{ "uniprot_canonical_ac": "A0A286ZP59-1", "uniprot_ac": "A0A286ZP59", "uniprot_id": "A0A286ZP59_PIG", "mass": { "chemical_mass": 37033.0, "monoisotopic_mass": 37033.0 }, "refseq": { "ac": "XP_003124270", "name": "olfactory receptor 2T3-like", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_003124270" }, "gene_names": [ { "name": "LOC100516426", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A0A286ZP59", "id": "A0A286ZP59" }, { "name": "LOC100516426", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_003124270", "id": "XP_003124270" } ], "protein_names": [ { "name": "Olfactory receptor", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprotkb/A0A286ZP59/entry#names_and_taxonomy", "id": "A0A286ZP59" }, { "name": "olfactory receptor 2T3-like", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_003124270", "id": "XP_003124270" } ], "function": [ { "annotation": "Putative odorant or sperm cell receptor.", "evidence": [ { "database": "UniProtKB", "id": "A0A286ZP59", "url": "https://www.uniprot.org/uniprot/A0A286ZP59#function" }, { "database": "UniProtKB", "id": "ARBA00003929", "url": "https://www.uniprot.org/uniprot/ARBA00003929#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Sus scrofa", "taxid": 9823, "evidence": [ { "database": "UniProtKB", "id": "A0A286ZP59", "url": "https://www.uniprot.org/uniprot/A0A286ZP59" } ], "common_name": "Pig", "glygen_name": "Pig", "reference_species": "Sus scrofa [9823]" } ], "gene": [ { "name": "LOC100516426", "url": "https://www.uniprot.org/uniprot/A0A286ZP59", "locus": { "chromosome": "2", "start_pos": 52779942, "end_pos": 52780922, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSSSCG00000038039", "url": "https://www.ensembl.org/id/ENSSSCG00000038039" } ] } } ], "crossref": [ { "id": "cd15421", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd15421", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "100516426", "url": "https://www.ncbi.nlm.nih.gov/gene/100516426", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR000276", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000276", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR000725", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000725", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR017452", "url": "https://www.ebi.ac.uk/interpro/entry/IPR017452", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "ssc:100516426", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+ssc:100516426", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "MIMYLCC", "url": "https://omabrowser.org/oma/group/MIMYLCC/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "3784606at2759", "url": "http://www.orthodb.org/?query=3784606at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR26453", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR26453", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR26453:SF4", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR26453:SF4", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF13853", "url": "http://pfam.xfam.org/family/PF13853", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "XP_003124270", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_003124270", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A286ZP59", "url": "https://www.uniprot.org/uniprot/A0A286ZP59", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A286ZP59-1", "url": "https://www.uniprot.org/uniprot/A0A286ZP59-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MYSLYQNSQNQTSNADFILVGLFGETRHSILLYTVVFIFFLMALAGNTLLLILIHVEPRLHTPMYFFISQLSLMDLLYISVTVPKMLMSQVTGDHKISPSGCGIQMFFYLTLAGAEFFLLSAMAYDRYAAICRPLHYPLLMNLRVCVCLVSGCWFLGMIDGLLLTPITMSFPFCHSRKILSFFCEAPALLKLSCSDISLYKMLMYLCCVLMLLLPIMIISSSYTLILWLIHRMSSSESRRKAFATCSSHMIVVLLFFGAAIYTYMLPGSYHTAEQDMRVSTFYTIITPVLNPLIYSFRNKDVTEALKSRMPSGLCFRKAVKGKTQE", "length": 326, "header": "tr|A0A286ZP59-1|A0A286ZP59_PIG Isoform 1 of Olfactory receptor OS=Sus scrofa OX=9823 GN=LOC100516426 PE=3 SV=1 CANONICAL=A0A286ZP59-1" }, "isoforms": [ { "isoform_ac": "A0A286ZP59-1", "url": "https://www.uniprot.org/uniprotkb/A0A286ZP59/entry#A0A286ZP59-1", "sequence": { "sequence": "MYSLYQNSQNQTSNADFILVGLFGETRHSILLYTVVFIFFLMALAGNTLLLILIHVEPRLHTPMYFFISQLSLMDLLYISVTVPKMLMSQVTGDHKISPSGCGIQMFFYLTLAGAEFFLLSAMAYDRYAAICRPLHYPLLMNLRVCVCLVSGCWFLGMIDGLLLTPITMSFPFCHSRKILSFFCEAPALLKLSCSDISLYKMLMYLCCVLMLLLPIMIISSSYTLILWLIHRMSSSESRRKAFATCSSHMIVVLLFFGAAIYTYMLPGSYHTAEQDMRVSTFYTIITPVLNPLIYSFRNKDVTEALKSRMPSGLCFRKAVKGKTQE", "length": 326, "header": "tr|A0A286ZP59-1|A0A286ZP59_PIG Isoform 1 of Olfactory receptor OS=Sus scrofa OX=9823 GN=LOC100516426 PE=3 SV=1 CANONICAL=A0A286ZP59-1" }, "locus": {} } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [ { "id": "ssc:100516426", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+ssc:100516426", "resource": "KEGG Pathway" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "G protein-coupled receptor activity", "id": "GO:0004930", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004930", "evidence": [ { "database": "UniProtKB", "id": "A0A286ZP59", "url": "https://www.uniprot.org/uniprot/A0A286ZP59" } ], "pmid": "" }, { "name": "olfactory receptor activity", "id": "GO:0004984", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004984", "evidence": [ { "database": "UniProtKB", "id": "A0A286ZP59", "url": "https://www.uniprot.org/uniprot/A0A286ZP59" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "A0A286ZP59", "url": "https://www.uniprot.org/uniprot/A0A286ZP59" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "detection of chemical stimulus involved in sensory perception of smell", "id": "GO:0050911", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050911", "evidence": [ { "database": "UniProtKB", "id": "A0A286ZP59", "url": "https://www.uniprot.org/uniprot/A0A286ZP59" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 10, "end_pos": 12, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 10, "end_pos": 12 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }