{ "uniprot_canonical_ac": "A1L3X0-1", "uniprot_ac": "A1L3X0", "uniprot_id": "ELOV7_HUMAN", "mass": { "chemical_mass": 33356.0, "monoisotopic_mass": 33356.0 }, "refseq": { "ac": "NP_001098028", "name": "very long chain fatty acid elongase 7 isoform 1", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001098028" }, "gene_names": [ { "name": "ELOVL7", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A1L3X0", "id": "A1L3X0" }, { "name": "ELOVL7", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001098028", "id": "NP_001098028" } ], "protein_names": [ { "name": "Very long chain fatty acid elongase 7", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "A1L3X0" }, { "name": "2.3.1.199", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "A1L3X0" }, { "name": "3-keto acyl-CoA synthase ELOVL7", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "A1L3X0" }, { "name": "ELOVL FA elongase 7", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "A1L3X0" }, { "name": "ELOVL fatty acid elongase 7", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "A1L3X0" }, { "name": "Elongation of very long chain fatty acids protein 7", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "A1L3X0" }, { "name": "Very long chain 3-ketoacyl-CoA synthase 7", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "A1L3X0" }, { "name": "Very long chain 3-oxoacyl-CoA synthase 7", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "A1L3X0" }, { "name": "elongation of very long chain fatty acids protein 7; 3-keto acyl-CoA synthase ELOVL7; ELOVL FA elongase 7; very long chain 3-oxoacyl-CoA synthase 7; ELOVL family member 7, elongation of long chain fatty acids; very long chain fatty acid elongase 7; very long chain 3-ketoacyl-CoA synthase 7", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001098028", "id": "NP_001098028" }, { "name": "very long chain fatty acid elongase 7 isoform 1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001098028", "id": "NP_001098028" } ], "function": [ { "annotation": "Catalyzes the first and rate-limiting reaction of the four reactions that constitute the long-chain fatty acids elongation cycle. This endoplasmic reticulum-bound enzymatic process allows the addition of 2 carbons to the chain of long- and very long-chain fatty acids (VLCFAs) per cycle. Condensing enzyme with higher activity toward C18 acyl-CoAs, especially C18:3(n-3) acyl-CoAs and C18:3(n-6)-CoAs. Also active toward C20:4-, C18:0-, C18:1-, C18:2- and C16:0-CoAs, and weakly toward C20:0-CoA. Little or no activity toward C22:0-, C24:0-, or C26:0-CoAs. May participate in the production of saturated and polyunsaturated VLCFAs of different chain lengths that are involved in multiple biological processes as precursors of membrane lipids and lipid mediators.", "evidence": [ { "database": "UniProtKB", "id": "A1L3X0", "url": "https://www.uniprot.org/uniprot/A1L3X0#function" }, { "database": "PubMed", "id": "20937905", "url": "https://glygen.org/publication/PubMed/20937905" }, { "database": "PubMed", "id": "21959040", "url": "https://glygen.org/publication/PubMed/21959040" }, { "database": "UniProtKB", "id": "MF_03207", "url": "https://www.uniprot.org/uniprot/MF_03207#function" }, { "database": "PubMed", "id": "19826053", "url": "https://glygen.org/publication/PubMed/19826053" }, { "database": "PubMed", "id": "34117479", "url": "https://glygen.org/publication/PubMed/34117479" } ] }, { "annotation": "Data show that ELOVL7, SOCS3, ACSL4 and CLU were upregulated while PRKAR1A and ABCG1 were downregulated in the phlegm-dampness group.", "evidence": [ { "database": "RefSeq", "id": "NP_001098028", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001098028" }, { "database": "PubMed", "id": "27928700", "url": "https://glygen.org/publication/PubMed/27928700" } ] }, { "annotation": "ELOVL fatty acid elongase 7 (ELOVL7), upregulated by Mdr2-knockout, predicts advanced liver fibrosis in patients with chronic hepatitis B.", "evidence": [ { "database": "RefSeq", "id": "NP_001098028", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001098028" }, { "database": "PubMed", "id": "36930494", "url": "https://glygen.org/publication/PubMed/36930494" } ] }, { "annotation": "ELOVL7 knockdown or mTOR inhibition impairs HCMV-induced fatty acid elongation.", "evidence": [ { "database": "RefSeq", "id": "NP_001098028", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001098028" }, { "database": "PubMed", "id": "25732827", "url": "https://glygen.org/publication/PubMed/25732827" } ] }, { "annotation": "Investigating ELOVL7 coding variants in multiple system atrophy.", "evidence": [ { "database": "RefSeq", "id": "NP_001098028", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001098028" }, { "database": "PubMed", "id": "33600908", "url": "https://glygen.org/publication/PubMed/33600908" } ] }, { "annotation": "Overexpression of ELOVL7 is associated with prostate cancer growth through saturated long-chain fatty acid metabolism.", "evidence": [ { "database": "RefSeq", "id": "NP_001098028", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001098028" }, { "database": "PubMed", "id": "19826053", "url": "https://glygen.org/publication/PubMed/19826053" } ] }, { "annotation": "Progression of the VLCFA cycle enhances ELOVL7 activity.", "evidence": [ { "database": "RefSeq", "id": "NP_001098028", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001098028" }, { "database": "PubMed", "id": "21959040", "url": "https://glygen.org/publication/PubMed/21959040" } ] }, { "annotation": "The structural basis of fatty acid elongation by the ELOVL elongases.", "evidence": [ { "database": "RefSeq", "id": "NP_001098028", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001098028" }, { "database": "PubMed", "id": "34117479", "url": "https://glygen.org/publication/PubMed/34117479" } ] } ], "disease": [], "snv": [], "mutagenesis": [ { "start_pos": 150, "end_pos": 150, "sequence_org": "H", "sequence_mut": "A", "comment": "Loss of activity alone or when associated with A-151.", "evidence": [ { "database": "UniProtKB", "id": "A1L3X0", "url": "https://www.uniprot.org/uniprot/A1L3X0" }, { "database": "PubMed", "id": "21959040", "url": "https://glygen.org/publication/PubMed/21959040" }, { "database": "PubMed", "id": "34117479", "url": "https://glygen.org/publication/PubMed/34117479" } ] }, { "start_pos": 151, "end_pos": 151, "sequence_org": "H", "sequence_mut": "A", "comment": "Loss of activity; when associated with A-150.", "evidence": [ { "database": "UniProtKB", "id": "A1L3X0", "url": "https://www.uniprot.org/uniprot/A1L3X0" }, { "database": "PubMed", "id": "21959040", "url": "https://glygen.org/publication/PubMed/21959040" } ] } ], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "84.83", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000164181", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000164181" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "78.72", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000164181", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000164181" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "71.97", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000164181", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000164181" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "77.54", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000164181", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000164181" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "85.72", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000164181", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000164181" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "75.39", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000164181", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000164181" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "81.99", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000164181", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000164181" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "59.46", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000164181", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000164181" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "80.7", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000164181", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000164181" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "77.48", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000164181", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000164181" } ] } ], "expression_disease": [ { "significant": "Yes", "trend": "up", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "A1L3X0", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A1L3X0" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "A1L3X0", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A1L3X0" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "A1L3X0", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A1L3X0" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "A1L3X0", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A1L3X0" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "A1L3X0", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A1L3X0" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "A1L3X0", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A1L3X0" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "A1L3X0", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A1L3X0" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "A1L3X0", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A1L3X0" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "A1L3X0", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A1L3X0" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "A1L3X0", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A1L3X0" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "A1L3X0", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A1L3X0" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "A1L3X0", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A1L3X0" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "A1L3X0", "url": "https://www.uniprot.org/uniprot/A1L3X0" } ], "common_name": "Human" } ], "gene": [ { "name": "ELOVL7", "url": "https://www.uniprot.org/uniprot/A1L3X0", "locus": { "chromosome": "5", "start_pos": 60751791, "end_pos": 60844274, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000164181", "url": "https://www.ensembl.org/id/ENSG00000164181" } ] } } ], "crossref": [ { "id": "ENSG00000164181", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000164181", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "2.3.1.199", "url": "https://www.brenda-enzymes.org/enzyme.php?ecno=2.3.1.199&UniProtAcc=A1L3X0", "database": "BRENDA", "categories": [ "Enzyme and Pathway" ] }, { "id": "CHEMBL5169094", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL5169094", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "ELOVL7", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=ELOVL7", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "79993", "url": "https://www.ncbi.nlm.nih.gov/gene/79993", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "26292", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=26292", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "A1L3X0", "url": "https://www.ebi.ac.uk/intact/interactors/id:A1L3X0*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR002076", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002076", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR030457", "url": "https://www.ebi.ac.uk/interpro/entry/IPR030457", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR033670", "url": "https://www.ebi.ac.uk/interpro/entry/IPR033670", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:79993", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:79993", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "614451", "url": "http://www.omim.org/entry/614451", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_A1L3X0", "url": "https://www.nextprot.org/entry/NX_A1L3X0", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "LPTLGMC", "url": "https://omabrowser.org/oma/group/LPTLGMC/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "168669at2759", "url": "http://www.orthodb.org/?query=168669at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR11157", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11157", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11157:SF118", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11157:SF118", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "6Y7F", "url": "https://www.rcsb.org/structure/6Y7F", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF01151", "url": "http://pfam.xfam.org/family/PF01151", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "A1L3X0", "url": "https://pharos.nih.gov/targets/A1L3X0", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_A1L3X0", "url": "http://purl.obolibrary.org/obo/PR_A1L3X0", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-75876", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75876", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001098028", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001098028", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "32727", "url": "https://www.rhea-db.org/rhea/32727", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "35315", "url": "https://www.rhea-db.org/rhea/35315", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "35319", "url": "https://www.rhea-db.org/rhea/35319", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "35327", "url": "https://www.rhea-db.org/rhea/35327", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "35379", "url": "https://www.rhea-db.org/rhea/35379", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "36475", "url": "https://www.rhea-db.org/rhea/36475", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "36503", "url": "https://www.rhea-db.org/rhea/36503", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "36511", "url": "https://www.rhea-db.org/rhea/36511", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "36523", "url": "https://www.rhea-db.org/rhea/36523", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "A1L3X0", "url": "https://www.uniprot.org/uniprot/A1L3X0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A1L3X0-1", "url": "https://www.uniprot.org/uniprot/A1L3X0-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "D6RBM2", "url": "https://www.uniprot.org/uniprot/D6RBM2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "D6RBM2-1", "url": "https://www.uniprot.org/uniprot/D6RBM2-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "D6RBR5", "url": "https://www.uniprot.org/uniprot/D6RBR5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "D6RBR5-1", "url": "https://www.uniprot.org/uniprot/D6RBR5-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "D6RE10", "url": "https://www.uniprot.org/uniprot/D6RE10", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "D6RE10-1", "url": "https://www.uniprot.org/uniprot/D6RE10-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "D6RHD0", "url": "https://www.uniprot.org/uniprot/D6RHD0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "D6RHD0-1", "url": "https://www.uniprot.org/uniprot/D6RHD0-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MAFSDLTSRTVHLYDNWIKDADPRVEDWLLMSSPLPQTILLGFYVYFVTSLGPKLMENRKPFELKKAMITYNFFIVLFSVYMCYEFVMSGWGIGYSFRCDIVDYSRSPTALRMARTCWLYYFSKFIELLDTIFFVLRKKNSQVTFLHVFHHTIMPWTWWFGVKFAAGGLGTFHALLNTAVHVVMYSYYGLSALGPAYQKYLWWKKYLTSLQLVQFVIVAIHISQFFFMEDCKYQFPVFACIIMSYSFMFLLLFLHFWYRAYTKGQRLPKTVKNGTCKNKDN", "length": 281, "header": "sp|A1L3X0-1|ELOV7_HUMAN Isoform 1 of Very long chain fatty acid elongase 7 OS=Homo sapiens OX=9606 GN=ELOVL7 PE=1 SV=1 CANONICAL=A1L3X0-1" }, "isoforms": [ { "isoform_ac": "A1L3X0-1", "url": "", "sequence": { "sequence": "MAFSDLTSRTVHLYDNWIKDADPRVEDWLLMSSPLPQTILLGFYVYFVTSLGPKLMENRKPFELKKAMITYNFFIVLFSVYMCYEFVMSGWGIGYSFRCDIVDYSRSPTALRMARTCWLYYFSKFIELLDTIFFVLRKKNSQVTFLHVFHHTIMPWTWWFGVKFAAGGLGTFHALLNTAVHVVMYSYYGLSALGPAYQKYLWWKKYLTSLQLVQFVIVAIHISQFFFMEDCKYQFPVFACIIMSYSFMFLLLFLHFWYRAYTKGQRLPKTVKNGTCKNKDN", "length": 281, "header": "sp|A1L3X0-1|ELOV7_HUMAN Isoform 1 of Very long chain fatty acid elongase 7 OS=Homo sapiens OX=9606 GN=ELOVL7 PE=1 SV=1 CANONICAL=A1L3X0-1" }, "locus": { "chromosome": "5", "start_pos": 60787397, "end_pos": 60754627, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000508821.6", "url": "https://www.ensembl.org/id/ENST00000508821.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000424123.1", "url": "https://www.ensembl.org/id/ENSP00000424123.1" } ] } }, { "isoform_ac": "D6RBM2-1", "url": "", "sequence": { "sequence": "MAFSDLTSRTVHLYDNWIKDADPRVEDWLLMSSPLPQTILLGFYVYFVTSLGPKLMENRKPFELKKAMITYNFFIVLFSVYMCYEFVMSGWGIGYSFRCDIVDYSRSPTALRMARTCWLYYFSKFIELLDTIFFVLRKKNSQVTFLHVFHHTIMPWTWWFGVKFA", "length": 165, "header": "tr|D6RBM2-1|ELOV7_HUMAN Computationally mapped isoform of Very long chain fatty acid elongase 7 OS=Homo sapiens OX=9606 GN=ELOVL7 PE=1 SV=1 CANONICAL=A1L3X0-1" }, "locus": { "chromosome": "5", "start_pos": 60787397, "end_pos": 60764231, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000511799.5", "url": "https://www.ensembl.org/id/ENST00000511799.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000424081.1", "url": "https://www.ensembl.org/id/ENSP00000424081.1" } ] } }, { "isoform_ac": "D6RBR5-1", "url": "", "sequence": { "sequence": "MAFSDLTSRTVHLYDNWIKDADPRVEDWLLMSSPLPQTILLGFYVYFVTSLGPKLMENRKPFELKKAMITYNFFIVLFSVYMCYEILF", "length": 88, "header": "tr|D6RBR5-1|D6RBR5_HUMAN Computationally mapped isoform of Elongation of very long chain fatty acids protein OS=Homo sapiens OX=9606 GN=ELOVL7 PE=1 SV=1 CANONICAL=A1L3X0-1" }, "locus": { "chromosome": "5", "start_pos": 60787397, "end_pos": 60768682, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000514809.1", "url": "https://www.ensembl.org/id/ENST00000514809.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000422602.1", "url": "https://www.ensembl.org/id/ENSP00000422602.1" } ] } }, { "isoform_ac": "D6RE10-1", "url": "", "sequence": { "sequence": "MAFSDLTSRTVHLYDNWIKDADPRVEDWLLMSSPLPQTILLGFYVYFVTSLGPKLMENRKPFELKKAMITL", "length": 71, "header": "tr|D6RE10-1|ELOV7_HUMAN Computationally mapped isoform of Very long chain fatty acid elongase 7 OS=Homo sapiens OX=9606 GN=ELOVL7 PE=1 SV=1 CANONICAL=A1L3X0-1" }, "locus": { "chromosome": "5", "start_pos": 60787397, "end_pos": 60767900, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000504455.5", "url": "https://www.ensembl.org/id/ENST00000504455.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000425127.1", "url": "https://www.ensembl.org/id/ENSP00000425127.1" } ] } }, { "isoform_ac": "D6RHD0-1", "url": "", "sequence": { "sequence": "MEKPINILYPRVEDWLLMSSPLPQTILLGFYVYFVTSLGPKLMENRKPFELKKAMITYNFFIVLFSVYMCYEFVMSGWGIGYSFRCDIVDYSRSPTALRMARTCWLYYFSKFIELLDTIFFVLRKKNSQVTFLHVFHHTIMPWTWWFGVKFAAGGLGTFHALLNTAVHVVMYSYYGLSALGPAYQKYLWWKKYLTSLQLVQFVIVAIHISQFFFMEDCKYQFPVFACIIMSYSFMFLLLFLHFWYRAYTKGQRLPKTVKNGTCKNKDN", "length": 268, "header": "tr|D6RHD0-1|ELOV7_HUMAN Computationally mapped isoform of Very long chain fatty acid elongase 7 OS=Homo sapiens OX=9606 GN=ELOVL7 PE=1 SV=1 CANONICAL=A1L3X0-1" }, "locus": { "chromosome": "5", "start_pos": 60784118, "end_pos": 60754627, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000505959.5", "url": "https://www.ensembl.org/id/ENST00000505959.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000421043.1", "url": "https://www.ensembl.org/id/ENSP00000421043.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme" ], "publication": [ { "title": "Identification and molecular characterization of acyl-CoA synthetase in human erythrocytes and erythroid precursors.", "journal": "The Biochemical journal", "date": "1999", "authors": "Malhotra KT, Malhotra K, Lubin BH, Kuypers FA", "evidence": [ { "database": "Reactome", "id": "R-HSA-75876", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75876" } ], "reference": [ { "type": "PubMed", "id": "10548543", "url": "https://glygen.org/publication/PubMed/10548543" } ] }, { "title": "Very long-chain acyl-CoA synthetases. Human `bubblegum` represents a new family of proteins capable of activating very long-chain fatty acids.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Steinberg SJ, Morgenthaler J, Heinzer AK, Smith KD, Watkins PA", "evidence": [ { "database": "Reactome", "id": "R-HSA-75876", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75876" } ], "reference": [ { "type": "PubMed", "id": "10954726", "url": "https://glygen.org/publication/PubMed/10954726" } ] }, { "title": "FACL4, encoding fatty acid-CoA ligase 4, is mutated in nonspecific X-linked mental retardation.", "journal": "Nature genetics", "date": "2002", "authors": "Meloni I, Muscettola M, Raynaud M, Longo I, Bruttini M, Moizard MP, Gomot M, Chelly J, des Portes V, Fryns JP, Ropers HH, Magi B, Bellan C, Volpi N, Yntema HG, Lewis SE, Schaffer JE, Renieri A", "evidence": [ { "database": "Reactome", "id": "R-HSA-75876", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75876" } ], "reference": [ { "type": "PubMed", "id": "11889465", "url": "https://glygen.org/publication/PubMed/11889465" } ] }, { "title": "Identification and expression of mammalian long-chain PUFA elongation enzymes.", "journal": "Lipids", "date": "2002", "authors": "Leonard AE, Kelder B, Bobik EG, Chuang LT, Lewis CJ, Kopchick JJ, Mukerji P, Huang YS", "evidence": [ { "database": "Reactome", "id": "R-HSA-75876", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75876" } ], "reference": [ { "type": "PubMed", "id": "12371743", "url": "https://glygen.org/publication/PubMed/12371743" } ] }, { "title": "Identification of two mammalian reductases involved in the two-carbon fatty acyl elongation cascade.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Moon YA, Horton JD", "evidence": [ { "database": "Reactome", "id": "R-HSA-75876", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75876" } ], "reference": [ { "type": "PubMed", "id": "12482854", "url": "https://glygen.org/publication/PubMed/12482854" } ] }, { "title": "A third MRX family (MRX68) is the result of mutation in the long chain fatty acid-CoA ligase 4 (FACL4) gene: proposal of a rapid enzymatic assay for screening mentally retarded patients.", "journal": "Journal of medical genetics", "date": "2003", "authors": "Longo I, Frints SG, Fryns JP, Meloni I, Pescucci C, Ariani F, Borghgraef M, Raynaud M, Marynen P, Schwartz C, Renieri A, Froyen G", "evidence": [ { "database": "Reactome", "id": "R-HSA-75876", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75876" } ], "reference": [ { "type": "PubMed", "id": "12525535", "url": "https://glygen.org/publication/PubMed/12525535" } ] }, { "title": "The acyl-CoA synthetase `bubblegum` (lipidosin): further characterization and role in neuronal fatty acid beta-oxidation..", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Pei Z, Oey NA, Zuidervaart MM, Jia Z, Li Y, Steinberg SJ, Smith KD, Watkins PA", "evidence": [ { "database": "Reactome", "id": "R-HSA-75876", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75876" } ], "reference": [ { "type": "PubMed", "id": "12975357", "url": "https://glygen.org/publication/PubMed/12975357" } ] }, { "title": "Mouse very long-chain Acyl-CoA synthetase 3/fatty acid transport protein 3 catalyzes fatty acid activation but not fatty acid transport in MA-10 cells.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Pei Z, Fraisl P, Berger J, Jia Z, Forss-Petter S, Watkins PA", "evidence": [ { "database": "Reactome", "id": "R-HSA-75876", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75876" } ], "reference": [ { "type": "PubMed", "id": "15469937", "url": "https://glygen.org/publication/PubMed/15469937" } ] }, { "title": "Dominant negative mechanism underlies autosomal dominant Stargardt-like macular dystrophy linked to mutations in ELOVL4.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Grayson C, Molday RS", "evidence": [ { "database": "Reactome", "id": "R-HSA-75876", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75876" } ], "reference": [ { "type": "PubMed", "id": "16036915", "url": "https://glygen.org/publication/PubMed/16036915" } ] }, { "title": "The second member of the human and murine bubblegum family is a testis- and brainstem-specific acyl-CoA synthetase.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Pei Z, Jia Z, Watkins PA", "evidence": [ { "database": "Reactome", "id": "R-HSA-75876", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75876" } ], "reference": [ { "type": "PubMed", "id": "16371355", "url": "https://glygen.org/publication/PubMed/16371355" } ] }, { "title": "Involvement of ACSL in local synthesis of neutral lipids in cytoplasmic lipid droplets in human hepatocyte HuH7.", "journal": "Journal of lipid research", "date": "2007", "authors": "Fujimoto Y, Itabe H, Kinoshita T, Homma KJ, Onoduka J, Mori M, Yamaguchi S, Makita M, Higashi Y, Yamashita A, Takano T", "evidence": [ { "database": "Reactome", "id": "R-HSA-75876", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75876" } ], "reference": [ { "type": "PubMed", "id": "17379924", "url": "https://glygen.org/publication/PubMed/17379924" } ] }, { "title": "Regulation of enterocyte apoptosis by acyl-CoA synthetase 5 splicing.", "journal": "Gastroenterology", "date": "2007", "authors": "Gassler N, Roth W, Funke B, Schneider A, Herzog F, Tischendorf JJ, Grund K, Penzel R, Bravo IG, Mariadason J, Ehemann V, Sykora J, Haas TL, Walczak H, Ganten T, Zentgraf H, Erb P, Alonso A, Autschbach F, Schirmacher P, Knuchel R, Kopitz J", "evidence": [ { "database": "Reactome", "id": "R-HSA-75876", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75876" } ], "reference": [ { "type": "PubMed", "id": "17681178", "url": "https://glygen.org/publication/PubMed/17681178" } ] }, { "title": "Evidence for 26 distinct acyl-coenzyme A synthetase genes in the human genome.", "journal": "Journal of lipid research", "date": "2007", "authors": "Watkins PA, Maiguel D, Jia Z, Pevsner J", "evidence": [ { "database": "Reactome", "id": "R-HSA-75876", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75876" } ], "reference": [ { "type": "PubMed", "id": "17762044", "url": "https://glygen.org/publication/PubMed/17762044" } ] }, { "title": "Long chain acyl-CoA synthetase 3-mediated phosphatidylcholine synthesis is required for assembly of very low density lipoproteins in human hepatoma Huh7 cells.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Yao H, Ye J", "evidence": [ { "database": "Reactome", "id": "R-HSA-75876", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75876" } ], "reference": [ { "type": "PubMed", "id": "18003621", "url": "https://glygen.org/publication/PubMed/18003621" } ] }, { "title": "Characterization of four mammalian 3-hydroxyacyl-CoA dehydratases involved in very long-chain fatty acid synthesis.", "journal": "FEBS letters", "date": "2008", "authors": "Ikeda M, Kanao Y, Yamanaka M, Sakuraba H, Mizutani Y, Igarashi Y, Kihara A", "evidence": [ { "database": "Reactome", "id": "R-HSA-75876", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75876" } ], "reference": [ { "type": "PubMed", "id": "18554506", "url": "https://glygen.org/publication/PubMed/18554506" } ] }, { "title": "Role of Stargardt-3 macular dystrophy protein (ELOVL4) in the biosynthesis of very long chain fatty acids.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2008", "authors": "Agbaga MP, Brush RS, Mandal MN, Henry K, Elliott MH, Anderson RE", "evidence": [ { "database": "Reactome", "id": "R-HSA-75876", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75876" } ], "reference": [ { "type": "PubMed", "id": "18728184", "url": "https://glygen.org/publication/PubMed/18728184" } ] }, { "title": "Identification and characterization of a selective radioligand for ELOVL6.", "journal": "Journal of biochemistry", "date": "2009", "authors": "Shimamura K, Takahashi H, Kitazawa H, Miyamoto Y, Nagumo A, Tang C, Dean D, Nagase T, Sato N, Tokita S", "evidence": [ { "database": "Reactome", "id": "R-HSA-75876", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75876" } ], "reference": [ { "type": "PubMed", "id": "19505953", "url": "https://glygen.org/publication/PubMed/19505953" } ] }, { "title": "Novel lipogenic enzyme ELOVL7 is involved in prostate cancer growth through saturated long-chain fatty acid metabolism.", "journal": "Cancer research", "date": "2009", "authors": "Tamura K, Makino A, Hullin-Matsuda F, Kobayashi T, Furihata M, Chung S, Ashida S, Miki T, Fujioka T, Shuin T, Nakamura Y, Nakagawa H", "evidence": [ { "database": "UniProtKB", "id": "A1L3X0", "url": "https://www.uniprot.org/uniprot/A1L3X0" }, { "database": "Reactome", "id": "R-HSA-75876", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75876" }, { "database": "RefSeq", "id": "NP_001098028", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001098028" } ], "reference": [ { "type": "PubMed", "id": "19826053", "url": "https://glygen.org/publication/PubMed/19826053" } ] }, { "title": "ELOVL1 production of C24 acyl-CoAs is linked to C24 sphingolipid synthesis.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2010", "authors": "Ohno Y, Suto S, Yamanaka M, Mizutani Y, Mitsutake S, Igarashi Y, Sassa T, Kihara A", "evidence": [ { "database": "UniProtKB", "id": "A1L3X0", "url": "https://www.uniprot.org/uniprot/A1L3X0" }, { "database": "Reactome", "id": "R-HSA-75876", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75876" } ], "reference": [ { "type": "PubMed", "id": "20937905", "url": "https://glygen.org/publication/PubMed/20937905" } ] }, { "title": "Biochemical characterization of the very long-chain fatty acid elongase ELOVL7.", "journal": "FEBS letters", "date": "2011", "authors": "Naganuma T, Sato Y, Sassa T, Ohno Y, Kihara A", "evidence": [ { "database": "UniProtKB", "id": "A1L3X0", "url": "https://www.uniprot.org/uniprot/A1L3X0" }, { "database": "Reactome", "id": "R-HSA-75876", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75876" }, { "database": "RefSeq", "id": "NP_001098028", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001098028" } ], "reference": [ { "type": "PubMed", "id": "21959040", "url": "https://glygen.org/publication/PubMed/21959040" } ] }, { "title": "Fatty acid elongase 7 catalyzes lipidome remodeling essential for human cytomegalovirus replication.", "journal": "Cell reports", "date": "2015", "authors": "Purdy JG, Shenk T, Rabinowitz JD", "evidence": [ { "database": "RefSeq", "id": "NP_001098028", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001098028" } ], "reference": [ { "type": "PubMed", "id": "25732827", "url": "https://glygen.org/publication/PubMed/25732827" } ] }, { "title": "Gene expression signatures for phlegm-dampness constitution of Chinese medicine.", "journal": "Science China. Life sciences", "date": "2017", "authors": "Li L, Feng J, Yao H, Xie L, Chen Y, Yang L, Hou S, Zhao S, Sun R, Wu Y, Bai T, Li Y, Yu R, Wang J, Wang Q", "evidence": [ { "database": "RefSeq", "id": "NP_001098028", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001098028" } ], "reference": [ { "type": "PubMed", "id": "27928700", "url": "https://glygen.org/publication/PubMed/27928700" } ] }, { "title": "Investigating ELOVL7 coding variants in multiple system atrophy.", "journal": "Neuroscience letters", "date": "2021", "authors": "Wernick AI, Walton RL, Soto-Beasley AI, Koga S, Ren Y, Heckman MG, Milanowski LM, Valentino RR, Kondru N, Uitti RJ, Cheshire WP, Wszolek ZK, Dickson DW, Ross OA", "evidence": [ { "database": "RefSeq", "id": "NP_001098028", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001098028" } ], "reference": [ { "type": "PubMed", "id": "33600908", "url": "https://glygen.org/publication/PubMed/33600908" } ] }, { "title": "The structural basis of fatty acid elongation by the ELOVL elongases.", "journal": "Nature structural & molecular biology", "date": "2021", "authors": "Nie L, Pascoa TC, Pike ACW, Bushell SR, Quigley A, Ruda GF, Chu A, Cole V, Speedman D, Moreira T, Shrestha L, Mukhopadhyay SMM, Burgess-Brown NA, Love JD, Brennan PE, Carpenter EP", "evidence": [ { "database": "UniProtKB", "id": "A1L3X0", "url": "https://www.uniprot.org/uniprot/A1L3X0" }, { "database": "RefSeq", "id": "NP_001098028", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001098028" } ], "reference": [ { "type": "PubMed", "id": "34117479", "url": "https://glygen.org/publication/PubMed/34117479" } ] }, { "title": "ELOVL fatty acid elongase 7 (ELOVL7), upregulated by Mdr2-knockout, predicts advanced liver fibrosis in patients with chronic hepatitis B.", "journal": "European review for medical and pharmacological sciences", "date": "2023-03", "authors": "Wang W-M, Yang Z-G, Liu C, Dong Q", "evidence": [ { "database": "RefSeq", "id": "NP_001098028", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001098028" } ], "reference": [ { "type": "PubMed", "id": "36930494", "url": "https://glygen.org/publication/PubMed/36930494" } ] }, { "title": "Male pseudohermaphroditism caused by mutations of testicular 17 beta-hydroxysteroid dehydrogenase 3.", "journal": "Nature genetics", "date": "1994", "authors": "Geissler WM, Davis DL, Wu L, Bradshaw KD, Patel S, Mendonca BB, Elliston KO, Wilson JD, Russell DW, Andersson S", "evidence": [ { "database": "Reactome", "id": "R-HSA-75876", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75876" } ], "reference": [ { "type": "PubMed", "id": "8075637", "url": "https://glygen.org/publication/PubMed/8075637" } ] } ], "pathway": [ { "id": "hsa:79993", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:79993", "resource": "KEGG Pathway" }, { "id": "R-HSA-75876", "name": "Synthesis of very long-chain fatty acyl-CoAs", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75876", "resource": "Reactome", "description": "Synthesis of very long-chain fatty acyl-CoAs" } ], "orthologs": [ { "uniprot_canonical_ac": "D4ADY9-1", "protein_name": "Very long chain fatty acid elongase 7", "gene_name": "Elovl7", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MAFSDLTSRTVRFYDNWIKDADPRVENWLLMSSPLPQTIILGLYVYFVTSLGPKLMENRKPFELKKAMITYNFFIVLFSVYMCYEFVMSGWGTGYSFRCDIVDYSQSPRAMRMVHTCWLYYFSKFIELFDTIFFVLRKKNSQVTFLHVFHHTIMPWTWWFGVKFAAGGLGTFHALLNTAVHVVMYFYYGLCAMGPAYQKYLWWKKHLTSLQLVQFVLVTVHIGQIFFMEDCNYQYPVFLYIIMSYGCIFLLLFLHFWYRAYTKGQRLPKTMENGNCKSKHH", "length": 281 }, "evidence": [ { "id": "45929761", "url": "http://www.informatics.jax.org/homology/45929761", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q95T98-1", "protein_name": "Elongation of very long chain fatty acids protein", "gene_name": "CG9798", "tax_id": 7227, "organism": "Drosophila melanogaster", "sequence": { "sequence": "MAIILQEAQKWYRDLMDNKSDPRVNDFFLLSSPLPTLCMCIFYAYFSKSLGPRLMAKRKPMELRSVLVVYNAIQTIFSAWIFYEYLMSGWWGHYSLKCQPVDYSTTGLAMRMVNICWWYYISKFTEFFDTLFFILRKKNEHVSTLHVIHHGCMPFSVWMGLKFAPGGHSTFFALLNSFVHIVMYFYYMIAAMGPKYQKYIWWKKYLTTFQMVQFVAIFTHQFQLLFRECDYPKGFMVWIGLHGVMFLFLFSDFYKAKYLNAARRRRQAVKANGYANGSASNGHSKHLGEGDALIANGCNTGACMPVMEDEYVKSKGQSNGAYKEGFFKEGVLSNNDAIFNPDSSSSSLHQRKVK", "length": 354 }, "evidence": [ { "id": "A1L3X0", "url": "https://omabrowser.org/oma/group/A1L3X0/", "database": "OMA" } ], "common_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9D2Y9-1", "protein_name": "Very long chain fatty acid elongase 7", "gene_name": "Elovl7", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MAFSDLTSRTVRFYDNWIKDADPRVEDYLLMSSPLPQTIILGLYVYFVTSLGPKLMENRKPFELKKAMITYNFFIVLFSVYMCYEFVMSGWGTGYSFRCDIVDYSQSPRAMRMVHTCWLYYFSKFIELLDTIFFVLRKKNSQVTFLHVFHHTIMPWTWWFGVKFAAGGLGTFHAFLNTAVHVVMYSYYGLCAMGPAYQKYLWWKKHLTSLQLVQFVLVTIHIGQIFFMEDCNYQYPVFLYIIMSYGCIFLLLFLHFWYRAYTKGQRLPKTLENGNCKSKRH", "length": 281 }, "evidence": [ { "id": "45929761", "url": "http://www.informatics.jax.org/homology/45929761", "database": "MGI" }, { "id": "A1L3X0", "url": "https://omabrowser.org/oma/group/A1L3X0/", "database": "OMA" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 3, "go_terms": [ { "name": "endoplasmic reticulum", "id": "GO:0005783", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005783", "evidence": [ { "database": "UniProtKB", "id": "A1L3X0", "url": "https://www.uniprot.org/uniprot/A1L3X0" } ], "pmid": "" }, { "name": "endoplasmic reticulum membrane", "id": "GO:0005789", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005789", "evidence": [ { "database": "UniProtKB", "id": "A1L3X0", "url": "https://www.uniprot.org/uniprot/A1L3X0" } ], "pmid": "" }, { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "A1L3X0", "url": "https://www.uniprot.org/uniprot/A1L3X0" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 8, "go_terms": [ { "name": "sphingolipid biosynthetic process", "id": "GO:0030148", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030148", "evidence": [ { "database": "UniProtKB", "id": "A1L3X0", "url": "https://www.uniprot.org/uniprot/A1L3X0" } ], "pmid": "" }, { "name": "long-chain fatty-acyl-CoA biosynthetic process", "id": "GO:0035338", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035338", "evidence": [ { "database": "UniProtKB", "id": "A1L3X0", "url": "https://www.uniprot.org/uniprot/A1L3X0" } ], "pmid": "" }, { "name": "unsaturated fatty acid biosynthetic process", "id": "GO:0006636", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006636", "evidence": [ { "database": "UniProtKB", "id": "A1L3X0", "url": "https://www.uniprot.org/uniprot/A1L3X0" } ], "pmid": "" }, { "name": "fatty acid elongation, monounsaturated fatty acid", "id": "GO:0034625", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034625", "evidence": [ { "database": "UniProtKB", "id": "A1L3X0", "url": "https://www.uniprot.org/uniprot/A1L3X0" } ], "pmid": "" }, { "name": "fatty acid elongation, polyunsaturated fatty acid", "id": "GO:0034626", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034626", "evidence": [ { "database": "UniProtKB", "id": "A1L3X0", "url": "https://www.uniprot.org/uniprot/A1L3X0" } ], "pmid": "" }, { "name": "fatty acid elongation, saturated fatty acid", "id": "GO:0019367", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019367", "evidence": [ { "database": "UniProtKB", "id": "A1L3X0", "url": "https://www.uniprot.org/uniprot/A1L3X0" } ], "pmid": "" }, { "name": "very long-chain fatty acid biosynthetic process", "id": "GO:0042761", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042761", "evidence": [ { "database": "UniProtKB", "id": "A1L3X0", "url": "https://www.uniprot.org/uniprot/A1L3X0" } ], "pmid": "" }, { "name": "fatty acid elongation", "id": "GO:0030497", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030497", "evidence": [ { "database": "UniProtKB", "id": "A1L3X0", "url": "https://www.uniprot.org/uniprot/A1L3X0" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "fatty acid elongase activity", "id": "GO:0009922", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009922", "evidence": [ { "database": "UniProtKB", "id": "A1L3X0", "url": "https://www.uniprot.org/uniprot/A1L3X0" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 273, "end_pos": 275, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "32727", "name": "", "equation": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "D4A612-1", "D4ADY9-1", "Q920L7-1", "Q920L6-1", "A0A1B0GWP1-1", "D3ZPX9-1", "D4ACH5-1", "A1L3X0-1", "Q9H5J4-1", "Q9GZR5-1", "Q9NYP7-1", "Q9HB03-1", "Q9NXB9-1", "Q9BW60-1", "Q920L5-1", "Q8BHI7-1", "O35949-1", "Q9EQC4-1", "Q9D2Y9-1", "Q9JLJ4-1", "Q9JLJ5-1", "P25358-1", "P39540-1", "P40319-1", "Q55BY4-1", "C7FZW5-1", "Q54TC9-1", "Q555E8-1", "Q86JM5-1", "Q7KWQ5-1", "Q54CJ4-1", "A8JNR0-1", "Q9VHX7-1", "A0A0B4KF65-1", "Q9VH58-1", "Q9VV87-1", "Q6NN18-1", "Q4V3H4-1", "A1ZBD2-1", "Q9VCY6-1", "Q5JZZ4-1", "Q9VH59-1", "Q9VCT3-1", "Q95T98-1", "Q9VCY5-1", "Q9VH57-1", "Q8SXD1-1", "Q8IMY2-1", "Q9VCY7-1", "Q9VCZ0-1", "Q9VH55-1" ], "evidence": [ { "id": "32727", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/32727" } ] }, { "id": "35315", "name": "", "equation": "H(+) + hexadecanoyl-CoA + malonyl-CoA = 3-oxooctadecanoyl-CoA + CO2 + CoA", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "D4ADY9-1", "Q920L6-1", "A1L3X0-1", "Q9H5J4-1", "Q9HB03-1", "Q920L5-1", "O35949-1", "Q9D2Y9-1", "P25358-1", "P40319-1", "Q9VV87-1" ], "evidence": [ { "id": "35315", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/35315" } ] }, { "id": "35319", "name": "", "equation": "H(+) + malonyl-CoA + octadecanoyl-CoA = 3-oxoeicosanoyl-CoA + CO2 + CoA", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "D4ADY9-1", "A1L3X0-1", "Q9HB03-1", "Q9BW60-1", "O35949-1", "Q9D2Y9-1", "P25358-1", "P40319-1" ], "evidence": [ { "id": "35319", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/35319" } ] }, { "id": "35327", "name": "", "equation": "eicosanoyl-CoA + H(+) + malonyl-CoA = 3-oxodocosanoyl-CoA + CO2 + CoA", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "D4ADY9-1", "A1L3X0-1", "Q9HB03-1", "Q9BW60-1", "O35949-1", "Q9D2Y9-1", "Q9JLJ5-1", "P25358-1", "P40319-1" ], "evidence": [ { "id": "35327", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/35327" } ] }, { "id": "35379", "name": "", "equation": "(6Z,9Z,12Z)-octadecatrienoyl-CoA + H(+) + malonyl-CoA = (8Z,11Z,14Z)-3-oxoeicosatrienoyl-CoA + CO2 + CoA", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "D4ADY9-1", "Q920L7-1", "A1L3X0-1", "Q9NYP7-1", "Q8BHI7-1", "Q9D2Y9-1" ], "evidence": [ { "id": "35379", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/35379" } ] }, { "id": "36475", "name": "", "equation": "(5Z,8Z,11Z,14Z)-eicosatetraenoyl-CoA + H(+) + malonyl-CoA = (7Z,10Z,13Z,16Z)-3-oxodocosatetraenoyl-CoA + CO2 + CoA", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "D4A612-1", "D4ADY9-1", "Q920L7-1", "A1L3X0-1", "Q9NYP7-1", "Q9NXB9-1", "Q8BHI7-1", "Q9D2Y9-1", "Q9JLJ4-1" ], "evidence": [ { "id": "36475", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/36475" } ] }, { "id": "36503", "name": "", "equation": "(9Z,12Z)-octadecadienoyl-CoA + H(+) + malonyl-CoA = (11Z,14Z)-3-oxoicosa-11,14-dienoyl-CoA + CO2 + CoA", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "D4ADY9-1", "Q920L7-1", "Q920L6-1", "A1L3X0-1", "Q9NYP7-1", "Q9H5J4-1", "Q9HB03-1", "Q920L5-1", "O35949-1", "Q8BHI7-1", "Q9D2Y9-1" ], "evidence": [ { "id": "36503", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/36503" } ] }, { "id": "36511", "name": "", "equation": "(9Z)-octadecenoyl-CoA + H(+) + malonyl-CoA = (11Z)-3-oxoicosenoyl-CoA + CO2 + CoA", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "D4ADY9-1", "Q920L7-1", "Q920L6-1", "A1L3X0-1", "Q9NYP7-1", "Q9H5J4-1", "Q9HB03-1", "Q920L5-1", "O35949-1", "Q8BHI7-1", "Q9D2Y9-1" ], "evidence": [ { "id": "36511", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/36511" } ] }, { "id": "36523", "name": "", "equation": "(9Z,12Z,15Z)-octadecatrienoyl-CoA + H(+) + malonyl-CoA = (11Z,14Z,17Z)-3-oxoeicosatrienoyl-CoA + CO2 + CoA", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "D4ADY9-1", "Q920L7-1", "Q920L6-1", "A1L3X0-1", "Q9NYP7-1", "Q9H5J4-1", "Q9HB03-1", "Q920L5-1", "O35949-1", "Q8BHI7-1", "Q9D2Y9-1" ], "evidence": [ { "id": "36523", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/36523" } ] }, { "id": "R-HSA-548814", "name": "ELOVL3,6,7 elongate PALM-CoA and Mal-CoA to 3OOD-CoA", "equation": "", "summary": "The ER membrane-bound elongation of very long chain fatty acids proteins 3, 6 and 7 (ELOVL3,6,7) catalyse the condensation of palmitoyl-CoA (PALM-CoA) with malonyl-CoA (Mal-CoA) to form 3-oxooctadecanoyl-CoA (3OOD-CoA) (Shimamura et al. 2009, Ohno et al. 2010, Naganuma et al. 2011).", "cellular_location": "cytosol, endoplasmic reticulum membrane", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "A1L3X0-1", "Q9H5J4-1", "Q9HB03-1" ], "evidence": [ { "id": "R-HSA-548814", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-548814" } ] }, { "id": "R-HSA-548815", "name": "ELOVL7 elongates ICS-CoA and Mal-CoA to 3ODC-CoA", "equation": "", "summary": "Elongation of very long chain fatty acids protein 7 (ELOVL7) catalyzes the reaction of arachidoyl-CoA (C20:0) and malonyl-CoA to form 3-oxobehenoyl-CoA, CO2, and CoASH. ELOVL7 is localized to the endoplasmic reticulum in transfected cells expressing the cloned cDNA (Tamura et al. 2009).", "cellular_location": "cytosol, endoplasmic reticulum membrane", "input_participant_list": [ "R-ALL-548794" ], "output_participant_list": [ "R-ALL-548829" ], "enzyme_list": [ "A1L3X0-1" ], "evidence": [ { "id": "R-HSA-548815", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-548815" } ] } ], "reaction_participants": [ { "participant_id": "R-ALL-548794", "participant_name": "ICS-CoA [cytosol]", "crossref": [ { "id": "57380", "database": "ChEBI", "url": "" }, { "id": "57380", "database": "ChEBI", "url": "" }, { "id": "57380", "database": "ChEBI", "url": "" }, { "id": "57380", "database": "ChEBI", "url": "" }, { "id": "57380", "database": "ChEBI", "url": "" } ] }, { "participant_id": "R-ALL-548829", "participant_name": "3ODC-CoA [cytosol]", "crossref": [ { "id": "71451", "database": "ChEBI", "url": "" }, { "id": "71451", "database": "ChEBI", "url": "" }, { "id": "71451", "database": "ChEBI", "url": "" }, { "id": "71451", "database": "ChEBI", "url": "" }, { "id": "71451", "database": "ChEBI", "url": "" } ] } ], "reaction_enzymes": [ { "uniprot_ac": "A0A0B4KF65", "gene_name": "BcDNA:GH22993", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "A0A0B4KF65", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0B4KF65" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "A0A0B4KF65", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0B4KF65" } ] } ] }, { "uniprot_ac": "A0A1B0GWP1", "gene_name": "Elovl1", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "A0A1B0GWP1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A1B0GWP1" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "A0A1B0GWP1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A1B0GWP1" } ] } ] }, { "uniprot_ac": "A1L3X0", "gene_name": "ELOVL7", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "A1L3X0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A1L3X0" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "A1L3X0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A1L3X0" } ] } ] }, { "uniprot_ac": "A1ZBD2", "gene_name": "Dmel\\CG17821", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "A1ZBD2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A1ZBD2" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "A1ZBD2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A1ZBD2" } ] } ] }, { "uniprot_ac": "A8JNR0", "gene_name": "Elo68beta", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "A8JNR0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A8JNR0" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "A8JNR0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A8JNR0" } ] } ] }, { "uniprot_ac": "C7FZW5", "gene_name": "", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "C7FZW5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/C7FZW5" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "C7FZW5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/C7FZW5" } ] } ] }, { "uniprot_ac": "D3ZPX9", "gene_name": "Elovl3", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "D3ZPX9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZPX9" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "D3ZPX9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZPX9" } ] } ] }, { "uniprot_ac": "D4A612", "gene_name": "Elovl2", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "D4A612", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D4A612" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "D4A612", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D4A612" } ] } ] }, { "uniprot_ac": "D4ACH5", "gene_name": "Elovl4", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "D4ACH5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D4ACH5" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "D4ACH5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D4ACH5" } ] } ] }, { "uniprot_ac": "D4ADY9", "gene_name": "Elovl7", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "D4ADY9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D4ADY9" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "D4ADY9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D4ADY9" } ] } ] }, { "uniprot_ac": "O35949", "gene_name": "Elovl3", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "O35949", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O35949" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "O35949", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O35949" } ] } ] }, { "uniprot_ac": "P25358", "gene_name": "ELO2", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "P25358", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P25358" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "P25358", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P25358" } ] } ] }, { "uniprot_ac": "P39540", "gene_name": "ELO1", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "P39540", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P39540" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "P39540", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P39540" } ] } ] }, { "uniprot_ac": "P40319", "gene_name": "ELO3", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "P40319", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P40319" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "P40319", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P40319" } ] } ] }, { "uniprot_ac": "Q4V3H4", "gene_name": "Dmel\\CG9459", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q4V3H4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q4V3H4" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q4V3H4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q4V3H4" } ] } ] }, { "uniprot_ac": "Q54CJ4", "gene_name": "eloA", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q54CJ4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54CJ4" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q54CJ4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54CJ4" } ] } ] }, { "uniprot_ac": "Q54TC9", "gene_name": "sre1", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q54TC9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54TC9" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q54TC9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54TC9" } ] } ] }, { "uniprot_ac": "Q555E8", "gene_name": "", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q555E8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q555E8" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q555E8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q555E8" } ] } ] }, { "uniprot_ac": "Q55BY4", "gene_name": "", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q55BY4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55BY4" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q55BY4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55BY4" } ] } ] }, { "uniprot_ac": "Q5JZZ4", "gene_name": "Elo68alpha", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q5JZZ4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5JZZ4" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q5JZZ4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5JZZ4" } ] } ] }, { "uniprot_ac": "Q6NN18", "gene_name": "CT42569", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q6NN18", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6NN18" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q6NN18", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6NN18" } ] } ] }, { "uniprot_ac": "Q7KWQ5", "gene_name": "", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q7KWQ5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7KWQ5" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q7KWQ5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7KWQ5" } ] } ] }, { "uniprot_ac": "Q86JM5", "gene_name": "", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q86JM5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q86JM5" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q86JM5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q86JM5" } ] } ] }, { "uniprot_ac": "Q8BHI7", "gene_name": "Elovl5", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q8BHI7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BHI7" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q8BHI7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BHI7" } ] } ] }, { "uniprot_ac": "Q8IMY2", "gene_name": "Dmel\\CG31141", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q8IMY2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8IMY2" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q8IMY2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8IMY2" } ] } ] }, { "uniprot_ac": "Q8SXD1", "gene_name": "CG12138", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q8SXD1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8SXD1" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q8SXD1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8SXD1" } ] } ] }, { "uniprot_ac": "Q920L5", "gene_name": "Elovl6", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q920L5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q920L5" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q920L5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q920L5" } ] } ] }, { "uniprot_ac": "Q920L6", "gene_name": "Elovl6", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q920L6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q920L6" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q920L6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q920L6" } ] } ] }, { "uniprot_ac": "Q920L7", "gene_name": "Elovl5", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q920L7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q920L7" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q920L7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q920L7" } ] } ] }, { "uniprot_ac": "Q95T98", "gene_name": "CG9798", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q95T98", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q95T98" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q95T98", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q95T98" } ] } ] }, { "uniprot_ac": "Q9BW60", "gene_name": "ELOVL1", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q9BW60", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BW60" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q9BW60", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BW60" } ] } ] }, { "uniprot_ac": "Q9D2Y9", "gene_name": "Elovl7", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q9D2Y9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9D2Y9" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q9D2Y9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9D2Y9" } ] } ] }, { "uniprot_ac": "Q9EQC4", "gene_name": "Elovl4", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q9EQC4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9EQC4" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q9EQC4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9EQC4" } ] } ] }, { "uniprot_ac": "Q9GZR5", "gene_name": "ELOVL4", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q9GZR5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9GZR5" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q9GZR5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9GZR5" } ] } ] }, { "uniprot_ac": "Q9H5J4", "gene_name": "ELOVL6", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q9H5J4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9H5J4" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q9H5J4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9H5J4" } ] } ] }, { "uniprot_ac": "Q9HB03", "gene_name": "ELOVL3", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q9HB03", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9HB03" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q9HB03", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9HB03" } ] } ] }, { "uniprot_ac": "Q9JLJ4", "gene_name": "Elovl2", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q9JLJ4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JLJ4" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q9JLJ4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JLJ4" } ] } ] }, { "uniprot_ac": "Q9JLJ5", "gene_name": "Elovl1", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q9JLJ5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JLJ5" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q9JLJ5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JLJ5" } ] } ] }, { "uniprot_ac": "Q9NXB9", "gene_name": "ELOVL2", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q9NXB9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NXB9" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q9NXB9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NXB9" } ] } ] }, { "uniprot_ac": "Q9NYP7", "gene_name": "ELOVL5", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q9NYP7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NYP7" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q9NYP7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NYP7" } ] } ] }, { "uniprot_ac": "Q9VCT3", "gene_name": "Dmel\\CG6660", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q9VCT3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VCT3" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q9VCT3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VCT3" } ] } ] }, { "uniprot_ac": "Q9VCY5", "gene_name": "CG13844", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q9VCY5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VCY5" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q9VCY5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VCY5" } ] } ] }, { "uniprot_ac": "Q9VCY6", "gene_name": "sit", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q9VCY6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VCY6" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q9VCY6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VCY6" } ] } ] }, { "uniprot_ac": "Q9VCY7", "gene_name": "bond", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q9VCY7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VCY7" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q9VCY7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VCY7" } ] } ] }, { "uniprot_ac": "Q9VCZ0", "gene_name": "Dmel\\CG5326", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q9VCZ0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VCZ0" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q9VCZ0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VCZ0" } ] } ] }, { "uniprot_ac": "Q9VH55", "gene_name": "CT26802", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q9VH55", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VH55" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q9VH55", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VH55" } ] } ] }, { "uniprot_ac": "Q9VH57", "gene_name": "Dmel\\CG16904", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q9VH57", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VH57" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q9VH57", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VH57" } ] } ] }, { "uniprot_ac": "Q9VH58", "gene_name": "eloF", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q9VH58", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VH58" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q9VH58", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VH58" } ] } ] }, { "uniprot_ac": "Q9VH59", "gene_name": "Dmel\\CG8534", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q9VH59", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VH59" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q9VH59", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VH59" } ] } ] }, { "uniprot_ac": "Q9VHX7", "gene_name": "Elovl7", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q9VHX7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VHX7" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q9VHX7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VHX7" } ] } ] }, { "uniprot_ac": "Q9VV87", "gene_name": "Baldspot", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q9VV87", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VV87" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q9VV87", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VV87" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 273, "end_pos": 275 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 26 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }