{ "uniprot_canonical_ac": "A1A4S6-1", "uniprot_ac": "A1A4S6", "uniprot_id": "RHG10_HUMAN", "mass": { "chemical_mass": 89375.0, "monoisotopic_mass": 89375.0 }, "refseq": { "ac": "NP_078881", "name": "rho GTPase-activating protein 10", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_078881" }, "gene_names": [ { "name": "ARHGAP10", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A1A4S6", "id": "A1A4S6" }, { "name": "ARHGAP10", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_078881", "id": "NP_078881" }, { "name": "GRAF2; PS-GAP; PSGAP", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_078881", "id": "NP_078881" }, { "name": "GRAF2", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/A1A4S6", "id": "A1A4S6" } ], "protein_names": [ { "name": "Rho GTPase-activating protein 10", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "A1A4S6" }, { "name": "GRAF2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "A1A4S6" }, { "name": "GTPase regulator associated with focal adhesion kinase 2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "A1A4S6" }, { "name": "Graf-related protein 2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "A1A4S6" }, { "name": "Rho-type GTPase-activating protein 10", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "A1A4S6" }, { "name": "graf-related protein 2; rho-type GTPase-activating protein 10; GTPase regulator associated with focal adhesion kinase 2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_078881", "id": "NP_078881" }, { "name": "rho GTPase-activating protein 10", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_078881", "id": "NP_078881" } ], "function": [ { "annotation": "ARHGAP10, which encodes Rho GTPase-activating protein 10, is a novel gene for schizophrenia risk. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_078881", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_078881" }, { "database": "PubMed", "id": "32699248", "url": "https://glygen.org/publication/PubMed/32699248" } ] }, { "annotation": "GRAF2, WDR44, and MICAL1 mediate Rab8/10/11-dependent export of E-cadherin, MMP14, and CFTR DeltaF508.", "evidence": [ { "database": "RefSeq", "id": "NP_078881", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_078881" }, { "database": "PubMed", "id": "32344433", "url": "https://glygen.org/publication/PubMed/32344433" } ] }, { "annotation": "GTPase-activating protein that catalyzes the conversion of active GTP-bound Rho GTPases to their inactive GDP-bound form, thus suppressing various Rho GTPase-mediated cellular processes (PubMed:11432776). Also converts Cdc42 to an inactive GDP-bound state (PubMed:11432776). Essential for PTKB2 regulation of cytoskeletal organization via Rho family GTPases. Inhibits PAK2 proteolytic fragment PAK-2p34 kinase activity and changes its localization from the nucleus to the perinuclear region. Stabilizes PAK-2p34 thereby increasing stimulation of cell death (By similarity). Associates with MICAL1 on the endosomal membrane to promote Rab8-Rab10-dependent tubule extension. After dissociation with MICAL1, recruits WDR44 which connects the endoplasmic reticulum (ER) with the endosomal tubule, thereby participating in the export of a subset of neosynthesized proteins (PubMed:32344433).", "evidence": [ { "database": "UniProtKB", "id": "A1A4S6", "url": "https://www.uniprot.org/uniprot/A1A4S6#function" }, { "database": "PubMed", "id": "11432776", "url": "https://glygen.org/publication/PubMed/11432776" }, { "database": "UniProtKB", "id": "Q6Y5D8", "url": "https://www.uniprot.org/uniprot/Q6Y5D8#function" }, { "database": "PubMed", "id": "32344433", "url": "https://glygen.org/publication/PubMed/32344433" } ] }, { "annotation": "MiR3373p inhibits gastric tumor metastasis by targeting ARHGAP10.", "evidence": [ { "database": "RefSeq", "id": "NP_078881", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_078881" }, { "database": "PubMed", "id": "31789419", "url": "https://glygen.org/publication/PubMed/31789419" } ] }, { "annotation": "Observational study of gene-disease association. (HuGE Navigator)", "evidence": [ { "database": "RefSeq", "id": "NP_078881", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_078881" }, { "database": "PubMed", "id": "19911011", "url": "https://glygen.org/publication/PubMed/19911011" } ] }, { "annotation": "PS-GAP is a novel regulator of caspase-activated PAK-2", "evidence": [ { "database": "RefSeq", "id": "NP_078881", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_078881" }, { "database": "PubMed", "id": "15471851", "url": "https://glygen.org/publication/PubMed/15471851" } ] }, { "annotation": "These findings suggest that CXCL12/CXCR4 promotes ovarian cancer cell invasion by suppressing ARHGAP10 expression, which is mediated by VEGF/VEGFR2 signaling.", "evidence": [ { "database": "RefSeq", "id": "NP_078881", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_078881" }, { "database": "PubMed", "id": "31445707", "url": "https://glygen.org/publication/PubMed/31445707" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "72.22", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000071205", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000071205" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "78.17", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000071205", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000071205" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "74.95", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000071205", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000071205" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "49.96", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000071205", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000071205" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "97.61", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000071205", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000071205" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "81.88", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000071205", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000071205" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "47.76", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000071205", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000071205" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "88.04", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000071205", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000071205" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "84.39", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000071205", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000071205" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "56.26", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000071205", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000071205" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "79.25", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000071205", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000071205" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "88.22", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000071205", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000071205" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "85.37", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000071205", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000071205" } ] } ], "expression_disease": [ { "significant": "Yes", "trend": "down", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "A1A4S6", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A1A4S6" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "A1A4S6", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A1A4S6" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "A1A4S6", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A1A4S6" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "A1A4S6", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A1A4S6" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "A1A4S6", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A1A4S6" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "A1A4S6", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A1A4S6" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "A1A4S6", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A1A4S6" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "A1A4S6", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A1A4S6" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "A1A4S6", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A1A4S6" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "A1A4S6", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A1A4S6" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "A1A4S6", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A1A4S6" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "A1A4S6", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A1A4S6" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "A1A4S6", "url": "https://www.uniprot.org/uniprot/A1A4S6" } ], "common_name": "Human" } ], "gene": [ { "name": "ARHGAP10", "url": "https://www.uniprot.org/uniprot/A1A4S6", "locus": { "chromosome": "4", "start_pos": 148072776, "end_pos": 147732063, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000071205", "url": "https://www.ensembl.org/id/ENSG00000071205" } ] } } ], "crossref": [ { "id": "ENSG00000071205", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000071205", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd01249", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd01249", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd04374", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd04374", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd07635", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd07635", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd12065", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd12065", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "ARHGAP10", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=ARHGAP10", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "79658", "url": "https://www.ncbi.nlm.nih.gov/gene/79658", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "26099", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=26099", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "A1A4S6", "url": "https://www.ebi.ac.uk/intact/interactors/id:A1A4S6*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR000198", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000198", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR001452", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001452", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR001849", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001849", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR004148", "url": "https://www.ebi.ac.uk/interpro/entry/IPR004148", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR008936", "url": "https://www.ebi.ac.uk/interpro/entry/IPR008936", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR011993", "url": "https://www.ebi.ac.uk/interpro/entry/IPR011993", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR027267", "url": "https://www.ebi.ac.uk/interpro/entry/IPR027267", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR035485", "url": "https://www.ebi.ac.uk/interpro/entry/IPR035485", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036028", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036028", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR047225", "url": "https://www.ebi.ac.uk/interpro/entry/IPR047225", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR047234", "url": "https://www.ebi.ac.uk/interpro/entry/IPR047234", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:79658", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:79658", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "609746", "url": "http://www.omim.org/entry/609746", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_A1A4S6", "url": "https://www.nextprot.org/entry/NX_A1A4S6", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "MRSPMVQ", "url": "https://omabrowser.org/oma/group/MRSPMVQ/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5395569at2759", "url": "http://www.orthodb.org/?query=5395569at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR12552", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12552", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR12552:SF5", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12552:SF5", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "2MIO", "url": "https://www.rcsb.org/structure/2MIO", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00169", "url": "http://pfam.xfam.org/family/PF00169", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF00620", "url": "http://pfam.xfam.org/family/PF00620", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF14604", "url": "http://pfam.xfam.org/family/PF14604", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF16746", "url": "http://pfam.xfam.org/family/PF16746", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "A1A4S6", "url": "https://pharos.nih.gov/targets/A1A4S6", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_A1A4S6", "url": "http://purl.obolibrary.org/obo/PR_A1A4S6", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-211728", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211728", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9013148", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013148", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_078881", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_078881", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A1A4S6", "url": "https://www.uniprot.org/uniprot/A1A4S6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A1A4S6-1", "url": "https://www.uniprot.org/uniprot/A1A4S6-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0Y8W5", "url": "https://www.uniprot.org/uniprot/H0Y8W5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0Y8W5-1", "url": "https://www.uniprot.org/uniprot/H0Y8W5-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MGLQPLEFSDCYLDSPWFRERIRAHEAELERTNKFIKELIKDGKNLIAATKSLSVAQRKFAHSLRDFKFEFIGDAVTDDERCIDASLREFSNFLKNLEEQREIMALSVTETLIKPLEKFRKEQLGAVKEEKKKFDKETEKNYSLIDKHLNLSAKKKDSHLQEADIQVEQNRQHFYELSLEYVCKLQEIQERKKFEFVEPMLSFFQGMFTFYHQGHELAKDFNHYKMELQINIQNTRNRFEGTRSEVEELMNKIRQNPKDHKRASQFTAEGYLYVQEKRPAPFGSSWVKHYCMYRKAAKKFNMIPFEHRSGGKLGDGEVFFLKECTKRHTDSIDRRFCFDIEAADRPGVSLTMQAFSEEERKQWLEALGGKEALSHSFNTAIIPRPEGNAQLDKMGFTIIRKCISAVETRGINDQGLYRVVGVSSKVQRLLSMLMDVKTCNEVDLENSADWEVKTITSALKQYLRSLPEPLMTYELHGDFIVPAKSGSPESRVNAIHFLVHKLPEKNKEMLDILVKHLTNVSNHSKQNLMTVANLGVVFGPTLMRPQEETVAALMDLKFQNIVVEILIENHEKIFRTPPDTTFPEPTCLSASPPNAPPRQSKRQGQRTKRPVAVYNLCLELEDGDNPYPSKEDTPTSSLDSLSSPSPVTTAVPGPPGPDKNHLLADGGSFGDWASTIPGQTRSSMVQWLNPQSPTTTSSNSAVTPLSPGSSPFPFSPPATVADKPPESIRSRKARAVYPCEAEHSSELSFEIGAIFEDVQTSREPGWLEGTLNGKRGLIPQNYVKLL", "length": 786, "header": "sp|A1A4S6-1|RHG10_HUMAN Isoform 1 of Rho GTPase-activating protein 10 OS=Homo sapiens OX=9606 GN=ARHGAP10 PE=1 SV=1 CANONICAL=A1A4S6-1" }, "isoforms": [ { "isoform_ac": "A1A4S6-1", "url": "", "sequence": { "sequence": "MGLQPLEFSDCYLDSPWFRERIRAHEAELERTNKFIKELIKDGKNLIAATKSLSVAQRKFAHSLRDFKFEFIGDAVTDDERCIDASLREFSNFLKNLEEQREIMALSVTETLIKPLEKFRKEQLGAVKEEKKKFDKETEKNYSLIDKHLNLSAKKKDSHLQEADIQVEQNRQHFYELSLEYVCKLQEIQERKKFEFVEPMLSFFQGMFTFYHQGHELAKDFNHYKMELQINIQNTRNRFEGTRSEVEELMNKIRQNPKDHKRASQFTAEGYLYVQEKRPAPFGSSWVKHYCMYRKAAKKFNMIPFEHRSGGKLGDGEVFFLKECTKRHTDSIDRRFCFDIEAADRPGVSLTMQAFSEEERKQWLEALGGKEALSHSFNTAIIPRPEGNAQLDKMGFTIIRKCISAVETRGINDQGLYRVVGVSSKVQRLLSMLMDVKTCNEVDLENSADWEVKTITSALKQYLRSLPEPLMTYELHGDFIVPAKSGSPESRVNAIHFLVHKLPEKNKEMLDILVKHLTNVSNHSKQNLMTVANLGVVFGPTLMRPQEETVAALMDLKFQNIVVEILIENHEKIFRTPPDTTFPEPTCLSASPPNAPPRQSKRQGQRTKRPVAVYNLCLELEDGDNPYPSKEDTPTSSLDSLSSPSPVTTAVPGPPGPDKNHLLADGGSFGDWASTIPGQTRSSMVQWLNPQSPTTTSSNSAVTPLSPGSSPFPFSPPATVADKPPESIRSRKARAVYPCEAEHSSELSFEIGAIFEDVQTSREPGWLEGTLNGKRGLIPQNYVKLL", "length": 786, "header": "sp|A1A4S6-1|RHG10_HUMAN Isoform 1 of Rho GTPase-activating protein 10 OS=Homo sapiens OX=9606 GN=ARHGAP10 PE=1 SV=1 CANONICAL=A1A4S6-1" }, "locus": { "chromosome": "4", "start_pos": 148072078, "end_pos": 147732302, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000336498.8", "url": "https://www.ensembl.org/id/ENST00000336498.8" }, { "database": "Ensembl Peptide", "id": "ENSP00000336923.3", "url": "https://www.ensembl.org/id/ENSP00000336923.3" } ] } }, { "isoform_ac": "H0Y8W5-1", "url": "", "sequence": { "sequence": "XCTKRHTDSIDRRFCFDIEAADRPGVSLTMQAFSEEERKQWLEALGGKEALSHSFNTAIIPRPEGNAQLDKMGFTIIRKCISAVETRGINDQGLYRVVGVSSKVQRLLSMLMDVKTCNEVDLENSADWEVKTITSALKQYLRSLPEPLMTYELHGDFIVPAKSGSPESRVNAIHFLVHKLPEKNKEMLDILVKHLTNVSNHSKQNLMTVANLGVVFGPTLMRPQEETVAALMDLKFQNIVVEILIENHEKIFRTPPDTTFPEPTCLSASPPNAPPRQSKRQGQRTKRPVAVYNLCLELEDGDNPYPSKEDTPTSSLDSLSSPSPVTTAVPGPPGPDKNHLLADGGSFGDWASTIIRSRKARAVYPCEAEHSSELSFEIGAIFEDVQTSREPGWLEGTLNGKRGLIPQNYVKLL", "length": 413, "header": "tr|H0Y8W5-1|RHG10_HUMAN Computationally mapped isoform of Rho GTPase-activating protein 10 OS=Homo sapiens OX=9606 GN=ARHGAP10 PE=1 SV=1 CANONICAL=A1A4S6-1" }, "locus": { "chromosome": "4", "start_pos": 148072080, "end_pos": 147881867, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000507661.1", "url": "https://www.ensembl.org/id/ENST00000507661.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000422358.1", "url": "https://www.ensembl.org/id/ENSP00000422358.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "Interaction of the small G protein RhoA with the C terminus of human phospholipase D1.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Yamazaki M, Zhang Y, Watanabe H, Yokozeki T, Ohno S, Kaibuchi K, Shibata H, Mukai H, Ono Y, Frohman MA, Kanaho Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "10037681", "url": "https://glygen.org/publication/PubMed/10037681" } ] }, { "title": "Expression, purification and crystallization of a BH domain from the GTPase regulatory protein associated with focal adhesion kinase.", "journal": "Acta crystallographica. Section D, Biological crystallography", "date": "1999", "authors": "Sheffield PJ, Derewenda U, Taylor J, Parsons TJ, Derewenda ZS", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "10232922", "url": "https://glygen.org/publication/PubMed/10232922" } ] }, { "title": "Association of frabin with the actin cytoskeleton is essential for microspike formation through activation of Cdc42 small G protein.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Umikawa M, Obaishi H, Nakanishi H, Satoh-Horikawa K, Takahashi K, Hotta I, Matsuura Y, Takai Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "10464238", "url": "https://glygen.org/publication/PubMed/10464238" } ] }, { "title": "The Borgs, a new family of Cdc42 and TC10 GTPase-interacting proteins.", "journal": "Molecular and cellular biology", "date": "1999", "authors": "Joberty G, Perlungher RR, Macara IG", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "10490598", "url": "https://glygen.org/publication/PubMed/10490598" } ] }, { "title": "Sema3A-induced growth-cone collapse is mediated by Rac1 amino acids 17-32.", "journal": "Current biology : CB", "date": "1999", "authors": "Vastrik I, Eickholt BJ, Walsh FS, Ridley A, Doherty P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "10508610", "url": "https://glygen.org/publication/PubMed/10508610" } ] }, { "title": "Dependence of Dbl and Dbs transformation on MEK and NF-kappaB activation.", "journal": "Molecular and cellular biology", "date": "1999", "authors": "Whitehead IP, Lambert QT, Glaven JA, Abe K, Rossman KL, Mahon GM, Trzaskos JM, Kay R, Campbell SL, Der CJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "10523665", "url": "https://glygen.org/publication/PubMed/10523665" } ] }, { "title": "Biological and regulatory properties of Vav-3, a new member of the Vav family of oncoproteins.", "journal": "Molecular and cellular biology", "date": "1999", "authors": "Movilla N, Bustelo XR", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "10523675", "url": "https://glygen.org/publication/PubMed/10523675" } ] }, { "title": "Rho-specific binding and guanine nucleotide exchange catalysis by KIAA0380, a dbl family member.", "journal": "FEBS letters", "date": "1999", "authors": "Rumenapp U, Blomquist A, Schworer G, Schablowski H, Psoma A, Jakobs KH", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "10526156", "url": "https://glygen.org/publication/PubMed/10526156" } ] }, { "title": "Identification and characterization of hPEM-2, a guanine nucleotide exchange factor specific for Cdc42.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Reid T, Bathoorn A, Ahmadian MR, Collard JG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "10559246", "url": "https://glygen.org/publication/PubMed/10559246" } ] }, { "title": "Human ECT2 is an exchange factor for Rho GTPases, phosphorylated in G2/M phases, and involved in cytokinesis.", "journal": "The Journal of cell biology", "date": "1999", "authors": "Tatsumoto T, Xie X, Blumenthal R, Okamoto I, Miki T", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "10579713", "url": "https://glygen.org/publication/PubMed/10579713" } ] }, { "title": "The structural basis of Rho effector recognition revealed by the crystal structure of human RhoA complexed with the effector domain of PKN/PRK1.", "journal": "Molecular cell", "date": "1999", "authors": "Maesaki R, Ihara K, Shimizu T, Kuroda S, Kaibuchi K, Hakoshima T", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "10619026", "url": "https://glygen.org/publication/PubMed/10619026" } ] }, { "title": "Functional analysis of ARHGAP6, a novel GTPase-activating protein for RhoA.", "journal": "Human molecular genetics", "date": "2000", "authors": "Prakash SK, Paylor R, Jenna S, Lamarche-Vane N, Armstrong DL, Xu B, Mancini MA, Zoghbi HY", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "10699171", "url": "https://glygen.org/publication/PubMed/10699171" } ] }, { "title": "Molecular cloning and characterization of a novel human STE20-like kinase, hSLK.", "journal": "Biochimica et biophysica acta", "date": "2000", "authors": "Yamada E, Tsujikawa K, Itoh S, Kameda Y, Kohama Y, Yamamoto H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "10699464", "url": "https://glygen.org/publication/PubMed/10699464" } ] }, { "title": "Autoinhibition and activation mechanisms of the Wiskott-Aldrich syndrome protein.", "journal": "Nature", "date": "2000", "authors": "Kim AS, Kakalis LT, Abdul-Manan N, Liu GA, Rosen MK", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013148", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013148" } ], "reference": [ { "type": "PubMed", "id": "10724160", "url": "https://glygen.org/publication/PubMed/10724160" } ] }, { "title": "Molecular cloning, expression characterization, and mapping of a novel putative inhibitor of rho GTPase activity, RTKN, to D2S145-D2S286.", "journal": "Genomics", "date": "2000", "authors": "Fu Q, Yu L, Liu Q, Zhang J, Zhang H, Zhao S", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "10873388", "url": "https://glygen.org/publication/PubMed/10873388" } ] }, { "title": "A human homolog of the C. elegans polarity determinant Par-6 links Rac and Cdc42 to PKCzeta signaling and cell transformation.", "journal": "Current biology : CB", "date": "2000", "authors": "Qiu RG, Abo A, Steven Martin G", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "10873802", "url": "https://glygen.org/publication/PubMed/10873802" } ] }, { "title": "FRL, a novel formin-related protein, binds to Rac and regulates cell motility and survival of macrophages.", "journal": "Molecular and cellular biology", "date": "2000", "authors": "Yayoshi-Yamamoto S, Taniuchi I, Watanabe T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "10958683", "url": "https://glygen.org/publication/PubMed/10958683" } ] }, { "title": "Structural basis for relief of autoinhibition of the Dbl homology domain of proto-oncogene Vav by tyrosine phosphorylation.", "journal": "Cell", "date": "2000", "authors": "Aghazadeh B, Lowry WE, Huang XY, Rosen MK", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "11007481", "url": "https://glygen.org/publication/PubMed/11007481" } ] }, { "title": "Characterization of p190RhoGEF, a RhoA-specific guanine nucleotide exchange factor that interacts with microtubules.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "van Horck FP, Ahmadian MR, Haeusler LC, Moolenaar WH, Kranenburg O", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "11058585", "url": "https://glygen.org/publication/PubMed/11058585" } ] }, { "title": "Identification and characterization of a novel Rho-specific guanine nucleotide exchange factor.", "journal": "The Biochemical journal", "date": "2000", "authors": "Blomquist A, Schworer G, Schablowski H, Psoma A, Lehnen M, Jakobs KH, Rumenapp U", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "11085924", "url": "https://glygen.org/publication/PubMed/11085924" } ] }, { "title": "Differential localization of Rho GTPases in live cells: regulation by hypervariable regions and RhoGDI binding.", "journal": "The Journal of cell biology", "date": "2001", "authors": "Michaelson D, Silletti J, Murphy G, D'Eustachio P, Rush M, Philips MR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013148", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013148" } ], "reference": [ { "type": "PubMed", "id": "11149925", "url": "https://glygen.org/publication/PubMed/11149925" } ] }, { "title": "Functional role for the class IX myosin myr5 in epithelial cell infection by Shigella flexneri.", "journal": "Cellular microbiology", "date": "2000", "authors": "Graf B, Bahler M, Hilpela P, Bowe C, Adam T", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "11207612", "url": "https://glygen.org/publication/PubMed/11207612" } ] }, { "title": "Signaling mediated by the closely related mammalian Rho family GTPases TC10 and Cdc42 suggests distinct functional pathways.", "journal": "Cell growth & differentiation : the molecular biology journal of the American Association for Cancer Research", "date": "2001", "authors": "Murphy GA, Jillian SA, Michaelson D, Philips MR, D'Eustachio P, Rush MG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013148", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013148" } ], "reference": [ { "type": "PubMed", "id": "11306516", "url": "https://glygen.org/publication/PubMed/11306516" } ] }, { "title": "Leukemia-associated Rho guanine nucleotide exchange factor, a Dbl family protein found mutated in leukemia, causes transformation by activation of RhoA.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Reuther GW, Lambert QT, Booden MA, Wennerberg K, Becknell B, Marcucci G, Sondek J, Caligiuri MA, Der CJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "11373293", "url": "https://glygen.org/publication/PubMed/11373293" } ] }, { "title": "Isolation of a novel human gene, ARHGAP9, encoding a rho-GTPase activating protein.", "journal": "Biochemical and biophysical research communications", "date": "2001", "authors": "Furukawa Y, Kawasoe T, Daigo Y, Nishiwaki T, Ishiguro H, Takahashi M, Kitayama J, Nakamura Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "11396949", "url": "https://glygen.org/publication/PubMed/11396949" } ] }, { "title": "Rich, a rho GTPase-activating protein domain-containing protein involved in signaling by Cdc42 and Rac1.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Richnau N, Aspenstrom P", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "11431473", "url": "https://glygen.org/publication/PubMed/11431473" } ] }, { "title": "PKNbeta interacts with the SH3 domains of Graf and a novel Graf related protein, Graf2, which are GTPase activating proteins for Rho family.", "journal": "Journal of biochemistry", "date": "2001", "authors": "Shibata H, Oishi K, Yamagiwa A, Matsumoto M, Mukai H, Ono Y", "evidence": [ { "database": "UniProtKB", "id": "A1A4S6", "url": "https://www.uniprot.org/uniprot/A1A4S6" }, { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "11432776", "url": "https://glygen.org/publication/PubMed/11432776" } ] }, { "title": "Endocytic protein intersectin-l regulates actin assembly via Cdc42 and N-WASP.", "journal": "Nature cell biology", "date": "2001", "authors": "Hussain NK, Jenna S, Glogauer M, Quinn CC, Wasiak S, Guipponi M, Antonarakis SE, Kay BK, Stossel TP, Lamarche-Vane N, McPherson PS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "11584276", "url": "https://glygen.org/publication/PubMed/11584276" } ] }, { "title": "Distinct roles for the two Rho GDP/GTP exchange factor domains of kalirin in regulation of neurite growth and neuronal morphology.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "date": "2001", "authors": "Penzes P, Johnson RC, Kambampati V, Mains RE, Eipper BA", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "11606631", "url": "https://glygen.org/publication/PubMed/11606631" } ] }, { "title": "Signal transduction in neuronal migration: roles of GTPase activating proteins and the small GTPase Cdc42 in the Slit-Robo pathway.", "journal": "Cell", "date": "2001", "authors": "Wong K, Ren XR, Huang YZ, Xie Y, Liu G, Saito H, Tang H, Wen L, Brady-Kalnay SM, Mei L, Wu JY, Xiong WC, Rao Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "11672528", "url": "https://glygen.org/publication/PubMed/11672528" } ] }, { "title": "Chondrocyte-derived ezrin-like domain containing protein (CDEP), a rho guanine nucleotide exchange factor, is inducible in chondrocytes by parathyroid hormone and cyclic AMP and has transforming activity in NIH3T3 cells.", "journal": "Osteoarthritis and cartilage", "date": "2001", "authors": "Koyano Y, Kawamoto T, Kikuchi A, Shen M, Kuruta Y, Tsutsumi S, Fujimoto K, Noshiro M, Fujii K, Kato Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "11680691", "url": "https://glygen.org/publication/PubMed/11680691" } ] }, { "title": "Kinectin is a key effector of RhoG microtubule-dependent cellular activity.", "journal": "Molecular and cellular biology", "date": "2001", "authors": "Vignal E, Blangy A, Martin M, Gauthier-Rouviere C, Fort P", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "11689693", "url": "https://glygen.org/publication/PubMed/11689693" } ] }, { "title": "Cdc42 induces filopodia by promoting the formation of an IRSp53:Mena complex.", "journal": "Current biology : CB", "date": "2001", "authors": "Krugmann S, Jordens I, Gevaert K, Driessens M, Vandekerckhove J, Hall A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013148", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013148" } ], "reference": [ { "type": "PubMed", "id": "11696321", "url": "https://glygen.org/publication/PubMed/11696321" } ] }, { "title": "The gene for a new brain specific RhoA exchange factor maps to the highly unstable chromosomal region 1p36.2-1p36.3.", "journal": "Oncogene", "date": "2001", "authors": "De Toledo M, Coulon V, Schmidt S, Fort P, Blangy A", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "11704860", "url": "https://glygen.org/publication/PubMed/11704860" } ] }, { "title": "Characterization of STEF, a guanine nucleotide exchange factor for Rac1, required for neurite growth.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Matsuo N, Hoshino M, Yoshizawa M, Nabeshima Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "11707441", "url": "https://glygen.org/publication/PubMed/11707441" } ] }, { "title": "PAK5, a new brain-specific kinase, promotes neurite outgrowth in N1E-115 cells.", "journal": "Molecular and cellular biology", "date": "2002", "authors": "Dan C, Nath N, Liberto M, Minden A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "11756552", "url": "https://glygen.org/publication/PubMed/11756552" } ] }, { "title": "AR and ER interaction with a p21-activated kinase (PAK6).", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2002", "authors": "Lee SR, Ramos SM, Ko A, Masiello D, Swanson KD, Lu ML, Balk SP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "11773441", "url": "https://glygen.org/publication/PubMed/11773441" } ] }, { "title": "Rac1 and RhoG promote cell survival by the activation of PI3K and Akt, independently of their ability to stimulate JNK and NF-kappaB.", "journal": "Oncogene", "date": "2002", "authors": "Murga C, Zohar M, Teramoto H, Gutkind JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "11803464", "url": "https://glygen.org/publication/PubMed/11803464" } ] }, { "title": "Pak1 kinase homodimers are autoinhibited in trans and dissociated upon activation by Cdc42 and Rac1.", "journal": "Molecular cell", "date": "2002", "authors": "Parrini MC, Lei M, Harrison SC, Mayer BJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "11804587", "url": "https://glygen.org/publication/PubMed/11804587" } ] }, { "title": "Identification of ARAP3, a novel PI3K effector regulating both Arf and Rho GTPases, by selective capture on phosphoinositide affinity matrices.", "journal": "Molecular cell", "date": "2002", "authors": "Krugmann S, Anderson KE, Ridley SH, Risso N, McGregor A, Coadwell J, Davidson K, Eguinoa A, Ellson CD, Lipp P, Manifava M, Ktistakis N, Painter G, Thuring JW, Cooper MA, Lim ZY, Holmes AB, Dove SK, Michell RH, Grewal A, Nazarian A, Erdjument-Bromage H, Tempst P, Stephens LR, Hawkins PT", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "11804589", "url": "https://glygen.org/publication/PubMed/11804589" } ] }, { "title": "ARAP1: a point of convergence for Arf and Rho signaling.", "journal": "Molecular cell", "date": "2002", "authors": "Miura K, Jacques KM, Stauffer S, Kubosaki A, Zhu K, Hirsch DS, Resau J, Zheng Y, Randazzo PA", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "11804590", "url": "https://glygen.org/publication/PubMed/11804590" } ] }, { "title": "Distinct role of phosphatidylinositol 3-kinase and Rho family GTPases in Vav3-induced cell transformation, cell motility, and morphological changes.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Sachdev P, Zeng L, Wang LH", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "11884391", "url": "https://glygen.org/publication/PubMed/11884391" } ] }, { "title": "Nucleotide exchange factor GEF-H1 mediates cross-talk between microtubules and the actin cytoskeleton.", "journal": "Nature cell biology", "date": "2002", "authors": "Krendel M, Zenke FT, Bokoch GM", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "11912491", "url": "https://glygen.org/publication/PubMed/11912491" } ] }, { "title": "IQGAP1 is a component of Cdc42 signaling to the cytoskeleton.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Swart-Mataraza JM, Li Z, Sacks DB", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013148", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013148" } ], "reference": [ { "type": "PubMed", "id": "11948177", "url": "https://glygen.org/publication/PubMed/11948177" } ] }, { "title": "SWAP-70 is a guanine-nucleotide-exchange factor that mediates signalling of membrane ruffling.", "journal": "Nature", "date": "2002", "authors": "Shinohara M, Terada Y, Iwamatsu A, Shinohara A, Mochizuki N, Higuchi M, Gotoh Y, Ihara S, Nagata S, Itoh H, Fukui Y, Jessberger R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "11961559", "url": "https://glygen.org/publication/PubMed/11961559" } ] }, { "title": "A mammalian Rho-specific guanine-nucleotide exchange factor (p164-RhoGEF) without a pleckstrin homology domain.", "journal": "The Biochemical journal", "date": "2002", "authors": "Rumenapp U, Freichel-Blomquist A, Wittinghofer B, Jakobs KH, Wieland T", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "12071859", "url": "https://glygen.org/publication/PubMed/12071859" } ] }, { "title": "A novel Rho GTPase-activating-protein interacts with Gem, a member of the Ras superfamily of GTPases.", "journal": "The Biochemical journal", "date": "2002", "authors": "Aresta S, de Tand-Heim MF, Beranger F, de Gunzburg J", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "12093360", "url": "https://glygen.org/publication/PubMed/12093360" } ] }, { "title": "p38 MAPK-mediated activation of NF-kappaB by the RhoGEF domain of Bcr.", "journal": "Oncogene", "date": "2002", "authors": "Korus M, Mahon GM, Cheng L, Whitehead IP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "12096337", "url": "https://glygen.org/publication/PubMed/12096337" } ] }, { "title": "Zizimin1, a novel Cdc42 activator, reveals a new GEF domain for Rho proteins.", "journal": "Nature cell biology", "date": "2002", "authors": "Meller N, Irani-Tehrani M, Kiosses WB, Del Pozo MA, Schwartz MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013148", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013148" } ], "reference": [ { "type": "PubMed", "id": "12172552", "url": "https://glygen.org/publication/PubMed/12172552" } ] }, { "title": "The novel Rho-GTPase activating gene MEGAP/ srGAP3 has a putative role in severe mental retardation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2002", "authors": "Endris V, Wogatzky B, Leimer U, Bartsch D, Zatyka M, Latif F, Maher ER, Tariverdian G, Kirsch S, Karch D, Rappold GA", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "12195014", "url": "https://glygen.org/publication/PubMed/12195014" } ] }, { "title": "The RhoA-binding protein, rhophilin-2, regulates actin cytoskeleton organization.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Peck JW, Oberst M, Bouker KB, Bowden E, Burbelo PD", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "12221077", "url": "https://glygen.org/publication/PubMed/12221077" } ] }, { "title": "XPLN, a guanine nucleotide exchange factor for RhoA and RhoB, but not RhoC.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Arthur WT, Ellerbroek SM, Der CJ, Burridge K, Wennerberg K", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "12221096", "url": "https://glygen.org/publication/PubMed/12221096" } ] }, { "title": "A novel FERM domain including guanine nucleotide exchange factor is involved in Rac signaling and regulates neurite remodeling.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "date": "2002", "authors": "Kubo T, Yamashita T, Yamaguchi A, Sumimoto H, Hosokawa K, Tohyama M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "12351724", "url": "https://glygen.org/publication/PubMed/12351724" } ] }, { "title": "Identification of an evolutionarily conserved superfamily of DOCK180-related proteins with guanine nucleotide exchange activity.", "journal": "Journal of cell science", "date": "2002", "authors": "Cote JF, Vuori K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "12432077", "url": "https://glygen.org/publication/PubMed/12432077" } ] }, { "title": "A new constitutively active brain PAK3 isoform displays modified specificities toward Rac and Cdc42 GTPases.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Rousseau V, Goupille O, Morin N, Barnier JV", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013148", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013148" } ], "reference": [ { "type": "PubMed", "id": "12464619", "url": "https://glygen.org/publication/PubMed/12464619" } ] }, { "title": "Novel role of gp91(phox)-containing NAD(P)H oxidase in vascular endothelial growth factor-induced signaling and angiogenesis.", "journal": "Circulation research", "date": "2002", "authors": "Ushio-Fukai M, Tang Y, Fukai T, Dikalov SI, Ma Y, Fujimoto M, Quinn MT, Pagano PJ, Johnson C, Alexander RW", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "12480817", "url": "https://glygen.org/publication/PubMed/12480817" } ] }, { "title": "Deleted in liver cancer (DLC) 2 encodes a RhoGAP protein with growth suppressor function and is underexpressed in hepatocellular carcinoma.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Ching YP, Wong CM, Chan SF, Leung TH, Ng DC, Jin DY, Ng IO", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "12531887", "url": "https://glygen.org/publication/PubMed/12531887" } ] }, { "title": "Rapid induction of dendritic spine morphogenesis by trans-synaptic ephrinB-EphB receptor activation of the Rho-GEF kalirin.", "journal": "Neuron", "date": "2003", "authors": "Penzes P, Beeser A, Chernoff J, Schiller MR, Eipper BA, Mains RE, Huganir RL", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "12546821", "url": "https://glygen.org/publication/PubMed/12546821" } ] }, { "title": "A Rac/Cdc42-specific exchange factor, GEFT, induces cell proliferation, transformation, and migration.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Guo X, Stafford LJ, Bryan B, Xia C, Ma W, Wu X, Liu D, Songyang Z, Liu M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "12547822", "url": "https://glygen.org/publication/PubMed/12547822" } ] }, { "title": "ArhGAP15, a novel human RacGAP protein with GTPase binding property.", "journal": "FEBS letters", "date": "2003", "authors": "Seoh ML, Ng CH, Yong J, Lim L, Leung T", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "12650940", "url": "https://glygen.org/publication/PubMed/12650940" } ] }, { "title": "Translocation of CrkL to focal adhesions mediates integrin-induced migration downstream of Src family kinases.", "journal": "Molecular and cellular biology", "date": "2003", "authors": "Li L, Guris DL, Okura M, Imamoto A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "12665586", "url": "https://glygen.org/publication/PubMed/12665586" } ] }, { "title": "TCGAP, a multidomain Rho GTPase-activating protein involved in insulin-stimulated glucose transport.", "journal": "The EMBO journal", "date": "2003", "authors": "Chiang SH, Hwang J, Legendre M, Zhang M, Kimura A, Saltiel AR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013148", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013148" } ], "reference": [ { "type": "PubMed", "id": "12773384", "url": "https://glygen.org/publication/PubMed/12773384" } ] }, { "title": "p250GAP, a novel brain-enriched GTPase-activating protein for Rho family GTPases, is involved in the N-methyl-d-aspartate receptor signaling.", "journal": "Molecular biology of the cell", "date": "2003", "authors": "Nakazawa T, Watabe AM, Tezuka T, Yoshida Y, Yokoyama K, Umemori H, Inoue A, Okabe S, Manabe T, Yamamoto T", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "12857875", "url": "https://glygen.org/publication/PubMed/12857875" } ] }, { "title": "Identification of an autoinhibitory domain of p21-activated protein kinase 5.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Ching YP, Leong VY, Wong CM, Kung HF", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013148", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013148" } ], "reference": [ { "type": "PubMed", "id": "12860998", "url": "https://glygen.org/publication/PubMed/12860998" } ] }, { "title": "Characterization of the Rac-GAP (Rac-GTPase-activating protein) activity of beta2-chimaerin, a 'non-protein kinase C' phorbol ester receptor.", "journal": "The Biochemical journal", "date": "2003", "authors": "Caloca MJ, Wang H, Kazanietz MG", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "12877655", "url": "https://glygen.org/publication/PubMed/12877655" } ] }, { "title": "The mechanism of p21-activated kinase 2 autoactivation.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Wu H, Wang ZX", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013148", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013148" } ], "reference": [ { "type": "PubMed", "id": "12907671", "url": "https://glygen.org/publication/PubMed/12907671" } ] }, { "title": "T cell receptor engagement leads to the recruitment of IBP, a novel guanine nucleotide exchange factor, to the immunological synapse.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Gupta S, Fanzo JC, Hu C, Cox D, Jang SY, Lee AE, Greenberg S, Pernis AB", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "12923183", "url": "https://glygen.org/publication/PubMed/12923183" } ] }, { "title": "Tuba, a novel protein containing bin/amphiphysin/Rvs and Dbl homology domains, links dynamin to regulation of the actin cytoskeleton.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Salazar MA, Kwiatkowski AV, Pellegrini L, Cestra G, Butler MH, Rossman KL, Serna DM, Sondek J, Gertler FB, De Camilli P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013148", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013148" } ], "reference": [ { "type": "PubMed", "id": "14506234", "url": "https://glygen.org/publication/PubMed/14506234" } ] }, { "title": "G Protein betagamma subunits stimulate p114RhoGEF, a guanine nucleotide exchange factor for RhoA and Rac1: regulation of cell shape and reactive oxygen species production.", "journal": "Circulation research", "date": "2003", "authors": "Niu J, Profirovic J, Pan H, Vaiskunaite R, Voyno-Yasenetskaya T", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "14512443", "url": "https://glygen.org/publication/PubMed/14512443" } ] }, { "title": "Molecular dissection of the interaction between the small G proteins Rac1 and RhoA and protein kinase C-related kinase 1 (PRK1).", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Owen D, Lowe PN, Nietlispach D, Brosnan CE, Chirgadze DY, Parker PJ, Blundell TL, Mott HR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "14514689", "url": "https://glygen.org/publication/PubMed/14514689" } ] }, { "title": "Post-translational processing of rac p21s is important both for their interaction with the GDP/GTP exchange proteins and for their activation of NADPH oxidase.", "journal": "The Journal of biological chemistry", "date": "1992", "authors": "Ando S, Kaibuchi K, Sasaki T, Hiraoka K, Nishiyama T, Mizuno T, Asada M, Nunoi H, Matsuda I, Matsuura Y, et al.", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "1464587", "url": "https://glygen.org/publication/PubMed/1464587" } ] }, { "title": "Comparative functional analysis of the Rac GTPases.", "journal": "FEBS letters", "date": "2003", "authors": "Haeusler LC, Blumenstein L, Stege P, Dvorsky R, Ahmadian MR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "14675773", "url": "https://glygen.org/publication/PubMed/14675773" } ] }, { "title": "MOCA induces membrane spreading by activating Rac1.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Namekata K, Enokido Y, Iwasawa K, Kimura H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "14718541", "url": "https://glygen.org/publication/PubMed/14718541" } ] }, { "title": "DEF6, a novel PH-DH-like domain protein, is an upstream activator of the Rho GTPases Rac1, Cdc42, and RhoA.", "journal": "Experimental cell research", "date": "2004", "authors": "Mavrakis KJ, McKinlay KJ, Jones P, Sablitzky F", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "15023524", "url": "https://glygen.org/publication/PubMed/15023524" } ] }, { "title": "Alsin is a Rab5 and Rac1 guanine nucleotide exchange factor.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Topp JD, Gray NW, Gerard RD, Horazdovsky BF", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "15033976", "url": "https://glygen.org/publication/PubMed/15033976" } ] }, { "title": "BPGAP1 interacts with cortactin and facilitates its translocation to cell periphery for enhanced cell migration.", "journal": "Molecular biology of the cell", "date": "2004", "authors": "Lua BL, Low BC", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "15064355", "url": "https://glygen.org/publication/PubMed/15064355" } ] }, { "title": "Scambio, a novel guanine nucleotide exchange factor for Rho.", "journal": "Molecular cancer", "date": "2004", "authors": "Curtis C, Hemmeryckx B, Haataja L, Senadheera D, Groffen J, Heisterkamp N", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "15107133", "url": "https://glygen.org/publication/PubMed/15107133" } ] }, { "title": "SGEF, a RhoG guanine nucleotide exchange factor that stimulates macropinocytosis.", "journal": "Molecular biology of the cell", "date": "2004", "authors": "Ellerbroek SM, Wennerberg K, Arthur WT, Dunty JM, Bowman DR, DeMali KA, Der C, Burridge K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "15133129", "url": "https://glygen.org/publication/PubMed/15133129" } ] }, { "title": "Identification and characterization of a novel Rho GTPase activating protein implicated in receptor-mediated endocytosis.", "journal": "FEBS letters", "date": "2004", "authors": "Sakakibara T, Nemoto Y, Nukiwa T, Takeshima H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "15147912", "url": "https://glygen.org/publication/PubMed/15147912" } ] }, { "title": "Role of the Sec14-like domain of Dbl family exchange factors in the regulation of Rho family GTPases in different subcellular sites.", "journal": "Cellular signalling", "date": "2004", "authors": "Ueda S, Kataoka T, Satoh T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013148", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013148" } ], "reference": [ { "type": "PubMed", "id": "15157669", "url": "https://glygen.org/publication/PubMed/15157669" } ] }, { "title": "Toca-1 mediates Cdc42-dependent actin nucleation by activating the N-WASP-WIP complex.", "journal": "Cell", "date": "2004", "authors": "Ho HY, Rohatgi R, Lebensohn AM, Le Ma, Li J, Gygi SP, Kirschner MW", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013148", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013148" } ], "reference": [ { "type": "PubMed", "id": "15260990", "url": "https://glygen.org/publication/PubMed/15260990" } ] }, { "title": "A vascular cell-restricted RhoGAP, p73RhoGAP, is a key regulator of angiogenesis.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2004", "authors": "Su ZJ, Hahn CN, Goodall GJ, Reck NM, Leske AF, Davy A, Kremmidiotis G, Vadas MA, Gamble JR", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "15302923", "url": "https://glygen.org/publication/PubMed/15302923" } ] }, { "title": "Isolation and characterisation of DOCK8, a member of the DOCK180-related regulators of cell morphology.", "journal": "FEBS letters", "date": "2004", "authors": "Ruusala A, Aspenstrom P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013148", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013148" } ], "reference": [ { "type": "PubMed", "id": "15304341", "url": "https://glygen.org/publication/PubMed/15304341" } ] }, { "title": "Galpha13 stimulates cell migration through cortactin-interacting protein Hax-1.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Radhika V, Onesime D, Ha JH, Dhanasekaran N", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "15339924", "url": "https://glygen.org/publication/PubMed/15339924" } ] }, { "title": "Vilse, a conserved Rac/Cdc42 GAP mediating Robo repulsion in tracheal cells and axons.", "journal": "Genes & development", "date": "2004", "authors": "Lundstrom A, Gallio M, Englund C, Steneberg P, Hemphala J, Aspenstrom P, Keleman K, Falileeva L, Dickson BJ, Samakovlis C", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "15342493", "url": "https://glygen.org/publication/PubMed/15342493" } ] }, { "title": "Identification and characterization of PS-GAP as a novel regulator of caspase-activated PAK-2.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Koeppel MA, McCarthy CC, Moertl E, Jakobi R", "evidence": [ { "database": "Reactome", "id": "R-HSA-211728", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211728" }, { "database": "RefSeq", "id": "NP_078881", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_078881" } ], "reference": [ { "type": "PubMed", "id": "15471851", "url": "https://glygen.org/publication/PubMed/15471851" } ] }, { "title": "WGEF is a novel RhoGEF expressed in intestine, liver, heart, and kidney.", "journal": "Biochemical and biophysical research communications", "date": "2004", "authors": "Wang Y, Suzuki H, Yokoo T, Tada-Iida K, Kihara R, Miura M, Watanabe K, Sone H, Shimano H, Toyoshima H, Yamada N", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "15485661", "url": "https://glygen.org/publication/PubMed/15485661" } ] }, { "title": "Structural mechanism for lipid activation of the Rac-specific GAP, beta2-chimaerin.", "journal": "Cell", "date": "2004", "authors": "Canagarajah B, Leskow FC, Ho JY, Mischak H, Saidi LF, Kazanietz MG, Hurley JH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "15507211", "url": "https://glygen.org/publication/PubMed/15507211" } ] }, { "title": "A Rac1/phosphatidylinositol 3-kinase/Akt3 anti-apoptotic pathway, triggered by AlsinLF, the product of the ALS2 gene, antagonizes Cu/Zn-superoxide dismutase (SOD1) mutant-induced motoneuronal cell death.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Kanekura K, Hashimoto Y, Kita Y, Sasabe J, Aiso S, Nishimoto I, Matsuoka M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "15579468", "url": "https://glygen.org/publication/PubMed/15579468" } ] }, { "title": "TIM, a Dbl-related protein, regulates cell shape and cytoskeletal organization in a Rho-dependent manner.", "journal": "Cellular signalling", "date": "2005", "authors": "Xie X, Chang SW, Tatsumoto T, Chan AM, Miki T", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "15601624", "url": "https://glygen.org/publication/PubMed/15601624" } ] }, { "title": "Characterization of a novel GTPase-activating protein associated with focal adhesions and the actin cytoskeleton.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Lavelin I, Geiger B", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "15611138", "url": "https://glygen.org/publication/PubMed/15611138" } ] }, { "title": "Local phosphatidylinositol 3,4,5-trisphosphate accumulation recruits Vav2 and Vav3 to activate Rac1/Cdc42 and initiate neurite outgrowth in nerve growth factor-stimulated PC12 cells.", "journal": "Molecular biology of the cell", "date": "2005", "authors": "Aoki K, Nakamura T, Fujikawa K, Matsuda M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "15728722", "url": "https://glygen.org/publication/PubMed/15728722" } ] }, { "title": "Recognition and activation of Rho GTPases by Vav1 and Vav2 guanine nucleotide exchange factors.", "journal": "Biochemistry", "date": "2005", "authors": "Heo J, Thapar R, Campbell SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "15850391", "url": "https://glygen.org/publication/PubMed/15850391" } ] }, { "title": "Involvement of a Rac activator,P-Rex1, in neurotrophin-derived signaling and neuronal migration.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "date": "2005", "authors": "Yoshizawa M, Kawauchi T, Sone M, Nishimura YV, Terao M, Chihama K, Nabeshima Y, Hoshino M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "15858067", "url": "https://glygen.org/publication/PubMed/15858067" } ] }, { "title": "Structural basis of Rho GTPase-mediated activation of the formin mDia1.", "journal": "Molecular cell", "date": "2005", "authors": "Otomo T, Otomo C, Tomchick DR, Machius M, Rosen MK", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "15866170", "url": "https://glygen.org/publication/PubMed/15866170" } ] }, { "title": "Substrate specificity and recognition is conferred by the pleckstrin homology domain of the Dbl family guanine nucleotide exchange factor P-Rex2.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Joseph RE, Norris FA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "15897194", "url": "https://glygen.org/publication/PubMed/15897194" } ] }, { "title": "Regulation of p21-activated kinase-independent Rac1 signal transduction by nischarin.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Reddig PJ, Xu D, Juliano RL", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "16002401", "url": "https://glygen.org/publication/PubMed/16002401" } ] }, { "title": "GrinchGEF--a novel Rho-specific guanine nucleotide exchange factor.", "journal": "Biochemical and biophysical research communications", "date": "2005", "authors": "Winkler S, Mohl M, Wieland T, Lutz S", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "16112081", "url": "https://glygen.org/publication/PubMed/16112081" } ] }, { "title": "The t complex-encoded GTPase-activating protein Tagap1 acts as a transmission ratio distorter in mice.", "journal": "Nature genetics", "date": "2005", "authors": "Bauer H, Willert J, Koschorz B, Herrmann BG", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "16116428", "url": "https://glygen.org/publication/PubMed/16116428" } ] }, { "title": "ARHGAP10 is necessary for alpha-catenin recruitment at adherens junctions and for Listeria invasion.", "journal": "Nature cell biology", "date": "2005", "authors": "Sousa S, Cabanes D, Archambaud C, Colland F, Lemichez E, Popoff M, Boisson-Dupuis S, Gouin E, Lecuit M, Legrain P, Cossart P", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "16184169", "url": "https://glygen.org/publication/PubMed/16184169" } ] }, { "title": "Deleted in liver cancer 2 (DLC2) suppresses cell transformation by means of inhibition of RhoA activity.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2005", "authors": "Leung TH, Ching YP, Yam JW, Wong CM, Yau TO, Jin DY, Ng IO", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "16217026", "url": "https://glygen.org/publication/PubMed/16217026" } ] }, { "title": "P-Rex1 is a primary Rac2 guanine nucleotide exchange factor in mouse neutrophils.", "journal": "Current biology : CB", "date": "2005", "authors": "Dong X, Mo Z, Bokoch G, Guo C, Li Z, Wu D", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "16243036", "url": "https://glygen.org/publication/PubMed/16243036" } ] }, { "title": "A PDZ-binding motif as a critical determinant of Rho guanine exchange factor function and cell phenotype.", "journal": "Molecular biology of the cell", "date": "2006", "authors": "Liu M, Horowitz A", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "16467373", "url": "https://glygen.org/publication/PubMed/16467373" } ] }, { "title": "Biochemical characterization of Alsin, a Rab5 and Rac1 guanine nucleotide exchange factor.", "journal": "Methods in enzymology", "date": "2005", "authors": "Topp JD, Carney DS, Horazdovsky BF", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "16473593", "url": "https://glygen.org/publication/PubMed/16473593" } ] }, { "title": "Targeting and activation of Rac1 are mediated by the exchange factor beta-Pix.", "journal": "The Journal of cell biology", "date": "2006", "authors": "ten Klooster JP, Jaffer ZM, Chernoff J, Hordijk PL", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "16492808", "url": "https://glygen.org/publication/PubMed/16492808" } ] }, { "title": "Involvement of Rac1 in activation of multicomponent Nox1- and Nox3-based NADPH oxidases.", "journal": "Molecular and cellular biology", "date": "2006", "authors": "Ueyama T, Geiszt M, Leto TL", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "16507994", "url": "https://glygen.org/publication/PubMed/16507994" } ] }, { "title": "The human orthologue of CdGAP is a phosphoprotein and a GTPase-activating protein for Cdc42 and Rac1 but not RhoA.", "journal": "Biology of the cell", "date": "2006", "authors": "Tcherkezian J, Triki I, Stenne R, Danek EI, Lamarche-Vane N", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "16519628", "url": "https://glygen.org/publication/PubMed/16519628" } ] }, { "title": "The diaphanous-related formin DAAM1 collaborates with the Rho GTPases RhoA and Cdc42, CIP4 and Src in regulating cell morphogenesis and actin dynamics.", "journal": "Experimental cell research", "date": "2006", "authors": "Aspenstrom P, Richnau N, Johansson AS", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "16630611", "url": "https://glygen.org/publication/PubMed/16630611" } ] }, { "title": "Nox1-dependent reactive oxygen generation is regulated by Rac1.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Cheng G, Diebold BA, Hughes Y, Lambeth JD", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "16636067", "url": "https://glygen.org/publication/PubMed/16636067" } ] }, { "title": "Optimization of WAVE2 complex-induced actin polymerization by membrane-bound IRSp53, PIP(3), and Rac.", "journal": "The Journal of cell biology", "date": "2006", "authors": "Suetsugu S, Kurisu S, Oikawa T, Yamazaki D, Oda A, Takenawa T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "16702231", "url": "https://glygen.org/publication/PubMed/16702231" } ] }, { "title": "Caveolin-1 functions as a novel Cdc42 guanine nucleotide dissociation inhibitor in pancreatic beta-cells.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Nevins AK, Thurmond DC", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013148", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013148" } ], "reference": [ { "type": "PubMed", "id": "16714282", "url": "https://glygen.org/publication/PubMed/16714282" } ] }, { "title": "Direct involvement of the small GTPase Rac in activation of the superoxide-producing NADPH oxidase Nox1.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Miyano K, Ueno N, Takeya R, Sumimoto H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "16762923", "url": "https://glygen.org/publication/PubMed/16762923" } ] }, { "title": "Inactivation of Rho GTPases by p190 RhoGAP reduces human pancreatic cancer cell invasion and metastasis.", "journal": "Cancer science", "date": "2006", "authors": "Kusama T, Mukai M, Endo H, Ishikawa O, Tatsuta M, Nakamura H, Inoue M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "16776779", "url": "https://glygen.org/publication/PubMed/16776779" } ] }, { "title": "The effect of missense mutations in the RhoGAP-homology domain on ocrl1 function.", "journal": "Molecular genetics and metabolism", "date": "2006", "authors": "Lichter-Konecki U, Farber LW, Cronin JS, Suchy SF, Nussbaum RL", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "16777452", "url": "https://glygen.org/publication/PubMed/16777452" } ] }, { "title": "Physical and functional interaction of Fyn tyrosine kinase with a brain-enriched Rho GTPase-activating protein TCGAP.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Liu H, Nakazawa T, Tezuka T, Yamamoto T", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "16777849", "url": "https://glygen.org/publication/PubMed/16777849" } ] }, { "title": "FilGAP, a Rho- and ROCK-regulated GAP for Rac binds filamin A to control actin remodelling.", "journal": "Nature cell biology", "date": "2006", "authors": "Ohta Y, Hartwig JH, Stossel TP", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "16862148", "url": "https://glygen.org/publication/PubMed/16862148" } ] }, { "title": "Gef10--the third member of a Rho-specific guanine nucleotide exchange factor subfamily with unusual protein architecture.", "journal": "Naunyn-Schmiedeberg's archives of pharmacology", "date": "2006", "authors": "Mohl M, Winkler S, Wieland T, Lutz S", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "16896804", "url": "https://glygen.org/publication/PubMed/16896804" } ] }, { "title": "Gene targeting of Cdc42 and Cdc42GAP affirms the critical involvement of Cdc42 in filopodia induction, directed migration, and proliferation in primary mouse embryonic fibroblasts.", "journal": "Molecular biology of the cell", "date": "2006", "authors": "Yang L, Wang L, Zheng Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "16914516", "url": "https://glygen.org/publication/PubMed/16914516" } ] }, { "title": "Identification of a DOCK180-related guanine nucleotide exchange factor that is capable of mediating a positive feedback activation of Cdc42.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Lin Q, Yang W, Baird D, Feng Q, Cerione RA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "16968698", "url": "https://glygen.org/publication/PubMed/16968698" } ] }, { "title": "Multiple Rho proteins regulate the subcellular targeting of PAK5.", "journal": "Biochemical and biophysical research communications", "date": "2006", "authors": "Wu X, Frost JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013148", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013148" } ], "reference": [ { "type": "PubMed", "id": "17064668", "url": "https://glygen.org/publication/PubMed/17064668" } ] }, { "title": "ARAP2 effects on the actin cytoskeleton are dependent on Arf6-specific GTPase-activating-protein activity and binding to RhoA-GTP.", "journal": "Journal of cell science", "date": "2006", "authors": "Yoon HY, Miura K, Cuthbert EJ, Davis KK, Ahvazi B, Casanova JE, Randazzo PA", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "17077126", "url": "https://glygen.org/publication/PubMed/17077126" } ] }, { "title": "Asef2 functions as a Cdc42 exchange factor and is stimulated by the release of an autoinhibitory module from a concealed C-terminal activation element.", "journal": "Molecular and cellular biology", "date": "2007", "authors": "Hamann MJ, Lubking CM, Luchini DN, Billadeau DD", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "17145773", "url": "https://glygen.org/publication/PubMed/17145773" } ] }, { "title": "Dock6, a Dock-C subfamily guanine nucleotide exchanger, has the dual specificity for Rac1 and Cdc42 and regulates neurite outgrowth.", "journal": "Experimental cell research", "date": "2007", "authors": "Miyamoto Y, Yamauchi J, Sanbe A, Tanoue A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "17196961", "url": "https://glygen.org/publication/PubMed/17196961" } ] }, { "title": "Asef is a Cdc42-specific guanine nucleotide exchange factor.", "journal": "Biological chemistry", "date": "2007", "authors": "Gotthardt K, Ahmadian MR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "17214551", "url": "https://glygen.org/publication/PubMed/17214551" } ] }, { "title": "IQGAP3, a novel effector of Rac1 and Cdc42, regulates neurite outgrowth.", "journal": "Journal of cell science", "date": "2007", "authors": "Wang S, Watanabe T, Noritake J, Fukata M, Yoshimura T, Itoh N, Harada T, Nakagawa M, Matsuura Y, Arimura N, Kaibuchi K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "17244649", "url": "https://glygen.org/publication/PubMed/17244649" } ] }, { "title": "Role of phospholipase Cgamma1 in cell spreading requires association with a beta-Pix/GIT1-containing complex, leading to activation of Cdc42 and Rac1.", "journal": "Molecular and cellular biology", "date": "2007", "authors": "Jones NP, Katan M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "17562871", "url": "https://glygen.org/publication/PubMed/17562871" } ] }, { "title": "Role of the small GTPase Rac in p22phox-dependent NADPH oxidases.", "journal": "Biochimie", "date": "2007", "authors": "Miyano K, Sumimoto H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "17583407", "url": "https://glygen.org/publication/PubMed/17583407" } ] }, { "title": "Identification and characterization of Asef2, a guanine-nucleotide exchange factor specific for Rac1 and Cdc42.", "journal": "Oncogene", "date": "2007", "authors": "Kawasaki Y, Sagara M, Shibata Y, Shirouzu M, Yokoyama S, Akiyama T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "17599059", "url": "https://glygen.org/publication/PubMed/17599059" } ] }, { "title": "Regulation of ephexin1, a guanine nucleotide exchange factor of Rho family GTPases, by fibroblast growth factor receptor-mediated tyrosine phosphorylation.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Zhang Y, Sawada T, Jing X, Yokote H, Yan X, Sakaguchi K", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "17702745", "url": "https://glygen.org/publication/PubMed/17702745" } ] }, { "title": "A role of the Lowe syndrome protein OCRL in early steps of the endocytic pathway.", "journal": "Developmental cell", "date": "2007", "authors": "Erdmann KS, Mao Y, McCrea HJ, Zoncu R, Lee S, Paradise S, Modregger J, Biemesderfer D, Toomre D, De Camilli P", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "17765681", "url": "https://glygen.org/publication/PubMed/17765681" } ] }, { "title": "ARHGAP4 is a novel RhoGAP that mediates inhibition of cell motility and axon outgrowth.", "journal": "Molecular and cellular neurosciences", "date": "2007", "authors": "Vogt DL, Gray CD, Young WS 3rd, Orellana SA, Malouf AT", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "17804252", "url": "https://glygen.org/publication/PubMed/17804252" } ] }, { "title": "DLC-1 suppresses non-small cell lung cancer growth and invasion by RhoGAP-dependent and independent mechanisms.", "journal": "Molecular carcinogenesis", "date": "2008", "authors": "Healy KD, Hodgson L, Kim TY, Shutes A, Maddileti S, Juliano RL, Hahn KM, Harden TK, Bang YJ, Der CJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "17932950", "url": "https://glygen.org/publication/PubMed/17932950" } ] }, { "title": "Trio's Rho-specific GEF domain is the missing Galpha q effector in C. elegans.", "journal": "Genes & development", "date": "2007", "authors": "Williams SL, Lutz S, Charlie NK, Vettel C, Ailion M, Coco C, Tesmer JJ, Jorgensen EM, Wieland T, Miller KG", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "17942708", "url": "https://glygen.org/publication/PubMed/17942708" } ] }, { "title": "START-GAP3/DLC3 is a GAP for RhoA and Cdc42 and is localized in focal adhesions regulating cell morphology.", "journal": "Biochemical and biophysical research communications", "date": "2007", "authors": "Kawai K, Kiyota M, Seike J, Deki Y, Yagisawa H", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "17976533", "url": "https://glygen.org/publication/PubMed/17976533" } ] }, { "title": "The Rac1 polybasic region is required for interaction with its effector PRK1.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Modha R, Campbell LJ, Nietlispach D, Buhecha HR, Owen D, Mott HR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "18006505", "url": "https://glygen.org/publication/PubMed/18006505" } ] }, { "title": "Heterotrimeric G protein betagamma subunits stimulate FLJ00018, a guanine nucleotide exchange factor for Rac1 and Cdc42.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Ueda H, Nagae R, Kozawa M, Morishita R, Kimura S, Nagase T, Ohara O, Yoshida S, Asano T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "18045877", "url": "https://glygen.org/publication/PubMed/18045877" } ] }, { "title": "Specific recognition of Rac2 and Cdc42 by DOCK2 and DOCK9 guanine nucleotide exchange factors.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Kwofie MA, Skowronski J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013148", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013148" } ], "reference": [ { "type": "PubMed", "id": "18056264", "url": "https://glygen.org/publication/PubMed/18056264" } ] }, { "title": "Anillin is a scaffold protein that links RhoA, actin, and myosin during cytokinesis.", "journal": "Current biology : CB", "date": "2008", "authors": "Piekny AJ, Glotzer M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "18158243", "url": "https://glygen.org/publication/PubMed/18158243" } ] }, { "title": "Biochemical characterization of the Rho GTPase-regulated actin assembly by diaphanous-related formins, mDia1 and Daam1, in platelets.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Higashi T, Ikeda T, Shirakawa R, Kondo H, Kawato M, Horiguchi M, Okuda T, Okawa K, Fukai S, Nureki O, Kita T, Horiuchi H", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "18218625", "url": "https://glygen.org/publication/PubMed/18218625" } ] }, { "title": "Role of chimaerins, a group of Rac-specific GTPase activating proteins, in T-cell receptor signaling.", "journal": "Cellular signalling", "date": "2008", "authors": "Caloca MJ, Delgado P, Alarcon B, Bustelo XR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "18249095", "url": "https://glygen.org/publication/PubMed/18249095" } ] }, { "title": "Identification of a conserved Rac-binding site on NADPH oxidases supports a direct GTPase regulatory mechanism.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Kao YY, Gianni D, Bohl B, Taylor RM, Bokoch GM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "18347018", "url": "https://glygen.org/publication/PubMed/18347018" } ] }, { "title": "Novel insights into FGD3, a putative GEF for Cdc42, that undergoes SCF(FWD1/beta-TrCP)-mediated proteasomal degradation analogous to that of its homologue FGD1 but regulates cell morphology and motility differently from FGD1.", "journal": "Genes to cells : devoted to molecular & cellular mechanisms", "date": "2008", "authors": "Hayakawa M, Matsushima M, Hagiwara H, Oshima T, Fujino T, Ando K, Kikugawa K, Tanaka H, Miyazawa K, Kitagawa M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013148", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013148" } ], "reference": [ { "type": "PubMed", "id": "18363964", "url": "https://glygen.org/publication/PubMed/18363964" } ] }, { "title": "Mutation of Dock5, a member of the guanine exchange factor Dock180 superfamily, in the rupture of lens cataract mouse.", "journal": "Experimental eye research", "date": "2008", "authors": "Omi N, Kiyokawa E, Matsuda M, Kinoshita K, Yamada S, Yamada K, Matsushima Y, Wang Y, Kawai J, Suzuki M, Hayashizaki Y, Hiai H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "18396277", "url": "https://glygen.org/publication/PubMed/18396277" } ] }, { "title": "ErbB2 directly activates the exchange factor Dock7 to promote Schwann cell migration.", "journal": "The Journal of cell biology", "date": "2008", "authors": "Yamauchi J, Miyamoto Y, Chan JR, Tanoue A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "18426980", "url": "https://glygen.org/publication/PubMed/18426980" } ] }, { "title": "Phosphorylation and activation of the Rac1 and Cdc42 GEF Asef in A431 cells stimulated by EGF.", "journal": "Journal of cell science", "date": "2008", "authors": "Itoh RE, Kiyokawa E, Aoki K, Nishioka T, Akiyama T, Matsuda M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "18653540", "url": "https://glygen.org/publication/PubMed/18653540" } ] }, { "title": "Effects of structure of Rho GTPase-activating protein DLC-1 on cell morphology and migration.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Kim TY, Healy KD, Der CJ, Sciaky N, Bang YJ, Juliano RL", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013148", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013148" } ], "reference": [ { "type": "PubMed", "id": "18786931", "url": "https://glygen.org/publication/PubMed/18786931" } ] }, { "title": "Specificity of interactions between mDia isoforms and Rho proteins.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Lammers M, Meyer S, Kuhlmann D, Wittinghofer A", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "18829452", "url": "https://glygen.org/publication/PubMed/18829452" } ] }, { "title": "DOCK10-mediated Cdc42 activation is necessary for amoeboid invasion of melanoma cells.", "journal": "Current biology : CB", "date": "2008", "authors": "Gadea G, Sanz-Moreno V, Self A, Godi A, Marshall CJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013148", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013148" } ], "reference": [ { "type": "PubMed", "id": "18835169", "url": "https://glygen.org/publication/PubMed/18835169" } ] }, { "title": "FGD2, a CDC42-specific exchange factor expressed by antigen-presenting cells, localizes to early endosomes and active membrane ruffles.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Huber C, Martensson A, Bokoch GM, Nemazee D, Gavin AL", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "18838382", "url": "https://glygen.org/publication/PubMed/18838382" } ] }, { "title": "Dissecting the thermodynamics of GAP-RhoA interactions.", "journal": "Journal of structural biology", "date": "2009", "authors": "Jelen F, Lachowicz P, Apostoluk W, Mateja A, Derewenda ZS, Otlewski J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013148", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013148" } ], "reference": [ { "type": "PubMed", "id": "18929667", "url": "https://glygen.org/publication/PubMed/18929667" } ] }, { "title": "Silencing of D4-GDI inhibits growth and invasive behavior in MDA-MB-231 cells by activation of Rac-dependent p38 and JNK signaling.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Zhang Y, Rivera Rosado LA, Moon SY, Zhang B", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "19269969", "url": "https://glygen.org/publication/PubMed/19269969" } ] }, { "title": "Cdc42GAP, reactive oxygen species, and the vimentin network.", "journal": "American journal of physiology. Cell physiology", "date": "2009", "authors": "Li QF, Spinelli AM, Tang DD", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "19494238", "url": "https://glygen.org/publication/PubMed/19494238" } ] }, { "title": "The rho-guanine nucleotide exchange factor domain of obscurin activates rhoA signaling in skeletal muscle.", "journal": "Molecular biology of the cell", "date": "2009", "authors": "Ford-Speelman DL, Roche JA, Bowman AL, Bloch RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "19605563", "url": "https://glygen.org/publication/PubMed/19605563" } ] }, { "title": "Regulation of mitotic spindle formation by the RhoA guanine nucleotide exchange factor ARHGEF10.", "journal": "BMC cell biology", "date": "2009", "authors": "Aoki T, Ueda S, Kataoka T, Satoh T", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "19635168", "url": "https://glygen.org/publication/PubMed/19635168" } ] }, { "title": "Regulation of the substrate preference of p190RhoGAP by protein kinase C-mediated phosphorylation of a phospholipid binding site.", "journal": "Biochemistry", "date": "2009", "authors": "Levay M, Settleman J, Ligeti E", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "19673492", "url": "https://glygen.org/publication/PubMed/19673492" } ] }, { "title": "Regulation of immature dendritic cell migration by RhoA guanine nucleotide exchange factor Arhgef5.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Wang Z, Kumamoto Y, Wang P, Gan X, Lehmann D, Smrcka AV, Cohn L, Iwasaki A, Li L, Wu D", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "19713215", "url": "https://glygen.org/publication/PubMed/19713215" } ] }, { "title": "Mutation of ARHGAP9 in patients with coronary spastic angina.", "journal": "Journal of human genetics", "date": "2010", "authors": "Takefuji M, Asano H, Mori K, Amano M, Kato K, Watanabe T, Morita Y, Katsumi A, Itoh T, Takenawa T, Hirashiki A, Izawa H, Nagata K, Hirayama H, Takatsu F, Naoe T, Yokota M, Kaibuchi K", "evidence": [ { "database": "RefSeq", "id": "NP_078881", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_078881" } ], "reference": [ { "type": "PubMed", "id": "19911011", "url": "https://glygen.org/publication/PubMed/19911011" } ] }, { "title": "The Rho-family GEF Asef2 activates Rac to modulate adhesion and actin dynamics and thereby regulate cell migration.", "journal": "Journal of cell science", "date": "2009", "authors": "Bristow JM, Sellers MH, Majumdar D, Anderson B, Hu L, Webb DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "19934221", "url": "https://glygen.org/publication/PubMed/19934221" } ] }, { "title": "[PI3-kinase mediates activity of RhoA and interaction of RhoA with mDia1 in thrombin-induced platelet aggregation].", "journal": "Zhongguo shi yan xue ye xue za zhi", "date": "2009", "authors": "Gao GX, Dong HJ, Gu HT, Gao Y, Pan YZ, Yang Y, Chen XQ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "20030946", "url": "https://glygen.org/publication/PubMed/20030946" } ] }, { "title": "Formin-like 2 drives amoeboid invasive cell motility downstream of RhoC.", "journal": "Oncogene", "date": "2010", "authors": "Kitzing TM, Wang Y, Pertz O, Copeland JW, Grosse R", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "20101212", "url": "https://glygen.org/publication/PubMed/20101212" } ] }, { "title": "Regulation of Rho GTPase crosstalk, degradation and activity by RhoGDI1.", "journal": "Nature cell biology", "date": "2010", "authors": "Boulter E, Garcia-Mata R, Guilluy C, Dubash A, Rossi G, Brennwald PJ, Burridge K", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "20400958", "url": "https://glygen.org/publication/PubMed/20400958" } ] }, { "title": "Focal-adhesion targeting links caveolin-1 to a Rac1-degradation pathway.", "journal": "Journal of cell science", "date": "2010", "authors": "Nethe M, Anthony EC, Fernandez-Borja M, Dee R, Geerts D, Hensbergen PJ, Deelder AM, Schmidt G, Hordijk PL", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "20460433", "url": "https://glygen.org/publication/PubMed/20460433" } ] }, { "title": "RhoA and DIAPH1 mediate adrenocorticotropin-stimulated cortisol biosynthesis by regulating mitochondrial trafficking.", "journal": "Endocrinology", "date": "2010", "authors": "Li D, Sewer MB", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "20591975", "url": "https://glygen.org/publication/PubMed/20591975" } ] }, { "title": "Gankyrin plays an essential role in Ras-induced tumorigenesis through regulation of the RhoA/ROCK pathway in mammalian cells.", "journal": "The Journal of clinical investigation", "date": "2010", "authors": "Man JH, Liang B, Gu YX, Zhou T, Li AL, Li T, Jin BF, Bai B, Zhang HY, Zhang WN, Li WH, Gong WL, Li HY, Zhang XM", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "20628200", "url": "https://glygen.org/publication/PubMed/20628200" } ] }, { "title": "Rho and anillin-dependent control of mDia2 localization and function in cytokinesis.", "journal": "Molecular biology of the cell", "date": "2010", "authors": "Watanabe S, Okawa K, Miki T, Sakamoto S, Morinaga T, Segawa K, Arakawa T, Kinoshita M, Ishizaki T, Narumiya S", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "20660154", "url": "https://glygen.org/publication/PubMed/20660154" } ] }, { "title": "Ephexin4 and EphA2 mediate cell migration through a RhoG-dependent mechanism.", "journal": "The Journal of cell biology", "date": "2010", "authors": "Hiramoto-Yamaki N, Takeuchi S, Ueda S, Harada K, Fujimoto S, Negishi M, Katoh H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "20679435", "url": "https://glygen.org/publication/PubMed/20679435" } ] }, { "title": "srGAP2 arginine methylation regulates cell migration and cell spreading through promoting dimerization.", "journal": "The Journal of biological chemistry", "date": "2010", "authors": "Guo S, Bao S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "20810653", "url": "https://glygen.org/publication/PubMed/20810653" } ] }, { "title": "Bi-modal regulation of a formin by srGAP2.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Mason FM, Heimsath EG, Higgs HN, Soderling SH", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "21148482", "url": "https://glygen.org/publication/PubMed/21148482" } ] }, { "title": "Mutational analysis reveals a single binding interface between RhoA and its effector, PRK1.", "journal": "Biochemistry", "date": "2011", "authors": "Hutchinson CL, Lowe PN, McLaughlin SH, Mott HR, Owen D", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "21351730", "url": "https://glygen.org/publication/PubMed/21351730" } ] }, { "title": "Mechanistic insights into specificity, activity, and regulatory elements of the regulator of G-protein signaling (RGS)-containing Rho-specific guanine nucleotide exchange factors (GEFs) p115, PDZ-RhoGEF (PRG), and leukemia-associated RhoGEF (LARG).", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Jaiswal M, Gremer L, Dvorsky R, Haeusler LC, Cirstea IC, Uhlenbrock K, Ahmadian MR", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "21454492", "url": "https://glygen.org/publication/PubMed/21454492" } ] }, { "title": "The Rac1 exchange factor Dock5 is essential for bone resorption by osteoclasts.", "journal": "Journal of bone and mineral research : the official journal of the American Society for Bone and Mineral Research", "date": "2011", "authors": "Vives V, Laurin M, Cres G, Larrousse P, Morichaud Z, Noel D, Cote JF, Blangy A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "21542010", "url": "https://glygen.org/publication/PubMed/21542010" } ] }, { "title": "ARHGAP30 is a Wrch-1-interacting protein involved in actin dynamics and cell adhesion.", "journal": "Biochemical and biophysical research communications", "date": "2011", "authors": "Naji L, Pacholsky D, Aspenstrom P", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "21565175", "url": "https://glygen.org/publication/PubMed/21565175" } ] }, { "title": "Multiple factors confer specific Cdc42 and Rac protein activation by dedicator of cytokinesis (DOCK) nucleotide exchange factors.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Kulkarni K, Yang J, Zhang Z, Barford D", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "21613211", "url": "https://glygen.org/publication/PubMed/21613211" } ] }, { "title": "RasGRF suppresses Cdc42-mediated tumour cell movement, cytoskeletal dynamics and transformation.", "journal": "Nature cell biology", "date": "2011", "authors": "Calvo F, Sanz-Moreno V, Agudo-Ibanez L, Wallberg F, Sahai E, Marshall CJ, Crespo P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013148", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013148" } ], "reference": [ { "type": "PubMed", "id": "21685891", "url": "https://glygen.org/publication/PubMed/21685891" } ] }, { "title": "Enhancement of mDia2 activity by Rho-kinase-dependent phosphorylation of the diaphanous autoregulatory domain.", "journal": "The Biochemical journal", "date": "2011", "authors": "Staus DP, Taylor JM, Mack CP", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "21699497", "url": "https://glygen.org/publication/PubMed/21699497" } ] }, { "title": "The IQGAP1 protein is a calmodulin-regulated barbed end capper of actin filaments: possible implications in its function in cell migration.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Pelikan-Conchaudron A, Le Clainche C, Didry D, Carlier MF", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "21730051", "url": "https://glygen.org/publication/PubMed/21730051" } ] }, { "title": "ARHGAP18, a GTPase-activating protein for RhoA, controls cell shape, spreading, and motility.", "journal": "Molecular biology of the cell", "date": "2011", "authors": "Maeda M, Hasegawa H, Hyodo T, Ito S, Asano E, Yuang H, Funasaka K, Shimokata K, Hasegawa Y, Hamaguchi M, Senga T", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "21865595", "url": "https://glygen.org/publication/PubMed/21865595" } ] }, { "title": "The hematopoietic cell-specific Rho GTPase inhibitor ARHGDIB/D4GDI limits HIV type 1 replication.", "journal": "AIDS research and human retroviruses", "date": "2012", "authors": "Watanabe T, Urano E, Miyauchi K, Ichikawa R, Hamatake M, Misawa N, Sato K, Ebina H, Koyanagi Y, Komano J", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "21936715", "url": "https://glygen.org/publication/PubMed/21936715" } ] }, { "title": "Dysregulation of Rho GTPases in the alphaPix/Arhgef6 mouse model of X-linked intellectual disability is paralleled by impaired structural and synaptic plasticity and cognitive deficits.", "journal": "Human molecular genetics", "date": "2012", "authors": "Ramakers GJ, Wolfer D, Rosenberger G, Kuchenbecker K, Kreienkamp HJ, Prange-Kiel J, Rune G, Richter K, Langnaese K, Masneuf S, Bosl MR, Fischer KD, Krugers HJ, Lipp HP, van Galen E, Kutsche K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "21989057", "url": "https://glygen.org/publication/PubMed/21989057" } ] }, { "title": "Detection of Rho GEF and GAP activity through a sensitive split luciferase assay system.", "journal": "The Biochemical journal", "date": "2012", "authors": "Anderson EL, Hamann MJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "22004470", "url": "https://glygen.org/publication/PubMed/22004470" } ] }, { "title": "ARHGAP25, a novel Rac GTPase-activating protein, regulates phagocytosis in human neutrophilic granulocytes.", "journal": "Blood", "date": "2012", "authors": "Csepanyi-Komi R, Sirokmany G, Geiszt M, Ligeti E", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "22096251", "url": "https://glygen.org/publication/PubMed/22096251" } ] }, { "title": "The GRAF family member oligophrenin1 is a RhoGAP with BAR domain and regulates Rho GTPases in platelets.", "journal": "Cardiovascular research", "date": "2012", "authors": "Elvers M, Beck S, Fotinos A, Ziegler M, Gawaz M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "22298643", "url": "https://glygen.org/publication/PubMed/22298643" } ] }, { "title": "Myosin-IXA regulates collective epithelial cell migration by targeting RhoGAP activity to cell-cell junctions.", "journal": "Current biology : CB", "date": "2012", "authors": "Omelchenko T, Hall A", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "22305756", "url": "https://glygen.org/publication/PubMed/22305756" } ] }, { "title": "RAC1 activation mediates Twist1-induced cancer cell migration.", "journal": "Nature cell biology", "date": "2012", "authors": "Yang WH, Lan HY, Huang CH, Tai SK, Tzeng CH, Kao SY, Wu KJ, Hung MC, Yang MH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "22407364", "url": "https://glygen.org/publication/PubMed/22407364" } ] }, { "title": "DOCK8 is a Cdc42 activator critical for interstitial dendritic cell migration during immune responses.", "journal": "Blood", "date": "2012", "authors": "Harada Y, Tanaka Y, Terasawa M, Pieczyk M, Habiro K, Katakai T, Hanawa-Suetsugu K, Kukimoto-Niino M, Nishizaki T, Shirouzu M, Duan X, Uruno T, Nishikimi A, Sanematsu F, Yokoyama S, Stein JV, Kinashi T, Fukui Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013148", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013148" } ], "reference": [ { "type": "PubMed", "id": "22461490", "url": "https://glygen.org/publication/PubMed/22461490" } ] }, { "title": "Dock7: a GEF for Rho-family GTPases and a novel myosin VI-binding partner in neuronal PC12 cells.", "journal": "Biochemistry and cell biology = Biochimie et biologie cellulaire", "date": "2012", "authors": "Majewski L, Sobczak M, Havrylov S, Jozwiak J, Redowicz MJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "22475431", "url": "https://glygen.org/publication/PubMed/22475431" } ] }, { "title": "Cdc42 and the guanine nucleotide exchange factors Ect2 and trio mediate Fn14-induced migration and invasion of glioblastoma cells.", "journal": "Molecular cancer research : MCR", "date": "2012", "authors": "Fortin SP, Ennis MJ, Schumacher CA, Zylstra-Diegel CR, Williams BO, Ross JT, Winkles JA, Loftus JC, Symons MH, Tran NL", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013148", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013148" } ], "reference": [ { "type": "PubMed", "id": "22571869", "url": "https://glygen.org/publication/PubMed/22571869" } ] }, { "title": "FMNL2 drives actin-based protrusion and migration downstream of Cdc42.", "journal": "Current biology : CB", "date": "2012", "authors": "Block J, Breitsprecher D, Kuhn S, Winterhoff M, Kage F, Geffers R, Duwe P, Rohn JL, Baum B, Brakebusch C, Geyer M, Stradal TE, Faix J, Rottner K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "22608513", "url": "https://glygen.org/publication/PubMed/22608513" } ] }, { "title": "Divergence of Rho residue 43 impacts GEF activity.", "journal": "Small GTPases", "date": "2012", "authors": "Sloan CM, Quinn CV, Peters JP, Farley J, Goetzinger C, Wernli M, DeMali KA, Ellerbroek SM", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "22673745", "url": "https://glygen.org/publication/PubMed/22673745" } ] }, { "title": "Dock3 regulates BDNF-TrkB signaling for neurite outgrowth by forming a ternary complex with Elmo and RhoG.", "journal": "Genes to cells : devoted to molecular & cellular mechanisms", "date": "2012", "authors": "Namekata K, Watanabe H, Guo X, Kittaka D, Kawamura K, Kimura A, Harada C, Harada T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "22734669", "url": "https://glygen.org/publication/PubMed/22734669" } ] }, { "title": "Identification of a novel actin-binding domain within the Rho guanine nucleotide exchange factor TEM4.", "journal": "PloS one", "date": "2012", "authors": "Mitin N, Rossman KL, Der CJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "22911862", "url": "https://glygen.org/publication/PubMed/22911862" } ] }, { "title": "Serine-71 phosphorylation of Rac1 modulates downstream signaling.", "journal": "PloS one", "date": "2012", "authors": "Schwarz J, Proff J, Havemeier A, Ladwein M, Rottner K, Barlag B, Pich A, Tatge H, Just I, Gerhard R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "22970203", "url": "https://glygen.org/publication/PubMed/22970203" } ] }, { "title": "Rho isoform-specific interaction with IQGAP1 promotes breast cancer cell proliferation and migration.", "journal": "The Journal of biological chemistry", "date": "2012", "authors": "Casteel DE, Turner S, Schwappacher R, Rangaswami H, Su-Yuo J, Zhuang S, Boss GR, Pilz RB", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "22992742", "url": "https://glygen.org/publication/PubMed/22992742" } ] }, { "title": "ARHGAP21 is a RhoGAP for RhoA and RhoC with a role in proliferation and migration of prostate adenocarcinoma cells.", "journal": "Biochimica et biophysica acta", "date": "2013", "authors": "Lazarini M, Traina F, Machado-Neto JA, Barcellos KS, Moreira YB, Brandao MM, Verjovski-Almeida S, Ridley AJ, Saad ST", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "23200924", "url": "https://glygen.org/publication/PubMed/23200924" } ] }, { "title": "The novel synaptogenic protein Farp1 links postsynaptic cytoskeletal dynamics and transsynaptic organization.", "journal": "The Journal of cell biology", "date": "2012", "authors": "Cheadle L, Biederer T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "23209303", "url": "https://glygen.org/publication/PubMed/23209303" } ] }, { "title": "Deciphering the molecular and functional basis of Dbl family proteins: a novel systematic approach toward classification of selective activation of the Rho family proteins.", "journal": "The Journal of biological chemistry", "date": "2013", "authors": "Jaiswal M, Dvorsky R, Ahmadian MR", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "23255595", "url": "https://glygen.org/publication/PubMed/23255595" } ] }, { "title": "Kalirin promotes neointimal hyperplasia by activating Rac in smooth muscle cells.", "journal": "Arteriosclerosis, thrombosis, and vascular biology", "date": "2013", "authors": "Wu JH, Fanaroff AC, Sharma KC, Smith LS, Brian L, Eipper BA, Mains RE, Freedman NJ, Zhang L", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "23288169", "url": "https://glygen.org/publication/PubMed/23288169" } ] }, { "title": "Reelin and the Cdc42/Rac1 guanine nucleotide exchange factor alphaPIX/Arhgef6 promote dendritic Golgi translocation in hippocampal neurons.", "journal": "The European journal of neuroscience", "date": "2013", "authors": "Meseke M, Rosenberger G, Forster E", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013148", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013148" } ], "reference": [ { "type": "PubMed", "id": "23406282", "url": "https://glygen.org/publication/PubMed/23406282" } ] }, { "title": "ARHGDIA: a novel gene implicated in nephrotic syndrome.", "journal": "Journal of medical genetics", "date": "2013", "authors": "Gupta IR, Baldwin C, Auguste D, Ha KC, El Andalousi J, Fahiminiya S, Bitzan M, Bernard C, Akbari MR, Narod SA, Rosenblatt DS, Majewski J, Takano T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013148", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013148" } ], "reference": [ { "type": "PubMed", "id": "23434736", "url": "https://glygen.org/publication/PubMed/23434736" } ] }, { "title": "Plekhg4 is a novel Dbl family guanine nucleotide exchange factor protein for rho family GTPases.", "journal": "The Journal of biological chemistry", "date": "2013", "authors": "Gupta M, Kamynina E, Morley S, Chung S, Muakkassa N, Wang H, Brathwaite S, Sharma G, Manor D", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "23572525", "url": "https://glygen.org/publication/PubMed/23572525" } ] }, { "title": "ARF1 controls Rac1 signaling to regulate migration of MDA-MB-231 invasive breast cancer cells.", "journal": "Cellular signalling", "date": "2013", "authors": "Lewis-Saravalli S, Campbell S, Claing A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "23707487", "url": "https://glygen.org/publication/PubMed/23707487" } ] }, { "title": "Prenylation and membrane localization of Cdc42 are essential for activation by DOCK7.", "journal": "Biochemistry", "date": "2013", "authors": "Zhou Y, Johnson JL, Cerione RA, Erickson JW", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "23718289", "url": "https://glygen.org/publication/PubMed/23718289" } ] }, { "title": "Vaccinia virus F11 promotes viral spread by acting as a PDZ-containing scaffolding protein to bind myosin-9A and inhibit RhoA signaling.", "journal": "Cell host & microbe", "date": "2013", "authors": "Handa Y, Durkin CH, Dodding MP, Way M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "23870313", "url": "https://glygen.org/publication/PubMed/23870313" } ] }, { "title": "RasGRF2 Rac-GEF activity couples NMDA receptor calcium flux to enhanced synaptic transmission.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2013", "authors": "Schwechter B, Rosenmund C, Tolias KF", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "23940355", "url": "https://glygen.org/publication/PubMed/23940355" } ] }, { "title": "The human minor histocompatibility antigen 1 is a RhoGAP.", "journal": "PloS one", "date": "2013", "authors": "de Kreuk BJ, Schaefer A, Anthony EC, Tol S, Fernandez-Borja M, Geerts D, Pool J, Hambach L, Goulmy E, Hordijk PL", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "24086303", "url": "https://glygen.org/publication/PubMed/24086303" } ] }, { "title": "Differential binding of RhoA, RhoB, and RhoC to protein kinase C-related kinase (PRK) isoforms PRK1, PRK2, and PRK3: PRKs have the highest affinity for RhoB.", "journal": "Biochemistry", "date": "2013", "authors": "Hutchinson CL, Lowe PN, McLaughlin SH, Mott HR, Owen D", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "24128008", "url": "https://glygen.org/publication/PubMed/24128008" } ] }, { "title": "The RhoGAP ARHGAP19 controls cytokinesis and chromosome segregation in T lymphocytes.", "journal": "Journal of cell science", "date": "2014", "authors": "David MD, Petit D, Bertoglio J", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "24259668", "url": "https://glygen.org/publication/PubMed/24259668" } ] }, { "title": "The smooth muscle-selective RhoGAP GRAF3 is a critical regulator of vascular tone and hypertension.", "journal": "Nature communications", "date": "2013", "authors": "Bai X, Lenhart KC, Bird KE, Suen AA, Rojas M, Kakoki M, Li F, Smithies O, Mack CP, Taylor JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "24335996", "url": "https://glygen.org/publication/PubMed/24335996" } ] }, { "title": "Rho-GTPase-activating protein interacting with Cdc-42-interacting protein 4 homolog 2 (Rich2): a new Ras-related C3 botulinum toxin substrate 1 (Rac1) GTPase-activating protein that controls dendritic spine morphogenesis.", "journal": "The Journal of biological chemistry", "date": "2014", "authors": "Raynaud F, Moutin E, Schmidt S, Dahl J, Bertaso F, Boeckers TM, Homburger V, Fagni L", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "24352656", "url": "https://glygen.org/publication/PubMed/24352656" } ] }, { "title": "Mechanism of IRSp53 inhibition and combinatorial activation by Cdc42 and downstream effectors.", "journal": "Nature structural & molecular biology", "date": "2014", "authors": "Kast DJ, Yang C, Disanza A, Boczkowska M, Madasu Y, Scita G, Svitkina T, Dominguez R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013148", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013148" } ], "reference": [ { "type": "PubMed", "id": "24584464", "url": "https://glygen.org/publication/PubMed/24584464" } ] }, { "title": "A Trio-Rac1-Pak1 signalling axis drives invadopodia disassembly.", "journal": "Nature cell biology", "date": "2014", "authors": "Moshfegh Y, Bravo-Cordero JJ, Miskolci V, Condeelis J, Hodgson L", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "24859002", "url": "https://glygen.org/publication/PubMed/24859002" } ] }, { "title": "ARHGAP22 localizes at endosomes and regulates actin cytoskeleton.", "journal": "PloS one", "date": "2014", "authors": "Mori M, Saito K, Ohta Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "24933155", "url": "https://glygen.org/publication/PubMed/24933155" } ] }, { "title": "Dynamic control of excitatory synapse development by a Rac1 GEF/GAP regulatory complex.", "journal": "Developmental cell", "date": "2014", "authors": "Um K, Niu S, Duman JG, Cheng JX, Tu YK, Schwechter B, Liu F, Hiles L, Narayanan AS, Ash RT, Mulherkar S, Alpadi K, Smirnakis SM, Tolias KF", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "24960694", "url": "https://glygen.org/publication/PubMed/24960694" } ] }, { "title": "Activation of Cdc42 is necessary for sustained oscillations of Ca2+ and PIP2 stimulated by antigen in RBL mast cells.", "journal": "Biology open", "date": "2014", "authors": "Wilkes MM, Wilson JD, Baird B, Holowka D", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013148", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013148" } ], "reference": [ { "type": "PubMed", "id": "24996924", "url": "https://glygen.org/publication/PubMed/24996924" } ] }, { "title": "Arhgap36-dependent activation of Gli transcription factors.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2014", "authors": "Rack PG, Ni J, Payumo AY, Nguyen V, Crapster JA, Hovestadt V, Kool M, Jones DT, Mich JK, Firestone AJ, Pfister SM, Cho YJ, Chen JK", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "25024229", "url": "https://glygen.org/publication/PubMed/25024229" } ] }, { "title": "Arhgap28 is a RhoGAP that inactivates RhoA and downregulates stress fibers.", "journal": "PloS one", "date": "2014", "authors": "Yeung CY, Taylor SH, Garva R, Holmes DF, Zeef LA, Soininen R, Boot-Handford RP, Kadler KE", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "25211221", "url": "https://glygen.org/publication/PubMed/25211221" } ] }, { "title": "CD147 promotes Src-dependent activation of Rac1 signaling through STAT3/DOCK8 during the motility of hepatocellular carcinoma cells.", "journal": "Oncotarget", "date": "2015", "authors": "Wang SJ, Cui HY, Liu YM, Zhao P, Zhang Y, Fu ZG, Chen ZN, Jiang JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "25428919", "url": "https://glygen.org/publication/PubMed/25428919" } ] }, { "title": "Identification of the GTPase-activating protein DEP domain containing 1B (DEPDC1B) as a transcriptional target of Pitx2.", "journal": "Experimental cell research", "date": "2015", "authors": "Wu D, Zhu X, Jimenez-Cowell K, Mold AJ, Sollecito CC, Lombana N, Jiao M, Wei Q", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "25704760", "url": "https://glygen.org/publication/PubMed/25704760" } ] }, { "title": "Human-specific gene ARHGAP11B promotes basal progenitor amplification and neocortex expansion.", "journal": "Science (New York, N.Y.)", "date": "2015", "authors": "Florio M, Albert M, Taverna E, Namba T, Brandl H, Lewitus E, Haffner C, Sykes A, Wong FK, Peters J, Guhr E, Klemroth S, Prufer K, Kelso J, Naumann R, Nusslein I, Dahl A, Lachmann R, Paabo S, Huttner WB", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "25721503", "url": "https://glygen.org/publication/PubMed/25721503" } ] }, { "title": "Rho guanine nucleotide exchange factors involved in cyclic-stretch-induced reorientation of vascular endothelial cells.", "journal": "Journal of cell science", "date": "2015", "authors": "Abiko H, Fujiwara S, Ohashi K, Hiatari R, Mashiko T, Sakamoto N, Sato M, Mizuno K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "25795300", "url": "https://glygen.org/publication/PubMed/25795300" } ] }, { "title": "Dock10, a Cdc42 and Rac1 GEF, induces loss of elongation, filopodia, and ruffles in cervical cancer epithelial HeLa cells.", "journal": "Biology open", "date": "2015", "authors": "Ruiz-Lafuente N, Alcaraz-Garcia MJ, Garcia-Serna AM, Sebastian-Ruiz S, Moya-Quiles MR, Garcia-Alonso AM, Parrado A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "25862245", "url": "https://glygen.org/publication/PubMed/25862245" } ] }, { "title": "The structure of FMNL2-Cdc42 yields insights into the mechanism of lamellipodia and filopodia formation.", "journal": "Nature communications", "date": "2015", "authors": "Kuhn S, Erdmann C, Kage F, Block J, Schwenkmezger L, Steffen A, Rottner K, Geyer M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013148", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013148" } ], "reference": [ { "type": "PubMed", "id": "25963737", "url": "https://glygen.org/publication/PubMed/25963737" } ] }, { "title": "A Rac/Cdc42 exchange factor complex promotes formation of lateral filopodia and blood vessel lumen morphogenesis.", "journal": "Nature communications", "date": "2015", "authors": "Abraham S, Scarcia M, Bagshaw RD, McMahon K, Grant G, Harvey T, Yeo M, Esteves FOG, Thygesen HH, Jones PF, Speirs V, Hanby AM, Selby PJ, Lorger M, Dear TN, Pawson T, Marshall CJ, Mavria G", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "26129894", "url": "https://glygen.org/publication/PubMed/26129894" } ] }, { "title": "The Formin FMNL3 Controls Early Apical Specification in Endothelial Cells by Regulating the Polarized Trafficking of Podocalyxin.", "journal": "Current biology : CB", "date": "2015", "authors": "Richards M, Hetheridge C, Mellor H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013148", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013148" } ], "reference": [ { "type": "PubMed", "id": "26299518", "url": "https://glygen.org/publication/PubMed/26299518" } ] }, { "title": "Annexin A2 Regulates Autophagy in Pseudomonas aeruginosa Infection through the Akt1-mTOR-ULK1/2 Signaling Pathway.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2015", "authors": "Li R, Tan S, Yu M, Jundt MC, Zhang S, Wu M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "26371245", "url": "https://glygen.org/publication/PubMed/26371245" } ] }, { "title": "Myo9b is a key player in SLIT/ROBO-mediated lung tumor suppression.", "journal": "The Journal of clinical investigation", "date": "2015", "authors": "Kong R, Yi F, Wen P, Liu J, Chen X, Ren J, Li X, Shang Y, Nie Y, Wu K, Fan D, Zhu L, Feng W, Wu JY", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "26529257", "url": "https://glygen.org/publication/PubMed/26529257" } ] }, { "title": "PAK6 targets to cell-cell adhesions through its N-terminus in a Cdc42-dependent manner to drive epithelial colony escape.", "journal": "Journal of cell science", "date": "2016", "authors": "Morse EM, Sun X, Olberding JR, Ha BH, Boggon TJ, Calderwood DA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013148", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013148" } ], "reference": [ { "type": "PubMed", "id": "26598554", "url": "https://glygen.org/publication/PubMed/26598554" } ] }, { "title": "Differential Rac1 signalling by guanine nucleotide exchange factors implicates FLII in regulating Rac1-driven cell migration.", "journal": "Nature communications", "date": "2016", "authors": "Marei H, Carpy A, Woroniuk A, Vennin C, White G, Timpson P, Macek B, Malliri A", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "26887924", "url": "https://glygen.org/publication/PubMed/26887924" } ] }, { "title": "Galpha13 Stimulates the Tyrosine Phosphorylation of Ric-8A.", "journal": "Journal of molecular signaling", "date": "2015", "authors": "Yan M, Ha JH, Dhanasekaran DN", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013148", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013148" } ], "reference": [ { "type": "PubMed", "id": "27096001", "url": "https://glygen.org/publication/PubMed/27096001" } ] }, { "title": "Oligophrenin1 protects mice against myocardial ischemia and reperfusion injury by modulating inflammation and myocardial apoptosis.", "journal": "Cellular signalling", "date": "2016", "authors": "Niermann C, Gorressen S, Klier M, Gowert NS, Billuart P, Kelm M, Merx MW, Elvers M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "27117132", "url": "https://glygen.org/publication/PubMed/27117132" } ] }, { "title": "ARHGEF15 overexpression worsens the prognosis in patients with pancreatic ductal adenocarcinoma through enhancing the motility and proliferative activity of the cancer cells.", "journal": "Molecular cancer", "date": "2016", "authors": "Fukushima H, Yasumoto M, Ogasawara S, Akiba J, Kitasato Y, Nakayama M, Naito Y, Ishida Y, Okabe Y, Yasunaga M, Horiuchi H, Sakamoto E, Itadani H, Mizuarai S, Oie S, Yano H", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "27145964", "url": "https://glygen.org/publication/PubMed/27145964" } ] }, { "title": "Rho GTPase Transcriptome Analysis Reveals Oncogenic Roles for Rho GTPase-Activating Proteins in Basal-like Breast Cancers.", "journal": "Cancer research", "date": "2016", "authors": "Lawson CD, Fan C, Mitin N, Baker NM, George SD, Graham DM, Perou CM, Burridge K, Der CJ, Rossman KL", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "27216196", "url": "https://glygen.org/publication/PubMed/27216196" } ] }, { "title": "Deciphering the Molecular and Functional Basis of RHOGAP Family Proteins: A SYSTEMATIC APPROACH TOWARD SELECTIVE INACTIVATION OF RHO FAMILY PROTEINS.", "journal": "The Journal of biological chemistry", "date": "2016", "authors": "Amin E, Jaiswal M, Derewenda U, Reis K, Nouri K, Koessmeier KT, Aspenstrom P, Somlyo AV, Dvorsky R, Ahmadian MR", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "27481945", "url": "https://glygen.org/publication/PubMed/27481945" } ] }, { "title": "PLEKHG3 enhances polarized cell migration by activating actin filaments at the cell front.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2016", "authors": "Nguyen TT, Park WS, Park BO, Kim CY, Oh Y, Kim JM, Choi H, Kyung T, Kim CH, Lee G, Hahn KM, Meyer T, Heo WD", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "27555588", "url": "https://glygen.org/publication/PubMed/27555588" } ] }, { "title": "Rac GTPase Activating Protein ARHGAP25 Regulates Leukocyte Transendothelial Migration in Mice.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2016", "authors": "Csepanyi-Komi R, Wisniewski E, Bartos B, Levai P, Nemeth T, Balazs B, Kurz AR, Bierschenk S, Sperandio M, Ligeti E", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "27566826", "url": "https://glygen.org/publication/PubMed/27566826" } ] }, { "title": "Disruption of ArhGAP15 results in hyperactive Rac1, affects the architecture and function of hippocampal inhibitory neurons and causes cognitive deficits.", "journal": "Scientific reports", "date": "2016", "authors": "Zamboni V, Armentano M, Saro G, Ciraolo E, Ghigo A, Germena G, Umbach A, Valnegri P, Passafaro M, Carabelli V, Gavello D, Bianchi V, D'Adamo P, de Curtis I, El-Assawi N, Mauro A, Priano L, Ferri N, Hirsch E, Merlo GR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "27713499", "url": "https://glygen.org/publication/PubMed/27713499" } ] }, { "title": "Heme drives hemolysis-induced susceptibility to infection via disruption of phagocyte functions.", "journal": "Nature immunology", "date": "2016", "authors": "Martins R, Maier J, Gorki AD, Huber KV, Sharif O, Starkl P, Saluzzo S, Quattrone F, Gawish R, Lakovits K, Aichinger MC, Radic-Sarikas B, Lardeau CH, Hladik A, Korosec A, Brown M, Vaahtomeri K, Duggan M, Kerjaschki D, Esterbauer H, Colinge J, Eisenbarth SC, Decker T, Bennett KL, Kubicek S, Sixt M, Superti-Furga G, Knapp S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013148", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013148" } ], "reference": [ { "type": "PubMed", "id": "27798618", "url": "https://glygen.org/publication/PubMed/27798618" } ] }, { "title": "SWAP70 Organizes the Actin Cytoskeleton and Is Essential for Phagocytosis.", "journal": "Cell reports", "date": "2016", "authors": "Baranov MV, Revelo NH, Dingjan I, Maraspini R, Ter Beest M, Honigmann A, van den Bogaart G", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "27806292", "url": "https://glygen.org/publication/PubMed/27806292" } ] }, { "title": "SOS1, ARHGEF1, and DOCK2 rho-GEFs Mediate JAK-Dependent LFA-1 Activation by Chemokines.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2017", "authors": "Toffali L, Montresor A, Mirenda M, Scita G, Laudanna C", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "27986909", "url": "https://glygen.org/publication/PubMed/27986909" } ] }, { "title": "LRCH1 interferes with DOCK8-Cdc42-induced T cell migration and ameliorates experimental autoimmune encephalomyelitis.", "journal": "The Journal of experimental medicine", "date": "2017", "authors": "Xu X, Han L, Zhao G, Xue S, Gao Y, Xiao J, Zhang S, Chen P, Wu ZY, Ding J, Hu R, Wei B, Wang H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013148", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013148" } ], "reference": [ { "type": "PubMed", "id": "28028151", "url": "https://glygen.org/publication/PubMed/28028151" } ] }, { "title": "Blood pressure-associated polymorphism controls ARHGAP42 expression via serum response factor DNA binding.", "journal": "The Journal of clinical investigation", "date": "2017", "authors": "Bai X, Mangum KD, Dee RA, Stouffer GA, Lee CR, Oni-Orisan A, Patterson C, Schisler JC, Viera AJ, Taylor JM, Mack CP", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "28112683", "url": "https://glygen.org/publication/PubMed/28112683" } ] }, { "title": "RhoGTPase Regulators Orchestrate Distinct Stages of Synaptic Development.", "journal": "PloS one", "date": "2017", "authors": "Martin-Vilchez S, Whitmore L, Asmussen H, Zareno J, Horwitz R, Newell-Litwa K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "28114311", "url": "https://glygen.org/publication/PubMed/28114311" } ] }, { "title": "Characterization of the activation of small GTPases by their GEFs on membranes using artificial membrane tethering.", "journal": "The Biochemical journal", "date": "2017", "authors": "Peurois F, Veyron S, Ferrandez Y, Ladid I, Benabdi S, Zeghouf M, Peyroche G, Cherfils J", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "28196833", "url": "https://glygen.org/publication/PubMed/28196833" } ] }, { "title": "ARHGAP42 is activated by Src-mediated tyrosine phosphorylation to promote cell motility.", "journal": "Journal of cell science", "date": "2017", "authors": "Luo W, Janostiak R, Tolde O, Ryzhova LM, Koudelkova L, Dibus M, Brabek J, Hanks SK, Rosel D", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "28584191", "url": "https://glygen.org/publication/PubMed/28584191" } ] }, { "title": "An apical MRCK-driven morphogenetic pathway controls epithelial polarity.", "journal": "Nature cell biology", "date": "2017", "authors": "Zihni C, Vlassaks E, Terry S, Carlton J, Leung TKC, Olson M, Pichaud F, Balda MS, Matter K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013148", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013148" } ], "reference": [ { "type": "PubMed", "id": "28825699", "url": "https://glygen.org/publication/PubMed/28825699" } ] }, { "title": "A CDC42-centered signaling unit is a dominant positive regulator of endothelial integrity.", "journal": "Scientific reports", "date": "2017", "authors": "Amado-Azevedo J, Reinhard NR, van Bezu J, de Menezes RX, van Beusechem VW, van Nieuw Amerongen GP, van Hinsbergh VWM, Hordijk PL", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013148", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013148" } ], "reference": [ { "type": "PubMed", "id": "28860633", "url": "https://glygen.org/publication/PubMed/28860633" } ] }, { "title": "Allosteric inhibition of the guanine nucleotide exchange factor DOCK5 by a small molecule.", "journal": "Scientific reports", "date": "2017", "authors": "Ferrandez Y, Zhang W, Peurois F, Akendengue L, Blangy A, Zeghouf M, Cherfils J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "29089502", "url": "https://glygen.org/publication/PubMed/29089502" } ] }, { "title": "Cytokinesis requires localized beta-actin filament production by an actin isoform specific nucleator.", "journal": "Nature communications", "date": "2017", "authors": "Chen A, Arora PD, McCulloch CA, Wilde A", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "29146911", "url": "https://glygen.org/publication/PubMed/29146911" } ] }, { "title": "Unraveling the molecular mechanism of interactions of the Rho GTPases Cdc42 and Rac1 with the scaffolding protein IQGAP2.", "journal": "The Journal of biological chemistry", "date": "2018", "authors": "Ozdemir ES, Jang H, Gursoy A, Keskin O, Li Z, Sacks DB, Nussinov R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "29358323", "url": "https://glygen.org/publication/PubMed/29358323" } ] }, { "title": "ARHGEF39 promotes tumor progression via activation of Rac1/P38 MAPK/ATF2 signaling and predicts poor prognosis in non-small cell lung cancer patients.", "journal": "Laboratory investigation; a journal of technical methods and pathology", "date": "2018", "authors": "Zhou H, Cai L, Zhang X, Li A, Miao Y, Li Q, Qiu X, Wang E", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "29382922", "url": "https://glygen.org/publication/PubMed/29382922" } ] }, { "title": "FBP17 and CIP4 recruit SHIP2 and lamellipodin to prime the plasma membrane for fast endophilin-mediated endocytosis.", "journal": "Nature cell biology", "date": "2018", "authors": "Chan Wah Hak L, Khan S, Di Meglio I, Law AL, Lucken-Ardjomande Hasler S, Quintaneiro LM, Ferreira APA, Krause M, McMahon HT, Boucrot E", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013148", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013148" } ], "reference": [ { "type": "PubMed", "id": "30061681", "url": "https://glygen.org/publication/PubMed/30061681" } ] }, { "title": "Structural Basis for the Dual Substrate Specificity of DOCK7 Guanine Nucleotide Exchange Factor.", "journal": "Structure (London, England : 1993)", "date": "2019", "authors": "Kukimoto-Niino M, Tsuda K, Ihara K, Mishima-Tsumagari C, Honda K, Ohsawa N, Shirouzu M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "30853411", "url": "https://glygen.org/publication/PubMed/30853411" } ] }, { "title": "Anillin Promotes Cell Contractility by Cyclic Resetting of RhoA Residence Kinetics.", "journal": "Developmental cell", "date": "2019", "authors": "Budnar S, Husain KB, Gomez GA, Naghibosadat M, Varma A, Verma S, Hamilton NA, Morris RG, Yap AS", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "31105010", "url": "https://glygen.org/publication/PubMed/31105010" } ] }, { "title": "CXCL12 promotes human ovarian cancer cell invasion through suppressing ARHGAP10 expression.", "journal": "Biochemical and biophysical research communications", "date": "2019", "authors": "Luo N, Chen DD, Liu L, Li L, Cheng ZP", "evidence": [ { "database": "RefSeq", "id": "NP_078881", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_078881" } ], "reference": [ { "type": "PubMed", "id": "31445707", "url": "https://glygen.org/publication/PubMed/31445707" } ] }, { "title": "miR3373p inhibits gastric tumor metastasis by targeting ARHGAP10.", "journal": "Molecular medicine reports", "date": "2020", "authors": "Wang Z, Yao L, Li Y, Hao B, Wang M, Wang J, Gu W, Zhan H, Liu G, Wu Q", "evidence": [ { "database": "RefSeq", "id": "NP_078881", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_078881" } ], "reference": [ { "type": "PubMed", "id": "31789419", "url": "https://glygen.org/publication/PubMed/31789419" } ] }, { "title": "Mapping the proximity interaction network of the Rho-family GTPases reveals signalling pathways and regulatory mechanisms.", "journal": "Nature cell biology", "date": "2020", "authors": "Bagci H, Sriskandarajah N, Robert A, Boulais J, Elkholi IE, Tran V, Lin ZY, Thibault MP, Dube N, Faubert D, Hipfner DR, Gingras AC, Cote JF", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013148", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013148" } ], "reference": [ { "type": "PubMed", "id": "31871319", "url": "https://glygen.org/publication/PubMed/31871319" } ] }, { "title": "Systems analysis of RhoGEF and RhoGAP regulatory proteins reveals spatially organized RAC1 signalling from integrin adhesions.", "journal": "Nature cell biology", "date": "2020", "authors": "Muller PM, Rademacher J, Bagshaw RD, Wortmann C, Barth C, van Unen J, Alp KM, Giudice G, Eccles RL, Heinrich LE, Pascual-Vargas P, Sanchez-Castro M, Brandenburg L, Mbamalu G, Tucholska M, Spatt L, Czajkowski MT, Welke RW, Zhang S, Nguyen V, Rrustemi T, Trnka P, Freitag K, Larsen B, Popp O, Mertins P, Gingras AC, Roth FP, Colwill K, Bakal C, Pertz O, Pawson T, Petsalaki E, Rocks O", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "32203420", "url": "https://glygen.org/publication/PubMed/32203420" } ] }, { "title": "GRAF2, WDR44, and MICAL1 mediate Rab8/10/11-dependent export of E-cadherin, MMP14, and CFTR DeltaF508.", "journal": "The Journal of cell biology", "date": "2020", "authors": "Lucken-Ardjomande Hasler S, Vallis Y, Pasche M, McMahon HT", "evidence": [ { "database": "UniProtKB", "id": "A1A4S6", "url": "https://www.uniprot.org/uniprot/A1A4S6" }, { "database": "RefSeq", "id": "NP_078881", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_078881" } ], "reference": [ { "type": "PubMed", "id": "32344433", "url": "https://glygen.org/publication/PubMed/32344433" } ] }, { "title": "ARHGAP10, which encodes Rho GTPase-activating protein 10, is a novel gene for schizophrenia risk.", "journal": "Translational psychiatry", "date": "2020", "authors": "Sekiguchi M, Sobue A, Kushima I, Wang C, Arioka Y, Kato H, Kodama A, Kubo H, Ito N, Sawahata M, Hada K, Ikeda R, Shinno M, Mizukoshi C, Tsujimura K, Yoshimi A, Ishizuka K, Takasaki Y, Kimura H, Xing J, Yu Y, Yamamoto M, Okada T, Shishido E, Inada T, Nakatochi M, Takano T, Kuroda K, Amano M, Aleksic B, Yamomoto T, Sakuma T, Aida T, Tanaka K, Hashimoto R, Arai M, Ikeda M, Iwata N, Shimamura T, Nagai T, Nabeshima T, Kaibuchi K, Yamada K, Mori D, Ozaki N", "evidence": [ { "database": "RefSeq", "id": "NP_078881", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_078881" } ], "reference": [ { "type": "PubMed", "id": "32699248", "url": "https://glygen.org/publication/PubMed/32699248" } ] }, { "title": "Abr and Bcr are multifunctional regulators of the Rho GTP-binding protein family.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1995", "authors": "Chuang TH, Xu X, Kaartinen V, Heisterkamp N, Groffen J, Bokoch GM", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "7479768", "url": "https://glygen.org/publication/PubMed/7479768" } ] }, { "title": "Identification of a novel protein with GDP dissociation inhibitor activity for the ras-like proteins CDC42Hs and rac I.", "journal": "Genes, chromosomes & cancer", "date": "1993", "authors": "Adra CN, Ko J, Leonard D, Wirth LJ, Cerione RA, Lim B", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013148", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013148" } ], "reference": [ { "type": "PubMed", "id": "7512369", "url": "https://glygen.org/publication/PubMed/7512369" } ] }, { "title": "Molecular cloning of a new member of the p21-Cdc42/Rac-activated kinase (PAK) family.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Manser E, Chong C, Zhao ZS, Leung T, Michael G, Hall C, Lim L", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "7559638", "url": "https://glygen.org/publication/PubMed/7559638" } ] }, { "title": "Bridging Ral GTPase to Rho pathways. RLIP76, a Ral effector with CDC42/Rac GTPase-activating protein activity.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Jullien-Flores V, Dorseuil O, Romero F, Letourneur F, Saragosti S, Berger R, Tavitian A, Gacon G, Camonis JH", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "7673236", "url": "https://glygen.org/publication/PubMed/7673236" } ] }, { "title": "Direct involvement of the small GTP-binding protein Rho in lbc oncogene function.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Zheng Y, Olson MF, Hall A, Cerione RA, Toksoz D", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "7721814", "url": "https://glygen.org/publication/PubMed/7721814" } ] }, { "title": "A role for Rac in Tiam1-induced membrane ruffling and invasion.", "journal": "Nature", "date": "1995", "authors": "Michiels F, Habets GG, Stam JC, van der Kammen RA, Collard JG", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "7753201", "url": "https://glygen.org/publication/PubMed/7753201" } ] }, { "title": "A dual functional signal mediator showing RhoGAP and phospholipase C-delta stimulating activities.", "journal": "The EMBO journal", "date": "1995", "authors": "Homma Y, Emori Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "7835339", "url": "https://glygen.org/publication/PubMed/7835339" } ] }, { "title": "Breakpoint cluster region gene product-related domain of n-chimaerin. Discrimination between Rac-binding and GTPase-activating residues by mutational analysis.", "journal": "The Journal of biological chemistry", "date": "1994", "authors": "Ahmed S, Lee J, Wen LP, Zhao Z, Ho J, Best A, Kozma R, Lim L", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "8021274", "url": "https://glygen.org/publication/PubMed/8021274" } ] }, { "title": "A brain serine/threonine protein kinase activated by Cdc42 and Rac1.", "journal": "Nature", "date": "1994", "authors": "Manser E, Leung T, Salihuddin H, Zhao ZS, Lim L", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "8107774", "url": "https://glygen.org/publication/PubMed/8107774" } ] }, { "title": "p190-B, a new member of the Rho GAP family, and Rho are induced to cluster after integrin cross-linking.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Burbelo PD, Miyamoto S, Utani A, Brill S, Yamada KM, Hall A, Yamada Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "8537347", "url": "https://glygen.org/publication/PubMed/8537347" } ] }, { "title": "A novel partner for the GTP-bound forms of rho and rac.", "journal": "FEBS letters", "date": "1995", "authors": "Madaule P, Furuyashiki T, Reid T, Ishizaki T, Watanabe G, Morii N, Narumiya S", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "8543060", "url": "https://glygen.org/publication/PubMed/8543060" } ] }, { "title": "Protein kinase N (PKN) and PKN-related protein rhophilin as targets of small GTPase Rho.", "journal": "Science (New York, N.Y.)", "date": "1996", "authors": "Watanabe G, Saito Y, Madaule P, Ishizaki T, Fujisawa K, Morii N, Mukai H, Ono Y, Kakizuka A, Narumiya S", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "8571126", "url": "https://glygen.org/publication/PubMed/8571126" } ] }, { "title": "The small GTP-binding protein Rho binds to and activates a 160 kDa Ser/Thr protein kinase homologous to myotonic dystrophy kinase.", "journal": "The EMBO journal", "date": "1996", "authors": "Ishizaki T, Maekawa M, Fujisawa K, Okawa K, Iwamatsu A, Fujita A, Watanabe N, Saito Y, Kakizuka A, Morii N, Narumiya S", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "8617235", "url": "https://glygen.org/publication/PubMed/8617235" } ] }, { "title": "The multidomain protein Trio binds the LAR transmembrane tyrosine phosphatase, contains a protein kinase domain, and has separate rac-specific and rho-specific guanine nucleotide exchange factor domains.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1996", "authors": "Debant A, Serra-Pages C, Seipel K, O'Brien S, Tang M, Park SH, Streuli M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "8643598", "url": "https://glygen.org/publication/PubMed/8643598" } ] }, { "title": "Rac GTPase interacts specifically with phosphatidylinositol 3-kinase.", "journal": "The Biochemical journal", "date": "1996", "authors": "Bokoch GM, Vlahos CJ, Wang Y, Knaus UG, Traynor-Kaplan AE", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "8645157", "url": "https://glygen.org/publication/PubMed/8645157" } ] }, { "title": "An SH3 domain-containing GTPase-activating protein for Rho and Cdc42 associates with focal adhesion kinase.", "journal": "Molecular and cellular biology", "date": "1996", "authors": "Hildebrand JD, Taylor JM, Parsons JT", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "8649427", "url": "https://glygen.org/publication/PubMed/8649427" } ] }, { "title": "Rhotekin, a new putative target for Rho bearing homology to a serine/threonine kinase, PKN, and rhophilin in the rho-binding domain.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Reid T, Furuyashiki T, Ishizaki T, Watanabe G, Watanabe N, Fujisawa K, Morii N, Madaule P, Narumiya S", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "8662891", "url": "https://glygen.org/publication/PubMed/8662891" } ] }, { "title": "IQGAP1, a calmodulin-binding protein with a rasGAP-related domain, is a potential effector for cdc42Hs.", "journal": "The EMBO journal", "date": "1996", "authors": "Hart MJ, Callow MG, Souza B, Polakis P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013148", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013148" } ], "reference": [ { "type": "PubMed", "id": "8670801", "url": "https://glygen.org/publication/PubMed/8670801" } ] }, { "title": "The Ras GTPase-activating-protein-related human protein IQGAP2 harbors a potential actin binding domain and interacts with calmodulin and Rho family GTPases.", "journal": "Molecular and cellular biology", "date": "1996", "authors": "Brill S, Li S, Lyman CW, Church DM, Wasmuth JJ, Weissbach L, Bernards A, Snijders AJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "8756646", "url": "https://glygen.org/publication/PubMed/8756646" } ] }, { "title": "Interaction of the Rho family small G proteins with kinectin, an anchoring protein of kinesin motor.", "journal": "Biochemical and biophysical research communications", "date": "1996", "authors": "Hotta K, Tanaka K, Mino A, Kohno H, Takai Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013148", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013148" } ], "reference": [ { "type": "PubMed", "id": "8769096", "url": "https://glygen.org/publication/PubMed/8769096" } ] }, { "title": "Identification of IQGAP as a putative target for the small GTPases, Cdc42 and Rac1.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Kuroda S, Fukata M, Kobayashi K, Nakafuku M, Nomura N, Iwamatsu A, Kaibuchi K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "8798539", "url": "https://glygen.org/publication/PubMed/8798539" } ] }, { "title": "Two GTPases, Cdc42 and Rac, bind directly to a protein implicated in the immunodeficiency disorder Wiskott-Aldrich syndrome.", "journal": "Current biology : CB", "date": "1996", "authors": "Aspenstrom P, Lindberg U, Hall A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "8805223", "url": "https://glygen.org/publication/PubMed/8805223" } ] }, { "title": "Rho proteins are localized with different membrane compartments involved in vesicular trafficking in anterior pituitary cells.", "journal": "Molecular and cellular endocrinology", "date": "1996", "authors": "Cussac D, Leblanc P, L'Heritier A, Bertoglio J, Lang P, Kordon C, Enjalbert A, Saltarelli D", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "8807639", "url": "https://glygen.org/publication/PubMed/8807639" } ] }, { "title": "Identification of a novel guanine nucleotide exchange factor for the Rho GTPase.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Hart MJ, Sharma S, elMasry N, Qiu RG, McCabe P, Polakis P, Bollag G", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "8810315", "url": "https://glygen.org/publication/PubMed/8810315" } ] }, { "title": "The p160 RhoA-binding kinase ROK alpha is a member of a kinase family and is involved in the reorganization of the cytoskeleton.", "journal": "Molecular and cellular biology", "date": "1996", "authors": "Leung T, Chen XQ, Manser E, Lim L", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "8816443", "url": "https://glygen.org/publication/PubMed/8816443" } ] }, { "title": "RhoGDI-3 is a new GDP dissociation inhibitor (GDI). Identification of a non-cytosolic GDI protein interacting with the small GTP-binding proteins RhoB and RhoG.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Zalcman G, Closson V, Camonis J, Honore N, Rousseau-Merck MF, Tavitian A, Olofsson B", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "8939998", "url": "https://glygen.org/publication/PubMed/8939998" } ] }, { "title": "Phosphotyrosine-dependent activation of Rac-1 GDP/GTP exchange by the vav proto-oncogene product.", "journal": "Nature", "date": "1997", "authors": "Crespo P, Schuebel KE, Ostrom AA, Gutkind JS, Bustelo XR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "8990121", "url": "https://glygen.org/publication/PubMed/8990121" } ] }, { "title": "Faciogenital dysplasia protein (FGD1) and Vav, two related proteins required for normal embryonic development, are upstream regulators of Rho GTPases.", "journal": "Current biology : CB", "date": "1996", "authors": "Olson MF, Pasteris NG, Gorski JL, Hall A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "8994827", "url": "https://glygen.org/publication/PubMed/8994827" } ] }, { "title": "Characterization of two alternately spliced forms of phospholipase D1. Activation of the purified enzymes by phosphatidylinositol 4,5-bisphosphate, ADP-ribosylation factor, and Rho family monomeric GTP-binding proteins and protein kinase C-alpha.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Hammond SM, Jenco JM, Nakashima S, Cadwallader K, Gu Q, Cook S, Nozawa Y, Prestwich GD, Frohman MA, Morris AJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "9013646", "url": "https://glygen.org/publication/PubMed/9013646" } ] }, { "title": "Tyrosine phosphorylation of the vav proto-oncogene product links FcepsilonRI to the Rac1-JNK pathway.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Teramoto H, Salem P, Robbins KC, Bustelo XR, Gutkind JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "9099726", "url": "https://glygen.org/publication/PubMed/9099726" } ] }, { "title": "Cloning, expression, and characterization of a novel phospholipase D complementary DNA from rat brain.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Kodaki T, Yamashita S", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "9111050", "url": "https://glygen.org/publication/PubMed/9111050" } ] }, { "title": "RhoGDIgamma: a GDP-dissociation inhibitor for Rho proteins with preferential expression in brain and pancreas.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1997", "authors": "Adra CN, Manor D, Ko JL, Zhu S, Horiuchi T, Van Aelst L, Cerione RA, Lim B", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013148", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013148" } ], "reference": [ { "type": "PubMed", "id": "9113980", "url": "https://glygen.org/publication/PubMed/9113980" } ] }, { "title": "Characterization of the interactions between the small GTPase Cdc42 and its GTPase-activating proteins and putative effectors. Comparison of kinetic properties of Cdc42 binding to the Cdc42-interactive domains.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Zhang B, Wang ZX, Zheng Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013148", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013148" } ], "reference": [ { "type": "PubMed", "id": "9268338", "url": "https://glygen.org/publication/PubMed/9268338" } ] }, { "title": "A novel GTPase-activating protein for Rho interacts with a PDZ domain of the protein-tyrosine phosphatase PTPL1.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Saras J, Franzen P, Aspenstrom P, Hellman U, Gonez LJ, Heldin CH", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "9305890", "url": "https://glygen.org/publication/PubMed/9305890" } ] }, { "title": "WIP, a protein associated with wiskott-aldrich syndrome protein, induces actin polymerization and redistribution in lymphoid cells.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1997", "authors": "Ramesh N, Anton IM, Hartwig JH, Geha RS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013148", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013148" } ], "reference": [ { "type": "PubMed", "id": "9405671", "url": "https://glygen.org/publication/PubMed/9405671" } ] }, { "title": "Myotonic dystrophy kinase-related Cdc42-binding kinase acts as a Cdc42 effector in promoting cytoskeletal reorganization.", "journal": "Molecular and cellular biology", "date": "1998", "authors": "Leung T, Chen XQ, Tan I, Manser E, Lim L", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "9418861", "url": "https://glygen.org/publication/PubMed/9418861" } ] }, { "title": "Coupling of Ras and Rac guanosine triphosphatases through the Ras exchanger Sos.", "journal": "Science (New York, N.Y.)", "date": "1998", "authors": "Nimnual AS, Yatsula BA, Bar-Sagi D", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "9438849", "url": "https://glygen.org/publication/PubMed/9438849" } ] }, { "title": "Human myosin-IXb is a mechanochemically active motor and a GAP for rho.", "journal": "Journal of cell science", "date": "1998", "authors": "Post PL, Bokoch GM, Mooseker MS", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "9490638", "url": "https://glygen.org/publication/PubMed/9490638" } ] }, { "title": "MgcRacGAP, a new human GTPase-activating protein for Rac and Cdc42 similar to Drosophila rotundRacGAP gene product, is expressed in male germ cells.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Toure A, Dorseuil O, Morin L, Timmons P, Jegou B, Reibel L, Gacon G", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "9497316", "url": "https://glygen.org/publication/PubMed/9497316" } ] }, { "title": "Analysis of RhoA-binding proteins reveals an interaction domain conserved in heterotrimeric G protein beta subunits and the yeast response regulator protein Skn7.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Alberts AS, Bouquin N, Johnston LH, Treisman R", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "9535835", "url": "https://glygen.org/publication/PubMed/9535835" } ] }, { "title": "Regulation of RhoA GTP hydrolysis by the GTPase-activating proteins p190, p50RhoGAP, Bcr, and 3BP-1.", "journal": "Biochemistry", "date": "1998", "authors": "Zhang B, Zheng Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "9548756", "url": "https://glygen.org/publication/PubMed/9548756" } ] }, { "title": "Oligophrenin-1 encodes a rhoGAP protein involved in X-linked mental retardation.", "journal": "Nature", "date": "1998", "authors": "Billuart P, Bienvenu T, Ronce N, des Portes V, Vinet MC, Zemni R, Roest Crollius H, Carrie A, Fauchereau F, Cherry M, Briault S, Hamel B, Fryns JP, Beldjord C, Kahn A, Moraine C, Chelly J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "9582072", "url": "https://glygen.org/publication/PubMed/9582072" } ] }, { "title": "PAK kinases are directly coupled to the PIX family of nucleotide exchange factors.", "journal": "Molecular cell", "date": "1998", "authors": "Manser E, Loo TH, Koh CG, Zhao ZS, Chen XQ, Tan L, Tan I, Leung T, Lim L", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "9659915", "url": "https://glygen.org/publication/PubMed/9659915" } ] }, { "title": "Activation of RhoA and SAPK/JNK signalling pathways by the RhoA-specific exchange factor mNET1.", "journal": "The EMBO journal", "date": "1998", "authors": "Alberts AS, Treisman R", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "9670022", "url": "https://glygen.org/publication/PubMed/9670022" } ] }, { "title": "Citron rho-interacting kinase, a novel tissue-specific ser/thr kinase encompassing the Rho-Rac-binding protein Citron.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Di Cunto F, Calautti E, Hsiao J, Ong L, Topley G, Turco E, Dotto GP", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "9792683", "url": "https://glygen.org/publication/PubMed/9792683" } ] }, { "title": "PAK4, a novel effector for Cdc42Hs, is implicated in the reorganization of the actin cytoskeleton and in the formation of filopodia.", "journal": "The EMBO journal", "date": "1998", "authors": "Abo A, Qu J, Cammarano MS, Dan C, Fritsch A, Baud V, Belisle B, Minden A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "9822598", "url": "https://glygen.org/publication/PubMed/9822598" } ] }, { "title": "Phosphorylation-dependent and constitutive activation of Rho proteins by wild-type and oncogenic Vav-2.", "journal": "The EMBO journal", "date": "1998", "authors": "Schuebel KE, Movilla N, Rosa JL, Bustelo XR", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "9822605", "url": "https://glygen.org/publication/PubMed/9822605" } ] }, { "title": "Dimerization via tandem leucine zippers is essential for the activation of the mitogen-activated protein kinase kinase kinase, MLK-3.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Leung IW, Lassam N", "evidence": [ { "database": "Reactome", "id": "R-HSA-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692" } ], "reference": [ { "type": "PubMed", "id": "9829970", "url": "https://glygen.org/publication/PubMed/9829970" } ] }, { "title": "WAVE, a novel WASP-family protein involved in actin reorganization induced by Rac.", "journal": "The EMBO journal", "date": "1998", "authors": "Miki H, Suetsugu S, Takenawa T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "9843499", "url": "https://glygen.org/publication/PubMed/9843499" } ] }, { "title": "Structures of Cdc42 bound to the active and catalytically compromised forms of Cdc42GAP.", "journal": "Nature structural biology", "date": "1998", "authors": "Nassar N, Hoffman GR, Manor D, Clardy JC, Cerione RA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013148", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013148" } ], "reference": [ { "type": "PubMed", "id": "9846874", "url": "https://glygen.org/publication/PubMed/9846874" } ] }, { "title": "Loop 6 of RhoA confers specificity for effector binding, stress fiber formation, and cellular transformation.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Zong H, Raman N, Mickelson-Young LA, Atkinson SJ, Quilliam LA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "9988689", "url": "https://glygen.org/publication/PubMed/9988689" } ] } ], "pathway": [ { "id": "hsa:79658", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:79658", "resource": "KEGG Pathway" }, { "id": "R-HSA-211728", "name": "Regulation of PAK-2p34 activity by PS-GAP/RHG10", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211728", "resource": "Reactome", "description": "Regulation of PAK-2p34 activity by PS-GAP/RHG10" }, { "id": "R-HSA-8980692", "name": "RHOA GTPase cycle", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8980692", "resource": "Reactome", "description": "RHOA GTPase cycle" }, { "id": "R-HSA-9013148", "name": "CDC42 GTPase cycle", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013148", "resource": "Reactome", "description": "CDC42 GTPase cycle" }, { "id": "R-HSA-9013149", "name": "RAC1 GTPase cycle", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149", "resource": "Reactome", "description": "RAC1 GTPase cycle" } ], "orthologs": [ { "uniprot_canonical_ac": "D4AB50-1", "protein_name": "Rho GTPase activating protein 10", "gene_name": "Arhgap10", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MGLQPLEFSDCYLDSPWFRERIRAHEAELERTNKFIKELIKDGKNLIAATKSLSAAQRKFAHSLRDFKFEFIGDAETDDERCIDASLREFSNFLKNLEEQREIMALSVTETLIKPLEKFRKEQLGAEEKKKFDKETERNYSLIDKHLTLSARKKDTHLQEADLQVEQNRQHFYELSLEYVCKLQEIQERKKFEFVEPMLSFFQGMFTFYHQGHELSKDFNHYKTELQINIQNTRNRFEGTRSEVEELMNKIRQNPKDQKRASQFTAEGYLYVQEKRPAPFGSSWVKHYCMYRKTAKKFNMIPFEHRSGGKLGDGEAFFLKECTKRHIDSTDRRFCFDIEAADRPGVPLTVQAFSEEERKQWLEALGGKEALFHTFNRAIVPRPEGGAQLDKMGFTILRKCISAVETRGINDQGLYRVVGVSSKVQRLLSMLMDVKTCNELDLENSTDWEVKTVTSALKQYLRSLPEPLMTYELHRDFIVPAKSGSPESRVSAIHFLVHKLPEKNKEMLDILVKHLTNVSSHSKQNLMTVANLGVVFGPTLMRPQEETVAAIMDLKFQNIVVEILIENHEKIFRTSPDTTFAEPTCLSASPPNAPPRQSKRQGQRTKRPVAVYNLCLELEEGDSPSPLKEDPPSSSQDSLSTPSPTTSAAHGPPGPDGNHLAADRGNCGDATATTPSQTRPSMVQWLNMQSPTTPSSNPAGTPPSPRMSPFPLSPAASIVDKLPECLINRKARAVYPCEAEHSSELSFEIGAIFEDVQTSREPGWLEGTLNGKRGLIPQNYVKLL", "length": 784 }, "evidence": [ { "id": "45926550", "url": "http://www.informatics.jax.org/homology/45926550", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q6Y5D8-1", "protein_name": "Rho GTPase-activating protein 10", "gene_name": "Arhgap10", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MGLQPLEFSDCYLDSPWFRERIRAHEAELERTNKFIKELIKDGKNLISATKSLSAAQRKFAHSLRDFKFEFIGDAETDDERCIDASLREFSNFLKNLEEQREIMALSVTETLIKPLEKFRKEQLGAVKEEKKKFDKETEKNYSLIDKHLTLSARKKDSHLQEADLQVEQNRQHFYELSLEYVCKLQEIQERKKFEFVEPMLSFFQGMFTFYHQGHELSKDFNHYKMELQINIQNTRNRFEGTRSEVEELMNKIRQNPKDQKRASQFTAEGYLYVQEKRPAPFGSSWVKHYCMYRKTAKKFNMIPFEHRSGGKLGDGEAFFLKECTKRHMDSTDRRFCFDIEAADRPGVPLTVQAFSEEERKQWLEALGGKEALFHTFNRAIVPRPEGGAQLDKMGFTILRKCISAVETRGINDQGLYRVVGVSSKVQRLLSMLMDVKMCNELDLENSADWEVKTVTSALKQYLRSLPEPLMTYELHRDFIVPAKSGSPESRVNAIHFLVHKLPEKNKEMLDILVKHLTNVSSHSKQNLMTVANLGVVFGPTLMRPQEETVAAIMDLKFQNIVVEILIENHEKIFRTSPDTTFAEPTCLSASPPNAPPRQSKRQGQRTKRPVAVYNLCLELEEGDSPSPLKEDPPSSSQDSLSTPSPTTSAAHGPPGLDGNHLAADGGSCGDATATTPSQTRPSMVQWLNMQSPTTPSSNPAGTPPSPRMSPFPLSPAASIVDKLPECVINRKARAVYPCEAEHSSELSFEIGAIFEDVQTSREPGWLEGTLNGKRGLIPQNYVKLL", "length": 786 }, "evidence": [ { "id": "45926550", "url": "http://www.informatics.jax.org/homology/45926550", "database": "MGI" }, { "id": "A1A4S6", "url": "https://omabrowser.org/oma/group/A1A4S6/", "database": "OMA" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "GTPase activator activity", "id": "GO:0005096", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005096", "evidence": [ { "database": "UniProtKB", "id": "A1A4S6", "url": "https://www.uniprot.org/uniprot/A1A4S6" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 4, "go_terms": [ { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "A1A4S6", "url": "https://www.uniprot.org/uniprot/A1A4S6" } ], "pmid": "" }, { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "A1A4S6", "url": "https://www.uniprot.org/uniprot/A1A4S6" } ], "pmid": "" }, { "name": "perinuclear region of cytoplasm", "id": "GO:0048471", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048471", "evidence": [ { "database": "UniProtKB", "id": "A1A4S6", "url": "https://www.uniprot.org/uniprot/A1A4S6" } ], "pmid": "" }, { "name": "endosome membrane", "id": "GO:0010008", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010008", "evidence": [ { "database": "UniProtKB", "id": "A1A4S6", "url": "https://www.uniprot.org/uniprot/A1A4S6" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 4, "go_terms": [ { "name": "signal transduction", "id": "GO:0007165", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007165", "evidence": [ { "database": "UniProtKB", "id": "A1A4S6", "url": "https://www.uniprot.org/uniprot/A1A4S6" } ], "pmid": "" }, { "name": "negative regulation of apoptotic process", "id": "GO:0043066", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043066", "evidence": [ { "database": "UniProtKB", "id": "A1A4S6", "url": "https://www.uniprot.org/uniprot/A1A4S6" } ], "pmid": "" }, { "name": "regulation of small GTPase mediated signal transduction", "id": "GO:0051056", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051056", "evidence": [ { "database": "UniProtKB", "id": "A1A4S6", "url": "https://www.uniprot.org/uniprot/A1A4S6" } ], "pmid": "" }, { "name": "cytoskeleton organization", "id": "GO:0007010", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007010", "evidence": [ { "database": "UniProtKB", "id": "A1A4S6", "url": "https://www.uniprot.org/uniprot/A1A4S6" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 141, "end_pos": 143, "annotation": "n_glycosylation_sequon" }, { "start_pos": 150, "end_pos": 152, "annotation": "n_glycosylation_sequon" }, { "start_pos": 519, "end_pos": 521, "annotation": "n_glycosylation_sequon" }, { "start_pos": 522, "end_pos": 524, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "Phosphorylated. Phosphorylated in vitro by constitutive active PKN3.", "evidence": [ { "database": "UniProtKB", "id": "A1A4S6", "url": "https://www.uniprot.org/uniprot/A1A4S6" }, { "database": "PubMed", "id": "11432776", "url": "https://glygen.org/publication/PubMed/11432776" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 141, "end_pos": 143 }, { "start_pos": 150, "end_pos": 152 }, { "start_pos": 519, "end_pos": 521 }, { "start_pos": 522, "end_pos": 524 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 310 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }