4H1/", "database": "OMA" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 5, "go_terms": [ { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "A1L4H1", "url": "https://www.uniprot.org/uniprot/A1L4H1" } ], "pmid": "" }, { "name": "extracellular space", "id": "GO:0005615", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005615", "evidence": [ { "database": "UniProtKB", "id": "A1L4H1", "url": "https://www.uniprot.org/uniprot/A1L4H1" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "A1L4H1", "url": "https://www.uniprot.org/uniprot/A1L4H1" } ], "pmid": "" }, { "name": "extracellular matrix", "id": "GO:0031012", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031012", "evidence": [ { "database": "UniProtKB", "id": "A1L4H1", "url": "https://www.uniprot.org/uniprot/A1L4H1" } ], "pmid": "" }, { "name": "collagen-containing extracellular matrix", "id": "GO:0062023", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0062023", "evidence": [ { "database": "UniProtKB", "id": "A1L4H1", "url": "https://www.uniprot.org/uniprot/A1L4H1" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 6, "go_terms": [ { "name": "detection of bacterial lipoprotein", "id": "GO:0042494", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042494", "evidence": [ { "database": "UniProtKB", "id": "A1L4H1", "url": "https://www.uniprot.org/uniprot/A1L4H1" } ], "pmid": "" }, { "name": "defense response", "id": "GO:0006952", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006952", "evidence": [ { "database": "UniProtKB", "id": "A1L4H1", "url": "https://www.uniprot.org/uniprot/A1L4H1" } ], "pmid": "" }, { "name": "innate immune response", "id": "GO:0045087", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045087", "evidence": [ { "database": "UniProtKB", "id": "A1L4H1", "url": "https://www.uniprot.org/uniprot/A1L4H1" } ], "pmid": "" }, { "name": "defense response to Gram-negative bacterium", "id": "GO:0050829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050829", "evidence": [ { "database": "UniProtKB", "id": "A1L4H1", "url": "https://www.uniprot.org/uniprot/A1L4H1" } ], "pmid": "" }, { "name": "defense response to Gram-positive bacterium", "id": "GO:0050830", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050830", "evidence": [ { "database": "UniProtKB", "id": "A1L4H1", "url": "https://www.uniprot.org/uniprot/A1L4H1" } ], "pmid": "" }, { "name": "negative regulation of interleukin-8 production", "id": "GO:0032717", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032717", "evidence": [ { "database": "UniProtKB", "id": "A1L4H1", "url": "https://www.uniprot.org/uniprot/A1L4H1" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 4, "go_terms": [ { "name": "scavenger receptor activity", "id": "GO:0005044", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005044", "evidence": [ { "database": "UniProtKB", "id": "A1L4H1", "url": "https://www.uniprot.org/uniprot/A1L4H1" } ], "pmid": "" }, { "name": "laminin binding", "id": "GO:0043236", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043236", "evidence": [ { "database": "UniProtKB", "id": "A1L4H1", "url": "https://www.uniprot.org/uniprot/A1L4H1" } ], "pmid": "" }, { "name": "extracellular matrix binding", "id": "GO:0050840", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050840", "evidence": [ { "database": "UniProtKB", "id": "A1L4H1", "url": "https://www.uniprot.org/uniprot/A1L4H1" } ], "pmid": "" }, { "name": "fibronectin binding", "id": "GO:0001968", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001968", "evidence": [ { "database": "UniProtKB", "id": "A1L4H1", "url": "https://www.uniprot.org/uniprot/A1L4H1" } ], "pmid": "" } ] } ] }, "pro_annotation": [ { "name": "soluble scavenger receptor cysteine-rich domain-containing protein SSC5D O-glycosylated 1 (human)", "definition": "A soluble scavenger receptor cysteine-rich domain-containing protein SSC5D (human) that has been O-glycosylated at the residue equivalent to Ser-1466 of the amino acid sequence represented by UniProtKB:A1L4H1-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:A1L4H1-1, Ser-1466, MOD:00002~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000050601", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000050601" } ] }, { "name": "soluble scavenger receptor cysteine-rich domain-containing protein SSC5D O-glycosylated 2 (human)", "definition": "A soluble scavenger receptor cysteine-rich domain-containing protein SSC5D (human) that has been O-glycosylated at the residue equivalent to Ser-581 of the amino acid sequence represented by UniProtKB:A1L4H1-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:A1L4H1-1, Ser-581, MOD:00002~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000050602", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000050602" } ] }, { "name": "soluble scavenger receptor cysteine-rich domain-containing protein SSC5D O-glycosylated 3 (human)", "definition": "A soluble scavenger receptor cysteine-rich domain-containing protein SSC5D (human) that has been O-glycosylated at the residue equivalent to Ser-758 of the amino acid sequence represented by UniProtKB:A1L4H1-1, in which the glycan composition is represented by GlyTouCan:G53434XO. Example: UniProtKB:A1L4H1-1, Ser-758, MOD:00002~GNO:G53434XO. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000050603", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000050603" } ] }, { "name": "soluble scavenger receptor cysteine-rich domain-containing protein SSC5D O-glycosylated 4 (human)", "definition": "A soluble scavenger receptor cysteine-rich domain-containing protein SSC5D (human) that has been O-glycosylated at the residue equivalent to Ser-760 of the amino acid sequence represented by UniProtKB:A1L4H1-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:A1L4H1-1, Ser-760, MOD:00002~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000050604", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000050604" } ] }, { "name": "soluble scavenger receptor cysteine-rich domain-containing protein SSC5D O-glycosylated 5 (human)", "definition": "A soluble scavenger receptor cysteine-rich domain-containing protein SSC5D (human) that has been O-glycosylated at the residue equivalent to Thr-1047 of the amino acid sequence represented by UniProtKB:A1L4H1-1, in which the glycan composition is represented by GlyTouCan:G57317CE. Example: UniProtKB:A1L4H1-1, Thr-1047, MOD:00005~GNO:G57317CE. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000050605", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000050605" } ] }, { "name": "soluble scavenger receptor cysteine-rich domain-containing protein SSC5D O-glycosylated 6 (human)", "definition": "A soluble scavenger receptor cysteine-rich domain-containing protein SSC5D (human) that has been O-glycosylated at the residue equivalent to Thr-1047 of the amino acid sequence represented by UniProtKB:A1L4H1-1, in which the glycan composition is represented by GlyTouCan:G73004SD. Example: UniProtKB:A1L4H1-1, Thr-1047, MOD:00005~GNO:G73004SD. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000050606", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000050606" } ] }, { "name": "soluble scavenger receptor cysteine-rich domain-containing protein SSC5D O-glycosylated 7 (human)", "definition": "A soluble scavenger receptor cysteine-rich domain-containing protein SSC5D (human) that has been O-glycosylated at the residue equivalent to Thr-1445 of the amino acid sequence represented by UniProtKB:A1L4H1-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:A1L4H1-1, Thr-1445, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000050607", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000050607" } ] }, { "name": "soluble scavenger receptor cysteine-rich domain-containing protein SSC5D O-glycosylated 8 (human)", "definition": "A soluble scavenger receptor cysteine-rich domain-containing protein SSC5D (human) that has been O-glycosylated at the residue equivalent to Thr-1458 of the amino acid sequence represented by UniProtKB:A1L4H1-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:A1L4H1-1, Thr-1458, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000050608", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000050608" } ] }, { "name": "soluble scavenger receptor cysteine-rich domain-containing protein SSC5D O-glycosylated 9 (human)", "definition": "A soluble scavenger receptor cysteine-rich domain-containing protein SSC5D (human) that has been O-glycosylated at the residue equivalent to Thr-1462 of the amino acid sequence represented by UniProtKB:A1L4H1-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:A1L4H1-1, Thr-1462, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000050609", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000050609" } ] }, { "name": "soluble scavenger receptor cysteine-rich domain-containing protein SSC5D O-glycosylated 10 (human)", "definition": "A soluble scavenger receptor cysteine-rich domain-containing protein SSC5D (human) that has been O-glycosylated at the residue equivalent to Thr-1462 of the amino acid sequence represented by UniProtKB:A1L4H1-1, in which the glycan composition is represented by GlyTouCan:G58001LT. Example: UniProtKB:A1L4H1-1, Thr-1462, MOD:00005~GNO:G58001LT. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000050610", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000050610" } ] }, { "name": "soluble scavenger receptor cysteine-rich domain-containing protein SSC5D O-glycosylated 11 (human)", "definition": "A soluble scavenger receptor cysteine-rich domain-containing protein SSC5D (human) that has been O-glycosylated at the residue equivalent to Thr-1558 of the amino acid sequence represented by UniProtKB:A1L4H1-1, in which the glycan composition is represented by GlyTouCan:G29063QY. Example: UniProtKB:A1L4H1-1, Thr-1558, MOD:00005~GNO:G29063QY. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000050611", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000050611" } ] }, { "name": "soluble scavenger receptor cysteine-rich domain-containing protein SSC5D O-glycosylated 12 (human)", "definition": "A soluble scavenger receptor cysteine-rich domain-containing protein SSC5D (human) that has been O-glycosylated at the residue equivalent to Thr-1558 of the amino acid sequence represented by UniProtKB:A1L4H1-1, in which the glycan composition is represented by GlyTouCan:G53434XO. Example: UniProtKB:A1L4H1-1, Thr-1558, MOD:00005~GNO:G53434XO. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000050612", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000050612" } ] }, { "name": "soluble scavenger receptor cysteine-rich domain-containing protein SSC5D O-glycosylated 13 (human)", "definition": "A soluble scavenger receptor cysteine-rich domain-containing protein SSC5D (human) that has been O-glycosylated at the residue equivalent to Thr-1558 of the amino acid sequence represented by UniProtKB:A1L4H1-1, in which the glycan composition is represented by GlyTouCan:G73004SD. Example: UniProtKB:A1L4H1-1, Thr-1558, MOD:00005~GNO:G73004SD. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000050613", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000050613" } ] }, { "name": "soluble scavenger receptor cysteine-rich domain-containing protein SSC5D O-glycosylated 14 (human)", "definition": "A soluble scavenger receptor cysteine-rich domain-containing protein SSC5D (human) that has been O-glycosylated at the residue equivalent to Thr-157 of the amino acid sequence represented by UniProtKB:A1L4H1-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:A1L4H1-1, Thr-157, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000050614", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000050614" } ] }, { "name": "soluble scavenger receptor cysteine-rich domain-containing protein SSC5D O-glycosylated 15 (human)", "definition": "A soluble scavenger receptor cysteine-rich domain-containing protein SSC5D (human) that has been O-glycosylated at the residue equivalent to Thr-453 of the amino acid sequence represented by UniProtKB:A1L4H1-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:A1L4H1-1, Thr-453, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000050615", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000050615" } ] }, { "name": "soluble scavenger receptor cysteine-rich domain-containing protein SSC5D O-glycosylated 16 (human)", "definition": "A soluble scavenger receptor cysteine-rich domain-containing protein SSC5D (human) that has been O-glycosylated at the residue equivalent to Thr-764 of the amino acid sequence represented by UniProtKB:A1L4H1-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:A1L4H1-1, Thr-764, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000050616", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000050616" } ] }, { "name": "soluble scavenger receptor cysteine-rich domain-containing protein SSC5D O-glycosylated 17 (human)", "definition": "A soluble scavenger receptor cysteine-rich domain-containing protein SSC5D (human) that has been O-glycosylated at the residue equivalent to Thr-884 of the amino acid sequence represented by UniProtKB:A1L4H1-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:A1L4H1-1, Thr-884, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000050617", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000050617" } ] }, { "name": "soluble scavenger receptor cysteine-rich domain-containing protein SSC5D O-glycosylated 18 (human)", "definition": "A soluble scavenger receptor cysteine-rich domain-containing protein SSC5D (human) that has been O-glycosylated at the residue equivalent to Thr-939 of the amino acid sequence represented by UniProtKB:A1L4H1-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:A1L4H1-1, Thr-939, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000050618", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000050618" } ] } ], "site_annotation": [ { "start_pos": 1419, "end_pos": 1421, "annotation": "n_glycosylation_sequon" }, { "start_pos": 168, "end_pos": 170, "annotation": "n_glycosylation_sequon" }, { "start_pos": 376, "end_pos": 378, "annotation": "n_glycosylation_sequon" }, { "start_pos": 420, "end_pos": 422, "annotation": "n_glycosylation_sequon" }, { "start_pos": 421, "end_pos": 423, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [ 168, 376, 420 ], "o_linked_sites": [ 157, 453, 581, 640, 649, 692, 693, 694, 696, 697, 699, 701, 758, 760, 764, 884, 939, 1047, 1445, 1458, 1462, 1466, 1558 ], "snv_sites": [ 130, 157, 168, 172, 288, 378, 420, 422, 558, 581, 607, 640, 649, 693, 694, 699, 708, 758, 760, 884, 939, 1000, 1025, 1169, 1290, 1445, 1458, 1558 ], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 1419, "end_pos": 1421 }, { "start_pos": 168, "end_pos": 170 }, { "start_pos": 376, "end_pos": 378 }, { "start_pos": 420, "end_pos": 422 }, { "start_pos": 421, "end_pos": 423 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 30 }, { "field": "total_sites", "count": 26 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 3 }, { "field": "o_linked_glycans", "count": 8 }, { "field": "o_linked_glycan_sites", "count": 23 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 27 }, { "field": "total_sites", "count": 23 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 8 }, { "field": "o_linked_glycan_sites", "count": 23 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 3 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 35 }, { "field": "total_sites", "count": 28 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 32 }, { "field": "total_sites", "count": 25 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 39 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }