{ "uniprot_canonical_ac": "P13473-1", "uniprot_ac": "P13473", "uniprot_id": "LAMP2_HUMAN", "mass": { "chemical_mass": 44961.0, "monoisotopic_mass": 44961.0 }, "refseq": { "ac": "NP_001116078", "name": "lysosome-associated membrane glycoprotein 2 isoform C precursor", "summary": "The protein encoded by this gene is a member of a family of membrane glycoproteins. This glycoprotein provides selectins with carbohydrate ligands. It may play a role in tumor cell metastasis. It may also function in the protection, maintenance, and adhesion of the lysosome. Alternative splicing of this gene results in multiple transcript variants encoding distinct proteins. [provided by RefSeq, Jul 2008].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001116078" }, "gene_names": [ { "name": "LAMP2", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P13473", "id": "P13473" }, { "name": "CD107b; DND; LAMP-2; LAMPB; LGP-96; LGP110", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001116078", "id": "NP_001116078" }, { "name": "LAMP2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001116078", "id": "NP_001116078" } ], "protein_names": [ { "name": "Lysosome-associated membrane glycoprotein 2", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P13473" }, { "name": "CD107 antigen-like family member B", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P13473" }, { "name": "LAMP-2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P13473" }, { "name": "LGP-96", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P13473" }, { "name": "Lysosome-associated membrane protein 2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P13473" }, { "name": "lysosome-associated membrane glycoprotein 2 isoform C precursor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001116078", "id": "NP_001116078" }, { "name": "lysosome-associated membrane glycoprotein 2; CD107 antigen-like family member B", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001116078", "id": "NP_001116078" } ], "function": [ { "annotation": "(Microbial infection) Supports the FURIN-mediated cleavage of mumps virus fusion protein F by interacting with both FURIN and the unprocessed form but not the processed form of the viral protein F.", "evidence": [ { "database": "UniProtKB", "id": "P13473", "url": "https://www.uniprot.org/uniprot/P13473#function" }, { "database": "PubMed", "id": "32295904", "url": "https://glygen.org/publication/PubMed/32295904" } ] }, { "annotation": "Danon Disease: Entire LAMP2 Gene Deletion with Unusual Clinical Presentation-Case Report and Review of the Literature. Review article Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_001116078", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001116078" }, { "database": "PubMed", "id": "37628591", "url": "https://glygen.org/publication/PubMed/37628591" } ] }, { "annotation": "Identification and functional analysis of a novel de novo missense mutation located in the initiation codon of LAMP2 associated with early onset female Danon disease.", "evidence": [ { "database": "RefSeq", "id": "NP_001116078", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001116078" }, { "database": "PubMed", "id": "37288668", "url": "https://glygen.org/publication/PubMed/37288668" } ] }, { "annotation": "Identification of a novel splicing-altering LAMP2 variant in a Chinese family with Danon disease.", "evidence": [ { "database": "RefSeq", "id": "NP_001116078", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001116078" }, { "database": "PubMed", "id": "37277924", "url": "https://glygen.org/publication/PubMed/37277924" } ] }, { "annotation": "Lysosomal LAMP proteins regulate lysosomal pH by direct inhibition of the TMEM175 channel.", "evidence": [ { "database": "RefSeq", "id": "NP_001116078", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001116078" }, { "database": "PubMed", "id": "37390818", "url": "https://glygen.org/publication/PubMed/37390818" } ] }, { "annotation": "Lysosomal membrane glycoprotein which plays an important role in lysosome biogenesis, lysosomal pH regulation and autophagy (PubMed:8662539, PubMed:11082038, PubMed:18644871, PubMed:24880125, PubMed:27628032, PubMed:36586411, PubMed:37390818). Acts as an important regulator of lysosomal lumen pH regulation by acting as a direct inhibitor of the proton channel TMEM175, facilitating lysosomal acidification for optimal hydrolase activity (PubMed:37390818). Plays an important role in chaperone-mediated autophagy, a process that mediates lysosomal degradation of proteins in response to various stresses and as part of the normal turnover of proteins with a long biological half-live (PubMed:8662539, PubMed:11082038, PubMed:18644871, PubMed:24880125, PubMed:27628032, PubMed:36586411). Functions by binding target proteins, such as GAPDH, NLRP3 and MLLT11, and targeting them for lysosomal degradation (PubMed:8662539, PubMed:11082038, PubMed:18644871, PubMed:24880125, PubMed:36586411). In the chaperone-mediated autophagy, acts downstream of chaperones, such as HSPA8/HSC70, which recognize and bind substrate proteins and mediate their recruitment to lysosomes, where target proteins bind LAMP2 (PubMed:36586411). Plays a role in lysosomal protein degradation in response to starvation (By similarity). Required for the fusion of autophagosomes with lysosomes during autophagy (PubMed:27628032). Cells that lack LAMP2 express normal levels of VAMP8, but fail to accumulate STX17 on autophagosomes, which is the most likely explanation for the lack of fusion between autophagosomes and lysosomes (PubMed:27628032). Required for normal degradation of the contents of autophagosomes (PubMed:27628032). Required for efficient MHC class II-mediated presentation of exogenous antigens via its function in lysosomal protein degradation; antigenic peptides generated by proteases in the endosomal/lysosomal compartment are captured by nascent MHC II subunits (PubMed:20518820, PubMed:15894275). Is not required for efficient MHC class II-mediated presentation of endogenous antigens (PubMed:20518820).", "evidence": [ { "database": "UniProtKB", "id": "P13473", "url": "https://www.uniprot.org/uniprot/P13473#function" }, { "database": "PubMed", "id": "27628032", "url": "https://glygen.org/publication/PubMed/27628032" }, { "database": "PubMed", "id": "8662539", "url": "https://glygen.org/publication/PubMed/8662539" }, { "database": "UniProtKB", "id": "P17046", "url": "https://www.uniprot.org/uniprot/P17046#function" }, { "database": "PubMed", "id": "20518820", "url": "https://glygen.org/publication/PubMed/20518820" }, { "database": "PubMed", "id": "24880125", "url": "https://glygen.org/publication/PubMed/24880125" }, { "database": "PubMed", "id": "11082038", "url": "https://glygen.org/publication/PubMed/11082038" }, { "database": "PubMed", "id": "18644871", "url": "https://glygen.org/publication/PubMed/18644871" }, { "database": "PubMed", "id": "36586411", "url": "https://glygen.org/publication/PubMed/36586411" }, { "database": "PubMed", "id": "37390818", "url": "https://glygen.org/publication/PubMed/37390818" }, { "database": "PubMed", "id": "15894275", "url": "https://glygen.org/publication/PubMed/15894275" } ] }, { "annotation": "Modulates chaperone-mediated autophagy. Decreases presentation of endogenous antigens by MHCII. Does not play a role in the presentation of exogenous and membrane-derived antigens by MHCII.", "evidence": [ { "database": "UniProtKB", "id": "P13473", "url": "https://www.uniprot.org/uniprot/P13473#function" }, { "database": "PubMed", "id": "26856698", "url": "https://glygen.org/publication/PubMed/26856698" } ] }, { "annotation": "The protein encoded by this gene is a member of a family of membrane glycoproteins. This glycoprotein provides selectins with carbohydrate ligands. It may play a role in tumor cell metastasis. It may also function in the protection, maintenance, and adhesion of the lysosome. Alternative splicing of this gene results in multiple transcript variants encoding distinct proteins. [provided by RefSeq, Jul 2008].", "evidence": [ { "database": "RefSeq", "id": "NP_001116078", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001116078" } ] } ], "disease": [ { "disease_id": "DOID:0050437", "recommended_name": { "id": "DOID:0050437", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050437", "name": "Danon disease", "description": "A lysosomal storage disease that is characterized by cardiomyopathy, skeletal myopathy and intellectual disability and has_material_basis_in mutations in the LAMP2 gene." }, "synonyms": [ { "id": "DOID:0050437", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050437", "name": "ANTOPOL DISEASE", "description": "" }, { "id": "DOID:0050437", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050437", "name": "PSEUDOGLYCOGENOSIS II", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "Danon disease", "description": "A lysosomal glycogen storage disease characterized by severe cardiomyopathy and variable degrees of muscle weakness, frequently associated with intellectual deficit." }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "ANTOPOL disease", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "Danon disease", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "Danon disease, X-linked dominant", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "GSD due to LAMP-2 deficiency", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "LAMP2 lysosomal glycogen storage disease", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "glycogen storage disease type IIb", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "glycogenosis due to LAMP-2 deficiency", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "lysosomal glycogen storage disease caused by mutation in LAMP2", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "lysosomal glycogen storage disease with normal acid maltase activity", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "pseudoglycogenosis II", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "Antopol disease", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "GSD IIb", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "GSD IIb, formerly", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "GSD2B (formerly)", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "X-linked vacuolar cardiomyopathy and myopathy", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "glycogen storage cardiomyopathy", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "glycogen storage disease IIb", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "glycogen storage disease due to LAMP-2 deficiency", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "glycogen storage disease limited to the heart", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "glycogen storage disease type 2b (formerly)", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "lysosomal glycogen storage disease without acid maltase deficiency", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "lysosomal glycogen storage disease without acid maltase deficiency (formerly)", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "lysosomal glycogen storage disease without acid maltase deficiency, formerly", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "pseudoglycogenosis 2", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "vacuolar cardiomyopathy and myopathy X-linked", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "vacuolar cardiomyopathy and myopathy, X-linked", "description": "" }, { "id": "MIM:300257", "resource": "MIM", "url": "https://www.omim.org/entry/300257", "name": "Danon disease", "description": "Danon disease" } ], "evidence": [ { "id": "300257", "database": "MIM", "url": "https://www.omim.org/entry/300257" } ] } ], "snv": [ { "evidence": [ { "id": "rs1033442580", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1033442580" }, { "id": "rs1033442580", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1033442580#frequency_tab" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 194, "end_pos": 194, "sequence_org": "T", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (TST->NST); o-glyco-site-loss (T->N).", "chr_id": "X", "chr_pos": "120448001", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T194", "disease": [ { "disease_id": "DOID:0050437", "recommended_name": { "id": "DOID:0050437", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050437", "name": "Danon disease", "description": "A lysosomal storage disease that is characterized by cardiomyopathy, skeletal myopathy and intellectual disability and has_material_basis_in mutations in the LAMP2 gene." }, "synonyms": [ { "id": "DOID:0050437", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050437", "name": "ANTOPOL DISEASE", "description": "" }, { "id": "DOID:0050437", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050437", "name": "PSEUDOGLYCOGENOSIS II", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "Danon disease", "description": "A lysosomal glycogen storage disease characterized by severe cardiomyopathy and variable degrees of muscle weakness, frequently associated with intellectual deficit." }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "ANTOPOL disease", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "Danon disease", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "Danon disease, X-linked dominant", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "GSD due to LAMP-2 deficiency", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "LAMP2 lysosomal glycogen storage disease", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "glycogen storage disease type IIb", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "glycogenosis due to LAMP-2 deficiency", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "lysosomal glycogen storage disease caused by mutation in LAMP2", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "lysosomal glycogen storage disease with normal acid maltase activity", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "pseudoglycogenosis II", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "Antopol disease", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "GSD IIb", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "GSD IIb, formerly", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "GSD2B (formerly)", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "X-linked vacuolar cardiomyopathy and myopathy", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "glycogen storage cardiomyopathy", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "glycogen storage disease IIb", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "glycogen storage disease due to LAMP-2 deficiency", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "glycogen storage disease limited to the heart", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "glycogen storage disease type 2b (formerly)", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "lysosomal glycogen storage disease without acid maltase deficiency", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "lysosomal glycogen storage disease without acid maltase deficiency (formerly)", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "lysosomal glycogen storage disease without acid maltase deficiency, formerly", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "pseudoglycogenosis 2", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "vacuolar cardiomyopathy and myopathy X-linked", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "vacuolar cardiomyopathy and myopathy, X-linked", "description": "" }, { "id": "MIM:300257", "resource": "MIM", "url": "https://www.omim.org/entry/300257", "name": "Danon disease", "description": "Danon disease" } ] } ], "keywords": [ "ebi", "germline", "disease" ] }, { "evidence": [ { "id": "rs1185408747", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1185408747" }, { "id": "rs1185408747", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1185408747" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 358, "end_pos": 358, "sequence_org": "T", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->NVA); o-glyco-site-loss (T->A).", "chr_id": "X", "chr_pos": "120441751", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T358", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1439172573", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1439172573" }, { "id": "rs1439172573", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1439172573" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 101, "end_pos": 101, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NFT->TFT).", "chr_id": "X", "chr_pos": "120446411", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N101", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs730880480", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs730880480" }, { "id": "rs730880480", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs730880480" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 122, "end_pos": 122, "sequence_org": "D", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (DNT->NNT).", "chr_id": "X", "chr_pos": "120455390", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "D122", "disease": [ { "disease_id": "DOID:0050437", "recommended_name": { "id": "DOID:0050437", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050437", "name": "Danon disease", "description": "A lysosomal storage disease that is characterized by cardiomyopathy, skeletal myopathy and intellectual disability and has_material_basis_in mutations in the LAMP2 gene." }, "synonyms": [ { "id": "DOID:0050437", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050437", "name": "ANTOPOL DISEASE", "description": "" }, { "id": "DOID:0050437", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050437", "name": "PSEUDOGLYCOGENOSIS II", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "Danon disease", "description": "A lysosomal glycogen storage disease characterized by severe cardiomyopathy and variable degrees of muscle weakness, frequently associated with intellectual deficit." }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "ANTOPOL disease", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "Danon disease", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "Danon disease, X-linked dominant", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "GSD due to LAMP-2 deficiency", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "LAMP2 lysosomal glycogen storage disease", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "glycogen storage disease type IIb", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "glycogenosis due to LAMP-2 deficiency", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "lysosomal glycogen storage disease caused by mutation in LAMP2", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "lysosomal glycogen storage disease with normal acid maltase activity", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "pseudoglycogenosis II", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "Antopol disease", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "GSD IIb", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "GSD IIb, formerly", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "GSD2B (formerly)", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "X-linked vacuolar cardiomyopathy and myopathy", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "glycogen storage cardiomyopathy", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "glycogen storage disease IIb", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "glycogen storage disease due to LAMP-2 deficiency", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "glycogen storage disease limited to the heart", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "glycogen storage disease type 2b (formerly)", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "lysosomal glycogen storage disease without acid maltase deficiency", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "lysosomal glycogen storage disease without acid maltase deficiency (formerly)", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "lysosomal glycogen storage disease without acid maltase deficiency, formerly", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "pseudoglycogenosis 2", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "vacuolar cardiomyopathy and myopathy X-linked", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "vacuolar cardiomyopathy and myopathy, X-linked", "description": "" }, { "id": "MIM:300257", "resource": "MIM", "url": "https://www.omim.org/entry/300257", "name": "Danon disease", "description": "Danon disease" } ] } ], "keywords": [ "ebi", "germline", "disease" ] }, { "evidence": [ { "id": "rs143699208", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs143699208" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 123, "end_pos": 123, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTT->DTT).", "chr_id": "X", "chr_pos": "120446346", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N123", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs397516747", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs397516747" }, { "id": "rs397516747", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs397516747#frequency_tab" }, { "id": "rs397516747", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs397516747" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 123, "end_pos": 123, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTT->STT).", "chr_id": "X", "chr_pos": "120446345", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N123", "disease": [ { "disease_id": "DOID:0050437", "recommended_name": { "id": "DOID:0050437", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050437", "name": "Danon disease", "description": "A lysosomal storage disease that is characterized by cardiomyopathy, skeletal myopathy and intellectual disability and has_material_basis_in mutations in the LAMP2 gene." }, "synonyms": [ { "id": "DOID:0050437", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050437", "name": "ANTOPOL DISEASE", "description": "" }, { "id": "DOID:0050437", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050437", "name": "PSEUDOGLYCOGENOSIS II", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "Danon disease", "description": "A lysosomal glycogen storage disease characterized by severe cardiomyopathy and variable degrees of muscle weakness, frequently associated with intellectual deficit." }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "ANTOPOL disease", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "Danon disease", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "Danon disease, X-linked dominant", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "GSD due to LAMP-2 deficiency", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "LAMP2 lysosomal glycogen storage disease", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "glycogen storage disease type IIb", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "glycogenosis due to LAMP-2 deficiency", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "lysosomal glycogen storage disease caused by mutation in LAMP2", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "lysosomal glycogen storage disease with normal acid maltase activity", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "pseudoglycogenosis II", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "Antopol disease", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "GSD IIb", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "GSD IIb, formerly", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "GSD2B (formerly)", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "X-linked vacuolar cardiomyopathy and myopathy", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "glycogen storage cardiomyopathy", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "glycogen storage disease IIb", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "glycogen storage disease due to LAMP-2 deficiency", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "glycogen storage disease limited to the heart", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "glycogen storage disease type 2b (formerly)", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "lysosomal glycogen storage disease without acid maltase deficiency", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "lysosomal glycogen storage disease without acid maltase deficiency (formerly)", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "lysosomal glycogen storage disease without acid maltase deficiency, formerly", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "pseudoglycogenosis 2", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "vacuolar cardiomyopathy and myopathy X-linked", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "vacuolar cardiomyopathy and myopathy, X-linked", "description": "" }, { "id": "MIM:300257", "resource": "MIM", "url": "https://www.omim.org/entry/300257", "name": "Danon disease", "description": "Danon disease" } ] } ], "keywords": [ "ebi", "germline", "disease" ] }, { "evidence": [ { "id": "rs748494547", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs748494547" }, { "id": "rs748494547", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs748494547" }, { "id": "rs748494547", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs748494547" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 125, "end_pos": 125, "sequence_org": "T", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTT->NTA).", "chr_id": "X", "chr_pos": "120455381", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T125", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1921041608", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1921041608" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 125, "end_pos": 125, "sequence_org": "T", "sequence_mut": "null", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTT->NTnull).", "chr_id": "X", "chr_pos": "120455380", "ref_nt": "l", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T125", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1385890053", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1385890053" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 156, "end_pos": 156, "sequence_org": "L", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NSL->NSS).", "chr_id": "X", "chr_pos": "120449059", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "L156", "disease": [ { "disease_id": "DOID:0050437", "recommended_name": { "id": "DOID:0050437", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050437", "name": "Danon disease", "description": "A lysosomal storage disease that is characterized by cardiomyopathy, skeletal myopathy and intellectual disability and has_material_basis_in mutations in the LAMP2 gene." }, "synonyms": [ { "id": "DOID:0050437", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050437", "name": "ANTOPOL DISEASE", "description": "" }, { "id": "DOID:0050437", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050437", "name": "PSEUDOGLYCOGENOSIS II", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "Danon disease", "description": "A lysosomal glycogen storage disease characterized by severe cardiomyopathy and variable degrees of muscle weakness, frequently associated with intellectual deficit." }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "ANTOPOL disease", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "Danon disease", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "Danon disease, X-linked dominant", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "GSD due to LAMP-2 deficiency", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "LAMP2 lysosomal glycogen storage disease", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "glycogen storage disease type IIb", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "glycogenosis due to LAMP-2 deficiency", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "lysosomal glycogen storage disease caused by mutation in LAMP2", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "lysosomal glycogen storage disease with normal acid maltase activity", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "pseudoglycogenosis II", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "Antopol disease", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "GSD IIb", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "GSD IIb, formerly", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "GSD2B (formerly)", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "X-linked vacuolar cardiomyopathy and myopathy", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "glycogen storage cardiomyopathy", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "glycogen storage disease IIb", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "glycogen storage disease due to LAMP-2 deficiency", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "glycogen storage disease limited to the heart", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "glycogen storage disease type 2b (formerly)", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "lysosomal glycogen storage disease without acid maltase deficiency", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "lysosomal glycogen storage disease without acid maltase deficiency (formerly)", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "lysosomal glycogen storage disease without acid maltase deficiency, formerly", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "pseudoglycogenosis 2", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "vacuolar cardiomyopathy and myopathy X-linked", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "vacuolar cardiomyopathy and myopathy, X-linked", "description": "" }, { "id": "MIM:300257", "resource": "MIM", "url": "https://www.omim.org/entry/300257", "name": "Danon disease", "description": "Danon disease" } ] } ], "keywords": [ "ebi", "germline", "disease" ] }, { "evidence": [ { "id": "rs138991195", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs138991195" }, { "id": "rs138991195", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs138991195" }, { "id": "rs138991195", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs138991195" }, { "id": "rs138991195", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs138991195#frequency_tab" }, { "id": "rs138991195", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs138991195" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 196, "end_pos": 196, "sequence_org": "T", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->A).", "chr_id": "X", "chr_pos": "120447996", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "0.000265", "site_lbl": "T196", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1459886510", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1459886510" }, { "id": "rs1459886510", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1459886510" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 204, "end_pos": 204, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->I).", "chr_id": "X", "chr_pos": "120447971", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T204", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs876657845", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs876657845" }, { "id": "rs876657845", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs876657845" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 204, "end_pos": 204, "sequence_org": "T", "sequence_mut": "P", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->P).", "chr_id": "X", "chr_pos": "120447972", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T204", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1369480606", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1369480606" }, { "id": "rs1369480606", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1369480606" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 207, "end_pos": 207, "sequence_org": "S", "sequence_mut": "F", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->F).", "chr_id": "X", "chr_pos": "120447962", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S207", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs2058604992", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2058604992" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 210, "end_pos": 210, "sequence_org": "T", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->K).", "chr_id": "X", "chr_pos": "120447953", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T210", "disease": [ { "disease_id": "DOID:0050437", "recommended_name": { "id": "DOID:0050437", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050437", "name": "Danon disease", "description": "A lysosomal storage disease that is characterized by cardiomyopathy, skeletal myopathy and intellectual disability and has_material_basis_in mutations in the LAMP2 gene." }, "synonyms": [ { "id": "DOID:0050437", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050437", "name": "ANTOPOL DISEASE", "description": "" }, { "id": "DOID:0050437", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050437", "name": "PSEUDOGLYCOGENOSIS II", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "Danon disease", "description": "A lysosomal glycogen storage disease characterized by severe cardiomyopathy and variable degrees of muscle weakness, frequently associated with intellectual deficit." }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "ANTOPOL disease", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "Danon disease", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "Danon disease, X-linked dominant", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "GSD due to LAMP-2 deficiency", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "LAMP2 lysosomal glycogen storage disease", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "glycogen storage disease type IIb", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "glycogenosis due to LAMP-2 deficiency", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "lysosomal glycogen storage disease caused by mutation in LAMP2", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "lysosomal glycogen storage disease with normal acid maltase activity", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "pseudoglycogenosis II", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "Antopol disease", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "GSD IIb", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "GSD IIb, formerly", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "GSD2B (formerly)", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "X-linked vacuolar cardiomyopathy and myopathy", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "glycogen storage cardiomyopathy", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "glycogen storage disease IIb", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "glycogen storage disease due to LAMP-2 deficiency", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "glycogen storage disease limited to the heart", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "glycogen storage disease type 2b (formerly)", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "lysosomal glycogen storage disease without acid maltase deficiency", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "lysosomal glycogen storage disease without acid maltase deficiency (formerly)", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "lysosomal glycogen storage disease without acid maltase deficiency, formerly", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "pseudoglycogenosis 2", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "vacuolar cardiomyopathy and myopathy X-linked", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "vacuolar cardiomyopathy and myopathy, X-linked", "description": "" }, { "id": "MIM:300257", "resource": "MIM", "url": "https://www.omim.org/entry/300257", "name": "Danon disease", "description": "Danon disease" } ] } ], "keywords": [ "ebi", "germline", "disease" ] }, { "evidence": [ { "id": "rs369032377", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs369032377" }, { "id": "rs369032377", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs369032377#frequency_tab" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 257, "end_pos": 257, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTT->DTT).", "chr_id": "X", "chr_pos": "120446400", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N257", "disease": [ { "disease_id": "DOID:0050437", "recommended_name": { "id": "DOID:0050437", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050437", "name": "Danon disease", "description": "A lysosomal storage disease that is characterized by cardiomyopathy, skeletal myopathy and intellectual disability and has_material_basis_in mutations in the LAMP2 gene." }, "synonyms": [ { "id": "DOID:0050437", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050437", "name": "ANTOPOL DISEASE", "description": "" }, { "id": "DOID:0050437", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050437", "name": "PSEUDOGLYCOGENOSIS II", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "Danon disease", "description": "A lysosomal glycogen storage disease characterized by severe cardiomyopathy and variable degrees of muscle weakness, frequently associated with intellectual deficit." }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "ANTOPOL disease", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "Danon disease", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "Danon disease, X-linked dominant", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "GSD due to LAMP-2 deficiency", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "LAMP2 lysosomal glycogen storage disease", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "glycogen storage disease type IIb", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "glycogenosis due to LAMP-2 deficiency", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "lysosomal glycogen storage disease caused by mutation in LAMP2", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "lysosomal glycogen storage disease with normal acid maltase activity", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "pseudoglycogenosis II", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "Antopol disease", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "GSD IIb", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "GSD IIb, formerly", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "GSD2B (formerly)", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "X-linked vacuolar cardiomyopathy and myopathy", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "glycogen storage cardiomyopathy", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "glycogen storage disease IIb", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "glycogen storage disease due to LAMP-2 deficiency", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "glycogen storage disease limited to the heart", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "glycogen storage disease type 2b (formerly)", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "lysosomal glycogen storage disease without acid maltase deficiency", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "lysosomal glycogen storage disease without acid maltase deficiency (formerly)", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "lysosomal glycogen storage disease without acid maltase deficiency, formerly", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "pseudoglycogenosis 2", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "vacuolar cardiomyopathy and myopathy X-linked", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "vacuolar cardiomyopathy and myopathy, X-linked", "description": "" }, { "id": "MIM:300257", "resource": "MIM", "url": "https://www.omim.org/entry/300257", "name": "Danon disease", "description": "Danon disease" } ] } ], "keywords": [ "ebi", "germline", "disease" ] }, { "evidence": [ { "id": "rs1569369275", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1569369275" }, { "id": "rs1569369275", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1569369275" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 257, "end_pos": 257, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTT->STT).", "chr_id": "X", "chr_pos": "120446399", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N257", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P13473", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P13473" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 259, "end_pos": 259, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "T", "sequence_mut": "P", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NTT->NTP).", "chr_id": "X", "chr_pos": "120446394", "ref_nt": "T", "alt_nt": "G", "minor_allelic_frequency": "", "site_lbl": "T259", "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs143699208", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs143699208" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 275, "end_pos": 275, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NSS->DSS).", "chr_id": "X", "chr_pos": "120446346", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N275", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs143699208", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs143699208" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 275, "end_pos": 275, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NSS->HSS).", "chr_id": "X", "chr_pos": "120446346", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N275", "disease": [ { "disease_id": "DOID:0050437", "recommended_name": { "id": "DOID:0050437", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050437", "name": "Danon disease", "description": "A lysosomal storage disease that is characterized by cardiomyopathy, skeletal myopathy and intellectual disability and has_material_basis_in mutations in the LAMP2 gene." }, "synonyms": [ { "id": "DOID:0050437", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050437", "name": "ANTOPOL DISEASE", "description": "" }, { "id": "DOID:0050437", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050437", "name": "PSEUDOGLYCOGENOSIS II", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "Danon disease", "description": "A lysosomal glycogen storage disease characterized by severe cardiomyopathy and variable degrees of muscle weakness, frequently associated with intellectual deficit." }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "ANTOPOL disease", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "Danon disease", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "Danon disease, X-linked dominant", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "GSD due to LAMP-2 deficiency", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "LAMP2 lysosomal glycogen storage disease", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "glycogen storage disease type IIb", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "glycogenosis due to LAMP-2 deficiency", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "lysosomal glycogen storage disease caused by mutation in LAMP2", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "lysosomal glycogen storage disease with normal acid maltase activity", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "pseudoglycogenosis II", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "Antopol disease", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "GSD IIb", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "GSD IIb, formerly", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "GSD2B (formerly)", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "X-linked vacuolar cardiomyopathy and myopathy", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "glycogen storage cardiomyopathy", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "glycogen storage disease IIb", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "glycogen storage disease due to LAMP-2 deficiency", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "glycogen storage disease limited to the heart", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "glycogen storage disease type 2b (formerly)", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "lysosomal glycogen storage disease without acid maltase deficiency", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "lysosomal glycogen storage disease without acid maltase deficiency (formerly)", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "lysosomal glycogen storage disease without acid maltase deficiency, formerly", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "pseudoglycogenosis 2", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "vacuolar cardiomyopathy and myopathy X-linked", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "vacuolar cardiomyopathy and myopathy, X-linked", "description": "" }, { "id": "MIM:300257", "resource": "MIM", "url": "https://www.omim.org/entry/300257", "name": "Danon disease", "description": "Danon disease" } ] } ], "keywords": [ "ebi", "germline", "disease" ] }, { "evidence": [ { "id": "rs397516747", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs397516747" }, { "id": "rs397516747", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs397516747#frequency_tab" }, { "id": "rs397516747", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs397516747" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 275, "end_pos": 275, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NSS->SSS).", "chr_id": "X", "chr_pos": "120446345", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N275", "disease": [ { "disease_id": "DOID:0050437", "recommended_name": { "id": "DOID:0050437", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050437", "name": "Danon disease", "description": "A lysosomal storage disease that is characterized by cardiomyopathy, skeletal myopathy and intellectual disability and has_material_basis_in mutations in the LAMP2 gene." }, "synonyms": [ { "id": "DOID:0050437", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050437", "name": "ANTOPOL DISEASE", "description": "" }, { "id": "DOID:0050437", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050437", "name": "PSEUDOGLYCOGENOSIS II", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "Danon disease", "description": "A lysosomal glycogen storage disease characterized by severe cardiomyopathy and variable degrees of muscle weakness, frequently associated with intellectual deficit." }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "ANTOPOL disease", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "Danon disease", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "Danon disease, X-linked dominant", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "GSD due to LAMP-2 deficiency", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "LAMP2 lysosomal glycogen storage disease", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "glycogen storage disease type IIb", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "glycogenosis due to LAMP-2 deficiency", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "lysosomal glycogen storage disease caused by mutation in LAMP2", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "lysosomal glycogen storage disease with normal acid maltase activity", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "pseudoglycogenosis II", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "Antopol disease", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "GSD IIb", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "GSD IIb, formerly", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "GSD2B (formerly)", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "X-linked vacuolar cardiomyopathy and myopathy", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "glycogen storage cardiomyopathy", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "glycogen storage disease IIb", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "glycogen storage disease due to LAMP-2 deficiency", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "glycogen storage disease limited to the heart", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "glycogen storage disease type 2b (formerly)", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "lysosomal glycogen storage disease without acid maltase deficiency", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "lysosomal glycogen storage disease without acid maltase deficiency (formerly)", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "lysosomal glycogen storage disease without acid maltase deficiency, formerly", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "pseudoglycogenosis 2", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "vacuolar cardiomyopathy and myopathy X-linked", "description": "" }, { "id": "MONDO:0010281", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010281", "name": "vacuolar cardiomyopathy and myopathy, X-linked", "description": "" }, { "id": "MIM:300257", "resource": "MIM", "url": "https://www.omim.org/entry/300257", "name": "Danon disease", "description": "Danon disease" } ] } ], "keywords": [ "ebi", "germline", "disease" ] }, { "evidence": [ { "id": "rs730880484", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs730880484" }, { "id": "rs730880484", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs730880484" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 277, "end_pos": 277, "sequence_org": "S", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NSS->NSN).", "chr_id": "X", "chr_pos": "120446339", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S277", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs749064700", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs749064700" }, { "id": "rs749064700", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs749064700" }, { "id": "rs749064700", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs749064700" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 307, "end_pos": 307, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->SGS).", "chr_id": "X", "chr_pos": "120442607", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N307", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs367625418", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs367625418" }, { "id": "rs367625418", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs367625418#frequency_tab" }, { "id": "rs367625418", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs367625418" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 32, "end_pos": 32, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->DLT).", "chr_id": "X", "chr_pos": "120456740", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N32", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1381065572", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1381065572" }, { "id": "rs1381065572", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1381065572" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 32, "end_pos": 32, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->SLT).", "chr_id": "X", "chr_pos": "120456739", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N32", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs778191463", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs778191463" }, { "id": "rs778191463", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs778191463" }, { "id": "rs778191463", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs778191463" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 34, "end_pos": 34, "sequence_org": "T", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->NLA).", "chr_id": "X", "chr_pos": "120456734", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T34", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs775416221", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs775416221" }, { "id": "rs775416221", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs775416221" }, { "id": "rs775416221", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs775416221" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 356, "end_pos": 356, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->SVT).", "chr_id": "X", "chr_pos": "120441756", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N356", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1259106557", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1259106557" }, { "id": "rs1259106557", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1259106557#frequency_tab" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 57, "end_pos": 57, "sequence_org": "T", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->A).", "chr_id": "X", "chr_pos": "120456665", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T57", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1294027053", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1294027053" }, { "id": "rs1294027053", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1294027053#frequency_tab" }, { "id": "rs1294027053", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1294027053" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 58, "end_pos": 58, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NKT->SKT).", "chr_id": "X", "chr_pos": "120456661", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N58", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1207512652", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1207512652" }, { "id": "rs1207512652", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1207512652" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 60, "end_pos": 60, "sequence_org": "T", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NKT->NKA).", "chr_id": "X", "chr_pos": "120456656", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T60", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P13473", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P13473" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 69, "end_pos": 69, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "H", "sequence_mut": "N", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (HGT->NGT).", "chr_id": "X", "chr_pos": "120455549", "ref_nt": "G", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "H69", "disease": [ { "disease_id": "DOID:4159", "recommended_name": { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "skin cancer", "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells." }, "synonyms": [ { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "CA - skin cancer", "description": "" }, { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "malignant neoplasm of skin", "description": "" }, { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "melanoma and Non-melanoma skin cancer", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] } ], "mutagenesis": [ { "start_pos": 401, "end_pos": 404, "sequence_org": "KHHH", "sequence_mut": "AAAA", "comment": "Impairs binding and subsequent lysosomal degradation of target proteins, such as GAPDH.", "evidence": [ { "database": "UniProtKB", "id": "P13473", "url": "https://www.uniprot.org/uniprot/P13473" }, { "database": "PubMed", "id": "11082038", "url": "https://glygen.org/publication/PubMed/11082038" } ] } ], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "96.31", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000005893", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000005893" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "96.69", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000005893", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000005893" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "96.67", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000005893", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000005893" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "88.13", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000005893", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000005893" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "97.55", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000005893", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000005893" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "97.28", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000005893", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000005893" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "88.72", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000005893", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000005893" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "93.86", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000005893", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000005893" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "95.52", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000005893", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000005893" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "88.97", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000005893", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000005893" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "97.82", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000005893", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000005893" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "94.7", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000005893", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000005893" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "95.88", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000005893", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000005893" } ] } ], "expression_disease": [ { "significant": "No", "trend": "down", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "P13473", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P13473" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "No", "trend": "up", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "P13473", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P13473" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "P13473", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P13473" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "P13473", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P13473" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "P13473", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P13473" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "P13473", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P13473" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "P13473", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P13473" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "P13473", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P13473" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "P13473", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P13473" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "P13473", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P13473" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "P13473", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P13473" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "P13473", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P13473" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P13473", "url": "https://www.uniprot.org/uniprot/P13473" } ], "common_name": "Human" } ], "gene": [ { "name": "LAMP2", "url": "https://www.uniprot.org/uniprot/P13473", "locus": { "chromosome": "X", "start_pos": 48202, "end_pos": 5001, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "LRG_749", "url": "https://www.ensembl.org/id/LRG_749" } ] } } ], "crossref": [ { "id": "ENSG00000005893", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000005893", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "P13473", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P13473", "database": "BioMuta", "categories": [ "Variation" ] }, { "id": "LAMP2", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=LAMP2", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "3920", "url": "https://www.ncbi.nlm.nih.gov/gene/3920", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "356", "url": "https://glyconnect.expasy.org/browser/proteins/356", "database": "GlyConnect", "categories": [ "Glycoproteomics", "Glycan" ] }, { "id": "6501", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=6501", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "P13473", "url": "https://www.ebi.ac.uk/intact/interactors/id:P13473*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR002000", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002000", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR018134", "url": "https://www.ebi.ac.uk/interpro/entry/IPR018134", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR048524", "url": "https://www.ebi.ac.uk/interpro/entry/IPR048524", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR048528", "url": "https://www.ebi.ac.uk/interpro/entry/IPR048528", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:3920", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:3920", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "300257", "url": "http://www.omim.org/entry/300257", "database": "MIM", "categories": [ "Other" ] }, { "id": "309060", "url": "http://www.omim.org/entry/309060", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_P13473", "url": "https://www.nextprot.org/entry/NX_P13473", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "P13473", "url": "https://oglcnac.org/atlas/detail/P13473", "database": "O-GlcNAc Atlas", "categories": [ "Glycoproteomics" ] }, { "id": "P13473", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P13473", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "CHPQTAQ", "url": "https://omabrowser.org/oma/group/CHPQTAQ/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5317371at2759", "url": "http://www.orthodb.org/?query=5317371at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR11506", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11506", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11506:SF6", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11506:SF6", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "2MOF", "url": "https://www.rcsb.org/structure/2MOF", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2MOM", "url": "https://www.rcsb.org/structure/2MOM", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF01299", "url": "http://pfam.xfam.org/family/PF01299", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF21222", "url": "http://pfam.xfam.org/family/PF21222", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "P13473", "url": "https://pharos.nih.gov/targets/P13473", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR:000055031", "url": "https://proconsortium.org/app/entry/PR:000055031", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055032", "url": "https://proconsortium.org/app/entry/PR:000055032", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055033", "url": "https://proconsortium.org/app/entry/PR:000055033", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055034", "url": "https://proconsortium.org/app/entry/PR:000055034", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055035", "url": "https://proconsortium.org/app/entry/PR:000055035", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055036", "url": "https://proconsortium.org/app/entry/PR:000055036", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055037", "url": "https://proconsortium.org/app/entry/PR:000055037", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055038", "url": "https://proconsortium.org/app/entry/PR:000055038", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055039", "url": "https://proconsortium.org/app/entry/PR:000055039", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055040", "url": "https://proconsortium.org/app/entry/PR:000055040", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055041", "url": "https://proconsortium.org/app/entry/PR:000055041", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055042", "url": "https://proconsortium.org/app/entry/PR:000055042", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055043", "url": "https://proconsortium.org/app/entry/PR:000055043", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055044", "url": "https://proconsortium.org/app/entry/PR:000055044", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055045", "url": "https://proconsortium.org/app/entry/PR:000055045", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055046", "url": "https://proconsortium.org/app/entry/PR:000055046", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055047", "url": "https://proconsortium.org/app/entry/PR:000055047", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055048", "url": "https://proconsortium.org/app/entry/PR:000055048", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055049", "url": "https://proconsortium.org/app/entry/PR:000055049", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055050", "url": "https://proconsortium.org/app/entry/PR:000055050", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055051", "url": "https://proconsortium.org/app/entry/PR:000055051", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055052", "url": "https://proconsortium.org/app/entry/PR:000055052", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055053", "url": "https://proconsortium.org/app/entry/PR:000055053", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055054", "url": "https://proconsortium.org/app/entry/PR:000055054", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055055", "url": "https://proconsortium.org/app/entry/PR:000055055", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055056", "url": "https://proconsortium.org/app/entry/PR:000055056", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055057", "url": "https://proconsortium.org/app/entry/PR:000055057", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055058", "url": "https://proconsortium.org/app/entry/PR:000055058", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055059", "url": "https://proconsortium.org/app/entry/PR:000055059", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055060", "url": "https://proconsortium.org/app/entry/PR:000055060", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055061", "url": "https://proconsortium.org/app/entry/PR:000055061", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055062", "url": "https://proconsortium.org/app/entry/PR:000055062", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055063", "url": "https://proconsortium.org/app/entry/PR:000055063", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055064", "url": "https://proconsortium.org/app/entry/PR:000055064", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055065", "url": "https://proconsortium.org/app/entry/PR:000055065", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055066", "url": "https://proconsortium.org/app/entry/PR:000055066", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055067", "url": "https://proconsortium.org/app/entry/PR:000055067", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055068", "url": "https://proconsortium.org/app/entry/PR:000055068", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055069", "url": "https://proconsortium.org/app/entry/PR:000055069", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055070", "url": "https://proconsortium.org/app/entry/PR:000055070", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055071", "url": "https://proconsortium.org/app/entry/PR:000055071", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055072", "url": "https://proconsortium.org/app/entry/PR:000055072", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055073", "url": "https://proconsortium.org/app/entry/PR:000055073", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055074", "url": "https://proconsortium.org/app/entry/PR:000055074", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055075", "url": "https://proconsortium.org/app/entry/PR:000055075", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055076", "url": "https://proconsortium.org/app/entry/PR:000055076", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR_P13473", "url": "http://purl.obolibrary.org/obo/PR_P13473", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-114608", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-114608", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-6798695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6798695", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9613829", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9613829", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001116078", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001116078", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "P13473", "url": "DISABLED", "database": "UniCarbKB", "categories": [ "Glycoproteomics" ] }, { "id": "A0A9L9PXQ4", "url": "https://www.uniprot.org/uniprot/A0A9L9PXQ4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A9L9PXQ4-1", "url": "https://www.uniprot.org/uniprot/A0A9L9PXQ4-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YCG2", "url": "https://www.uniprot.org/uniprot/H0YCG2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YCG2-1", "url": "https://www.uniprot.org/uniprot/H0YCG2-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P13473", "url": "https://www.uniprot.org/uniprot/P13473", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P13473-1", "url": "https://www.uniprot.org/uniprot/P13473-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P13473-2", "url": "https://www.uniprot.org/uniprot/P13473-2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P13473-3", "url": "https://www.uniprot.org/uniprot/P13473-3", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MVCFRLFPVPGSGLVLVCLVLGAVRSYALELNLTDSENATCLYAKWQMNFTVRYETTNKTYKTVTISDHGTVTYNGSICGDDQNGPKIAVQFGPGFSWIANFTKAASTYSIDSVSFSYNTGDNTTFPDAEDKGILTVDELLAIRIPLNDLFRCNSLSTLEKNDVVQHYWDVLVQAFVQNGTVSTNEFLCDKDKTSTVAPTIHTTVPSPTTTPTPKEKPEAGTYSVNNGNDTCLLATMGLQLNITQDKVASVININPNTTHSTGSCRSHTALLRLNSSTIKYLDFVFAVKNENRFYLKEVNISMYLVNGSVFSIANNNLSYWDAPLGSSYMCNKEQTVSVSGAFQINTFDLRVQPFNVTQGKYSTAQDCSADDDNFLVPIAVGAALAGVLILVLLAYFIGLKHHHAGYEQF", "length": 410, "header": "sp|P13473-1|LAMP2_HUMAN Isoform 1 of Lysosome-associated membrane glycoprotein 2 OS=Homo sapiens OX=9606 GN=LAMP2 PE=1 SV=2 CANONICAL=P13473-1" }, "isoforms": [ { "isoform_ac": "A0A9L9PXQ4-1", "url": "", "sequence": { "sequence": "MVCFRLFPVPGSGLVLVCLVLGAVRSYALELNLTDSENATCLYAKWQMNFTVRYETTNKTYKTVTISDHGTVTYNGSICGDDQNGPKIAVQFGPGFSWIANFTKAASTYSIDSVSFSYNTGDNTTFPDAEDKGILTVDELLAIRIPLNDLFRCNSLSTLEKNDVVQHYWDVLVQAFVQNGTVSTNEFLCDKDKTSTVAPTIHTTVPSPTTTPTPKEKPEAGTYSVNNGNDTCLLATMGLQLNITQDKVASVININPNTTHSTGSCRSHTALLRLNSSTIKYLDFVFAVKNENRFYLKEVNISMYLVNGSVFSIANNNLSYWDAPLGSSYMCNKEQTVSVSGAFQINTFDLRVQPFNVTQGKYSTEWHQHLHNQSSVELETILLSPPRTPPTSVWSILPSNLISSLCLLLFFCTSLIQLRTILLVTWTLVIKICPTLLPPSAITSEMKSCLISCC", "length": 454, "header": "tr|A0A9L9PXQ4-1|LAMP2_HUMAN Computationally mapped isoform of Lysosome-associated membrane glycoprotein 2 OS=Homo sapiens OX=9606 GN=LAMP2 PE=1 SV=1 CANONICAL=P13473-1" }, "locus": { "chromosome": "X", "start_pos": 120469169, "end_pos": 120432418, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000706600.1", "url": "https://www.ensembl.org/id/ENST00000706600.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000516464.1", "url": "https://www.ensembl.org/id/ENSP00000516464.1" } ] } }, { "isoform_ac": "H0YCG2-1", "url": "", "sequence": { "sequence": "XNSLSTLEKNDVVQHYWDVLVQAFVQNGTVSTNEFLCDKDKTSTVAPTIHTTVPSPTTTPTPKEKPEAGTYSVNNGNDTCLLATMGLQLNITQDKVASVININPNTTHSTGSCRSHTALLRLNSSTIKYLDFVFAVKNENRFYLKEVNISMYLVNGSVFSIANNNLSYWDAPLGSSYMCNKEQTVSVSGAFQINTFDLRVQPFNVTQGKYSTAQECSLDDDTILIPIIVGAGLSGLIIVIVIAYVIGRRKSYAGYQTL", "length": 258, "header": "tr|H0YCG2-1|LAMP2_HUMAN Computationally mapped isoform of Lysosome-associated membrane glycoprotein 2 OS=Homo sapiens OX=9606 GN=LAMP2 PE=1 SV=1 CANONICAL=P13473-1" }, "locus": { "chromosome": "X", "start_pos": 120449068, "end_pos": 120439156, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000486593.5", "url": "https://www.ensembl.org/id/ENST00000486593.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000431526.1", "url": "https://www.ensembl.org/id/ENSP00000431526.1" } ] } }, { "isoform_ac": "P13473-1", "url": "", "sequence": { "sequence": "MVCFRLFPVPGSGLVLVCLVLGAVRSYALELNLTDSENATCLYAKWQMNFTVRYETTNKTYKTVTISDHGTVTYNGSICGDDQNGPKIAVQFGPGFSWIANFTKAASTYSIDSVSFSYNTGDNTTFPDAEDKGILTVDELLAIRIPLNDLFRCNSLSTLEKNDVVQHYWDVLVQAFVQNGTVSTNEFLCDKDKTSTVAPTIHTTVPSPTTTPTPKEKPEAGTYSVNNGNDTCLLATMGLQLNITQDKVASVININPNTTHSTGSCRSHTALLRLNSSTIKYLDFVFAVKNENRFYLKEVNISMYLVNGSVFSIANNNLSYWDAPLGSSYMCNKEQTVSVSGAFQINTFDLRVQPFNVTQGKYSTAQDCSADDDNFLVPIAVGAALAGVLILVLLAYFIGLKHHHAGYEQF", "length": 410, "header": "sp|P13473-1|LAMP2_HUMAN Isoform 1 of Lysosome-associated membrane glycoprotein 2 OS=Homo sapiens OX=9606 GN=LAMP2 PE=1 SV=2 CANONICAL=P13473-1" }, "locus": { "chromosome": "X", "start_pos": 120469169, "end_pos": 120431326, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000200639.9", "url": "https://www.ensembl.org/id/ENST00000200639.9" }, { "database": "Ensembl Peptide", "id": "ENSP00000200639.4", "url": "https://www.ensembl.org/id/ENSP00000200639.4" } ] } }, { "isoform_ac": "P13473-2", "url": "", "sequence": { "sequence": "MVCFRLFPVPGSGLVLVCLVLGAVRSYALELNLTDSENATCLYAKWQMNFTVRYETTNKTYKTVTISDHGTVTYNGSICGDDQNGPKIAVQFGPGFSWIANFTKAASTYSIDSVSFSYNTGDNTTFPDAEDKGILTVDELLAIRIPLNDLFRCNSLSTLEKNDVVQHYWDVLVQAFVQNGTVSTNEFLCDKDKTSTVAPTIHTTVPSPTTTPTPKEKPEAGTYSVNNGNDTCLLATMGLQLNITQDKVASVININPNTTHSTGSCRSHTALLRLNSSTIKYLDFVFAVKNENRFYLKEVNISMYLVNGSVFSIANNNLSYWDAPLGSSYMCNKEQTVSVSGAFQINTFDLRVQPFNVTQGKYSTAQECSLDDDTILIPIIVGAGLSGLIIVIVIAYVIGRRKSYAGYQTL", "length": 410, "header": "sp|P13473-2|LAMP2_HUMAN Isoform 2 of Lysosome-associated membrane glycoprotein 2 OS=Homo sapiens OX=9606 GN=LAMP2 PE=1 SV=2 CANONICAL=P13473-1" }, "locus": { "chromosome": "X", "start_pos": 120469169, "end_pos": 120439157, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000371335.4", "url": "https://www.ensembl.org/id/ENST00000371335.4" }, { "database": "Ensembl Peptide", "id": "ENSP00000360386.4", "url": "https://www.ensembl.org/id/ENSP00000360386.4" } ] } }, { "isoform_ac": "P13473-3", "url": "", "sequence": { "sequence": "MVCFRLFPVPGSGLVLVCLVLGAVRSYALELNLTDSENATCLYAKWQMNFTVRYETTNKTYKTVTISDHGTVTYNGSICGDDQNGPKIAVQFGPGFSWIANFTKAASTYSIDSVSFSYNTGDNTTFPDAEDKGILTVDELLAIRIPLNDLFRCNSLSTLEKNDVVQHYWDVLVQAFVQNGTVSTNEFLCDKDKTSTVAPTIHTTVPSPTTTPTPKEKPEAGTYSVNNGNDTCLLATMGLQLNITQDKVASVININPNTTHSTGSCRSHTALLRLNSSTIKYLDFVFAVKNENRFYLKEVNISMYLVNGSVFSIANNNLSYWDAPLGSSYMCNKEQTVSVSGAFQINTFDLRVQPFNVTQGKYSTAEECSADSDLNFLIPVAVGVALGFLIIVVFISYMIGRRKSRTGYQSV", "length": 411, "header": "sp|P13473-3|LAMP2_HUMAN Isoform 3 of Lysosome-associated membrane glycoprotein 2 OS=Homo sapiens OX=9606 GN=LAMP2 PE=1 SV=2 CANONICAL=P13473-1" }, "locus": { "chromosome": "X", "start_pos": 120469169, "end_pos": 120428487, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000434600.6", "url": "https://www.ensembl.org/id/ENST00000434600.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000408411.2", "url": "https://www.ensembl.org/id/ENSP00000408411.2" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G03461SC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 101, "start_aa": "Asn", "end_pos": 101, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn101", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G06356OH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 101, "start_aa": "Asn", "end_pos": 101, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn101", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G11629QQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 101, "start_aa": "Asn", "end_pos": 101, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn101", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G13694XX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 101, "start_aa": "Asn", "end_pos": 101, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn101", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G14669DU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 101, "start_aa": "Asn", "end_pos": 101, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn101", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G22310AV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 101, "start_aa": "Asn", "end_pos": 101, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn101", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G28681TP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 101, "start_aa": "Asn", "end_pos": 101, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn101", "evidence": [ { "id": "P13473@N101", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P13473@N101" } ] }, { "glytoucan_ac": "G37818NZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 101, "start_aa": "Asn", "end_pos": 101, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn101", "evidence": [ { "id": "P13473@N101", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P13473@N101" } ] }, { "glytoucan_ac": "G37881RL", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 101, "start_aa": "Asn", "end_pos": 101, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn101", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G41882MT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 101, "start_aa": "Asn", "end_pos": 101, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn101", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G45883VE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 101, "start_aa": "Asn", "end_pos": 101, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn101", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G47518TP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 101, "start_aa": "Asn", "end_pos": 101, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn101", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 101, "start_aa": "Asn", "end_pos": 101, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn101", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G50427EO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 101, "start_aa": "Asn", "end_pos": 101, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn101", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G52527GH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 101, "start_aa": "Asn", "end_pos": 101, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn101", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G57888GL", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 101, "start_aa": "Asn", "end_pos": 101, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn101", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G59536GA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 101, "start_aa": "Asn", "end_pos": 101, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn101", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G60177UT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 101, "start_aa": "Asn", "end_pos": 101, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn101", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G62461SM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 101, "start_aa": "Asn", "end_pos": 101, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn101", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G64394MX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 101, "start_aa": "Asn", "end_pos": 101, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn101", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G66088HZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 101, "start_aa": "Asn", "end_pos": 101, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn101", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G66163OV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 101, "start_aa": "Asn", "end_pos": 101, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn101", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G69834CE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 101, "start_aa": "Asn", "end_pos": 101, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn101", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G70822IO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 101, "start_aa": "Asn", "end_pos": 101, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn101", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G70894RY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 101, "start_aa": "Asn", "end_pos": 101, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn101", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G75983OB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 101, "start_aa": "Asn", "end_pos": 101, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn101", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G79286RS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 101, "start_aa": "Asn", "end_pos": 101, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn101", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G81263BG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 101, "start_aa": "Asn", "end_pos": 101, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn101", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G82830MN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 101, "start_aa": "Asn", "end_pos": 101, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn101", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G84452RH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 101, "start_aa": "Asn", "end_pos": 101, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn101", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G86795LJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 101, "start_aa": "Asn", "end_pos": 101, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn101", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G92081HT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 101, "start_aa": "Asn", "end_pos": 101, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn101", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G94831VI", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 101, "start_aa": "Asn", "end_pos": 101, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn101", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G95133RI", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 101, "start_aa": "Asn", "end_pos": 101, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn101", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G95865ZB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 101, "start_aa": "Asn", "end_pos": 101, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn101", "evidence": [ { "id": "P13473@N101", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P13473@N101" } ] }, { "glytoucan_ac": "G96577RX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 101, "start_aa": "Asn", "end_pos": 101, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn101", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 101, "start_aa": "Asn", "end_pos": 101, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn101", "evidence": [ { "id": "P13473", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "P13473", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13473#ptm_processing" }, { "id": "19159218", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19159218" }, { "id": "16335952", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16335952" }, { "id": "12754519", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/12754519" }, { "id": "24190977", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24190977" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" }, { "id": "23090970", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23090970" } ] }, { "glytoucan_ac": "G11870QZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 123, "start_aa": "Asn", "end_pos": 123, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn123", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G12313PD", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 123, "start_aa": "Asn", "end_pos": 123, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn123", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G14669DU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 123, "start_aa": "Asn", "end_pos": 123, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn123", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G14994KB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 123, "start_aa": "Asn", "end_pos": 123, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn123", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G29880MM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 123, "start_aa": "Asn", "end_pos": 123, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn123", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G34617SM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 123, "start_aa": "Asn", "end_pos": 123, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn123", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G44215PV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 123, "start_aa": "Asn", "end_pos": 123, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn123", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G47012YE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 123, "start_aa": "Asn", "end_pos": 123, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn123", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G47448YK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 123, "start_aa": "Asn", "end_pos": 123, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn123", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G48584BU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 123, "start_aa": "Asn", "end_pos": 123, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn123", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G55383ZG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 123, "start_aa": "Asn", "end_pos": 123, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn123", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G62894KT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 123, "start_aa": "Asn", "end_pos": 123, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn123", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G64527OM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 123, "start_aa": "Asn", "end_pos": 123, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn123", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G70101JE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 123, "start_aa": "Asn", "end_pos": 123, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn123", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G80223IX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 123, "start_aa": "Asn", "end_pos": 123, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn123", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G82119TF", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 123, "start_aa": "Asn", "end_pos": 123, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn123", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G84820NF", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 123, "start_aa": "Asn", "end_pos": 123, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn123", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 123, "start_aa": "Asn", "end_pos": 123, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn123", "evidence": [ { "id": "P13473", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "P13473", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13473#ptm_processing" }, { "id": "19159218", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19159218" }, { "id": "16335952", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16335952" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 179, "start_aa": "Asn", "end_pos": 179, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn179", "evidence": [ { "id": "P13473", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13473#ptm_processing" }, { "id": "8323299", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8323299" } ] }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "", "site_category": "automatic_literature_mining", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 181, "start_aa": "Thr", "end_pos": 181, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr181", "evidence": [ { "id": "8323299", "database": "Automatic Literature Mining", "url": "https://research.bioinformatics.udel.edu/glyco/pmid/8323299" }, { "id": "8323299", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8323299" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "LCDKDKTSTVAPTIHTTVPSPTTTPTPKEKPEAGTY", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 188, "start_aa": "Leu", "end_pos": 223, "end_aa": "Tyr", "evidence": [ { "id": "P13473", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "DKTSTVAPTIHTTVPSPTTTPTPK", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 192, "start_aa": "Asp", "end_pos": 215, "end_aa": "Lys", "evidence": [ { "id": "P13473", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 194, "start_aa": "Thr", "end_pos": 194, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr194", "evidence": [ { "id": "P13473", "database": "UniCarbKB", "url": "" }, { "id": "25813380", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25813380" }, { "id": "10.1074/mcp.M114.046862", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1074/mcp.M114.046862" } ] }, { "glytoucan_ac": "G00031MO", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-195, T-196, T-200, T-203, T-204, S-207, T-209, T-210, T-211", "start_pos": 195, "start_aa": "Ser", "end_pos": 195, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser195", "evidence": [ { "id": "P13473", "database": "UniCarbKB", "url": "" }, { "id": "8323299", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8323299" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-195, T-196, T-200, T-203, T-204, S-207, T-209, T-210, T-211", "start_pos": 195, "start_aa": "Ser", "end_pos": 195, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser195", "evidence": [ { "id": "P13473", "database": "UniCarbKB", "url": "" }, { "id": "8323299", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8323299" }, { "id": "25813380", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25813380" }, { "id": "10.1074/mcp.M114.046862", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1074/mcp.M114.046862" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G64973KT", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-195, T-196, T-200, T-203, T-204, S-207, T-209, T-210, T-211", "start_pos": 195, "start_aa": "Ser", "end_pos": 195, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser195", "evidence": [ { "id": "P13473", "database": "UniCarbKB", "url": "" }, { "id": "8323299", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8323299" } ] }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GalNAcylation", "site_category": "reported", "site_seq": "S", "relation": "attached", "comment": "O-linked (GalNAc...) serine O-GalNAcylation", "start_pos": 195, "start_aa": "Ser", "end_pos": 195, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser195", "evidence": [ { "id": "P13473", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13473#ptm_processing" }, { "id": "8323299", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8323299" } ] }, { "glytoucan_ac": "G00031MO", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-195, T-196, T-200, T-203, T-204, S-207, T-209, T-210, T-211", "start_pos": 196, "start_aa": "Thr", "end_pos": 196, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr196", "evidence": [ { "id": "P13473", "database": "UniCarbKB", "url": "" }, { "id": "8323299", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8323299" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-195, T-196, T-200, T-203, T-204, S-207, T-209, T-210, T-211", "start_pos": 196, "start_aa": "Thr", "end_pos": 196, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr196", "evidence": [ { "id": "P13473", "database": "UniCarbKB", "url": "" }, { "id": "8323299", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8323299" }, { "id": "25813380", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25813380" }, { "id": "10.1074/mcp.M114.046862", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1074/mcp.M114.046862" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G64973KT", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-195, T-196, T-200, T-203, T-204, S-207, T-209, T-210, T-211", "start_pos": 196, "start_aa": "Thr", "end_pos": 196, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr196", "evidence": [ { "id": "P13473", "database": "UniCarbKB", "url": "" }, { "id": "8323299", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8323299" } ] }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GalNAcylation", "site_category": "reported", "site_seq": "T", "relation": "attached", "comment": "O-linked (GalNAc...) threonine O-GalNAcylation", "start_pos": 196, "start_aa": "Thr", "end_pos": 196, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr196", "evidence": [ { "id": "P13473", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13473#ptm_processing" }, { "id": "8323299", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8323299" } ] }, { "glytoucan_ac": "G00031MO", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-195, T-196, T-200, T-203, T-204, S-207, T-209, T-210, T-211", "start_pos": 200, "start_aa": "Thr", "end_pos": 200, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr200", "evidence": [ { "id": "P13473", "database": "UniCarbKB", "url": "" }, { "id": "8323299", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8323299" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-195, T-196, T-200, T-203, T-204, S-207, T-209, T-210, T-211", "start_pos": 200, "start_aa": "Thr", "end_pos": 200, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr200", "evidence": [ { "id": "P13473", "database": "UniCarbKB", "url": "" }, { "id": "8323299", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8323299" }, { "id": "25813380", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25813380" }, { "id": "10.1074/mcp.M114.046862", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1074/mcp.M114.046862" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G64973KT", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-195, T-196, T-200, T-203, T-204, S-207, T-209, T-210, T-211", "start_pos": 200, "start_aa": "Thr", "end_pos": 200, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr200", "evidence": [ { "id": "P13473", "database": "UniCarbKB", "url": "" }, { "id": "8323299", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8323299" } ] }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GalNAcylation", "site_category": "reported", "site_seq": "T", "relation": "attached", "comment": "O-linked (GalNAc...) threonine O-GalNAcylation", "start_pos": 200, "start_aa": "Thr", "end_pos": 200, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr200", "evidence": [ { "id": "P13473", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13473#ptm_processing" }, { "id": "8323299", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8323299" } ] }, { "glytoucan_ac": "G00031MO", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-195, T-196, T-200, T-203, T-204, S-207, T-209, T-210, T-211", "start_pos": 203, "start_aa": "Thr", "end_pos": 203, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr203", "evidence": [ { "id": "P13473", "database": "UniCarbKB", "url": "" }, { "id": "8323299", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8323299" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-195, T-196, T-200, T-203, T-204, S-207, T-209, T-210, T-211", "start_pos": 203, "start_aa": "Thr", "end_pos": 203, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr203", "evidence": [ { "id": "P13473", "database": "UniCarbKB", "url": "" }, { "id": "8323299", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8323299" }, { "id": "25813380", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25813380" }, { "id": "10.1074/mcp.M114.046862", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1074/mcp.M114.046862" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G64973KT", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-195, T-196, T-200, T-203, T-204, S-207, T-209, T-210, T-211", "start_pos": 203, "start_aa": "Thr", "end_pos": 203, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr203", "evidence": [ { "id": "P13473", "database": "UniCarbKB", "url": "" }, { "id": "8323299", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8323299" } ] }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GalNAcylation", "site_category": "reported", "site_seq": "T", "relation": "attached", "comment": "O-linked (GalNAc...) threonine O-GalNAcylation", "start_pos": 203, "start_aa": "Thr", "end_pos": 203, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr203", "evidence": [ { "id": "P13473", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13473#ptm_processing" }, { "id": "8323299", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8323299" } ] }, { "glytoucan_ac": "G00031MO", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-195, T-196, T-200, T-203, T-204, S-207, T-209, T-210, T-211", "start_pos": 204, "start_aa": "Thr", "end_pos": 204, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr204", "evidence": [ { "id": "P13473", "database": "UniCarbKB", "url": "" }, { "id": "8323299", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8323299" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-195, T-196, T-200, T-203, T-204, S-207, T-209, T-210, T-211", "start_pos": 204, "start_aa": "Thr", "end_pos": 204, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr204", "evidence": [ { "id": "P13473", "database": "UniCarbKB", "url": "" }, { "id": "8323299", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8323299" }, { "id": "25813380", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25813380" }, { "id": "10.1074/mcp.M114.046862", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1074/mcp.M114.046862" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G64973KT", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-195, T-196, T-200, T-203, T-204, S-207, T-209, T-210, T-211", "start_pos": 204, "start_aa": "Thr", "end_pos": 204, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr204", "evidence": [ { "id": "P13473", "database": "UniCarbKB", "url": "" }, { "id": "8323299", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8323299" } ] }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GalNAcylation", "site_category": "reported", "site_seq": "T", "relation": "attached", "comment": "O-linked (GalNAc...) threonine O-GalNAcylation", "start_pos": 204, "start_aa": "Thr", "end_pos": 204, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr204", "evidence": [ { "id": "P13473", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13473#ptm_processing" }, { "id": "8323299", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8323299" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "VPSPTTTPTPKEKPEAGT", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 205, "start_aa": "Val", "end_pos": 222, "end_aa": "Thr", "evidence": [ { "id": "P13473", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G00031MO", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-195, T-196, T-200, T-203, T-204, S-207, T-209, T-210, T-211", "start_pos": 207, "start_aa": "Ser", "end_pos": 207, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser207", "evidence": [ { "id": "P13473", "database": "UniCarbKB", "url": "" }, { "id": "8323299", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8323299" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-195, T-196, T-200, T-203, T-204, S-207, T-209, T-210, T-211", "start_pos": 207, "start_aa": "Ser", "end_pos": 207, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser207", "evidence": [ { "id": "P13473", "database": "UniCarbKB", "url": "" }, { "id": "8323299", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8323299" }, { "id": "25813380", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25813380" }, { "id": "10.1074/mcp.M114.046862", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1074/mcp.M114.046862" } ] }, { "glytoucan_ac": "G64973KT", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-195, T-196, T-200, T-203, T-204, S-207, T-209, T-210, T-211", "start_pos": 207, "start_aa": "Ser", "end_pos": 207, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser207", "evidence": [ { "id": "P13473", "database": "UniCarbKB", "url": "" }, { "id": "8323299", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8323299" } ] }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GalNAcylation", "site_category": "reported", "site_seq": "S", "relation": "attached", "comment": "O-linked (GalNAc...) serine; partial O-GalNAcylation", "start_pos": 207, "start_aa": "Ser", "end_pos": 207, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser207", "evidence": [ { "id": "P13473", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13473#ptm_processing" }, { "id": "8323299", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8323299" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "SPT", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 207, "start_aa": "Ser", "end_pos": 209, "end_aa": "Thr", "evidence": [ { "id": "P13473", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G00031MO", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-195, T-196, T-200, T-203, T-204, S-207, T-209, T-210, T-211", "start_pos": 209, "start_aa": "Thr", "end_pos": 209, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr209", "evidence": [ { "id": "P13473", "database": "UniCarbKB", "url": "" }, { "id": "8323299", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8323299" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-195, T-196, T-200, T-203, T-204, S-207, T-209, T-210, T-211", "start_pos": 209, "start_aa": "Thr", "end_pos": 209, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr209", "evidence": [ { "id": "P13473", "database": "UniCarbKB", "url": "" }, { "id": "8323299", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8323299" }, { "id": "25813380", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25813380" }, { "id": "10.1074/mcp.M114.046862", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1074/mcp.M114.046862" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G64973KT", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-195, T-196, T-200, T-203, T-204, S-207, T-209, T-210, T-211", "start_pos": 209, "start_aa": "Thr", "end_pos": 209, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr209", "evidence": [ { "id": "P13473", "database": "UniCarbKB", "url": "" }, { "id": "8323299", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8323299" } ] }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GalNAcylation", "site_category": "reported", "site_seq": "T", "relation": "attached", "comment": "O-linked (GalNAc...) threonine; partial O-GalNAcylation", "start_pos": 209, "start_aa": "Thr", "end_pos": 209, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr209", "evidence": [ { "id": "P13473", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13473#ptm_processing" }, { "id": "8323299", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8323299" } ] }, { "glytoucan_ac": "G00031MO", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-195, T-196, T-200, T-203, T-204, S-207, T-209, T-210, T-211", "start_pos": 210, "start_aa": "Thr", "end_pos": 210, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr210", "evidence": [ { "id": "P13473", "database": "UniCarbKB", "url": "" }, { "id": "8323299", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8323299" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 210, "start_aa": "Thr", "end_pos": 210, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr210", "evidence": [ { "id": "P13473", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P13473" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "28411811", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28411811" }, { "id": "34725712", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725712" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "36240223", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/36240223" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-195, T-196, T-200, T-203, T-204, S-207, T-209, T-210, T-211", "start_pos": 210, "start_aa": "Thr", "end_pos": 210, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr210", "evidence": [ { "id": "P13473", "database": "UniCarbKB", "url": "" }, { "id": "8323299", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8323299" }, { "id": "25813380", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25813380" }, { "id": "10.1074/mcp.M114.046862", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1074/mcp.M114.046862" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G64973KT", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-195, T-196, T-200, T-203, T-204, S-207, T-209, T-210, T-211", "start_pos": 210, "start_aa": "Thr", "end_pos": 210, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr210", "evidence": [ { "id": "P13473", "database": "UniCarbKB", "url": "" }, { "id": "8323299", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8323299" } ] }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GalNAcylation", "site_category": "reported", "site_seq": "T", "relation": "attached", "comment": "O-linked (GalNAc...) threonine O-GalNAcylation", "start_pos": 210, "start_aa": "Thr", "end_pos": 210, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr210", "evidence": [ { "id": "P13473", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13473#ptm_processing" }, { "id": "8323299", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8323299" } ] }, { "glytoucan_ac": "G00031MO", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-195, T-196, T-200, T-203, T-204, S-207, T-209, T-210, T-211", "start_pos": 211, "start_aa": "Thr", "end_pos": 211, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr211", "evidence": [ { "id": "P13473", "database": "UniCarbKB", "url": "" }, { "id": "8323299", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8323299" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-195, T-196, T-200, T-203, T-204, S-207, T-209, T-210, T-211", "start_pos": 211, "start_aa": "Thr", "end_pos": 211, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr211", "evidence": [ { "id": "P13473", "database": "UniCarbKB", "url": "" }, { "id": "8323299", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8323299" }, { "id": "25813380", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25813380" }, { "id": "10.1074/mcp.M114.046862", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1074/mcp.M114.046862" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G64973KT", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-195, T-196, T-200, T-203, T-204, S-207, T-209, T-210, T-211", "start_pos": 211, "start_aa": "Thr", "end_pos": 211, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr211", "evidence": [ { "id": "P13473", "database": "UniCarbKB", "url": "" }, { "id": "8323299", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8323299" } ] }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GalNAcylation", "site_category": "reported", "site_seq": "T", "relation": "attached", "comment": "O-linked (GalNAc...) threonine O-GalNAcylation", "start_pos": 211, "start_aa": "Thr", "end_pos": 211, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr211", "evidence": [ { "id": "P13473", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13473#ptm_processing" }, { "id": "8323299", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8323299" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 213, "start_aa": "Thr", "end_pos": 213, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr213", "evidence": [ { "id": "P13473", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GalNAcylation", "site_category": "reported", "site_seq": "T", "relation": "attached", "comment": "O-linked (GalNAc...) threonine; partial O-GalNAcylation", "start_pos": 213, "start_aa": "Thr", "end_pos": 213, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr213", "evidence": [ { "id": "P13473", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13473#ptm_processing" }, { "id": "8323299", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8323299" } ] }, { "glytoucan_ac": "G66538GV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 229, "start_aa": "Asn", "end_pos": 229, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn229", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "23345538", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23345538" } ] }, { "glytoucan_ac": "G92050GC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 229, "start_aa": "Asn", "end_pos": 229, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn229", "evidence": [ { "id": "P13473", "database": "UniCarbKB", "url": "" }, { "id": "23345538", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23345538" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 229, "start_aa": "Asn", "end_pos": 229, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn229", "evidence": [ { "id": "P13473", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13473#ptm_processing" }, { "id": "8323299", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8323299" } ] }, { "glytoucan_ac": "G05724UK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 242, "start_aa": "Asn", "end_pos": 242, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn242", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G64527OM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 242, "start_aa": "Asn", "end_pos": 242, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn242", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G70101JE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 242, "start_aa": "Asn", "end_pos": 242, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn242", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 242, "start_aa": "Asn", "end_pos": 242, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn242", "evidence": [ { "id": "P13473", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "P13473", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13473#ptm_processing" }, { "id": "8323299", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8323299" } ] }, { "glytoucan_ac": "G00912UN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 257, "start_aa": "Asn", "end_pos": 257, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn257", "evidence": [ { "id": "P13473", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G02030ZB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 257, "start_aa": "Asn", "end_pos": 257, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn257", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G10773YW", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 257, "start_aa": "Asn", "end_pos": 257, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn257", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G11870QZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 257, "start_aa": "Asn", "end_pos": 257, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn257", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G14669DU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 257, "start_aa": "Asn", "end_pos": 257, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn257", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G23294PN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 257, "start_aa": "Asn", "end_pos": 257, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn257", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G23863VK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 257, "start_aa": "Asn", "end_pos": 257, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn257", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G27947YN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 257, "start_aa": "Asn", "end_pos": 257, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn257", "evidence": [ { "id": "P13473", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G32926LW", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 257, "start_aa": "Asn", "end_pos": 257, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn257", "evidence": [ { "id": "P13473@N257", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P13473@N257" } ] }, { "glytoucan_ac": "G34617SM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 257, "start_aa": "Asn", "end_pos": 257, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn257", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G41247ZX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "high-energy collision-induced dissociation", "start_pos": 257, "start_aa": "Asn", "end_pos": 257, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn257", "evidence": [ { "id": "P13473", "database": "UniCarbKB", "url": "" }, { "id": "34089345", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34089345" }, { "id": "10.1007/s00018-021-03863-1", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1007/s00018-021-03863-1" } ] }, { "glytoucan_ac": "G41882MT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 257, "start_aa": "Asn", "end_pos": 257, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn257", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G47012YE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 257, "start_aa": "Asn", "end_pos": 257, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn257", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 257, "start_aa": "Asn", "end_pos": 257, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn257", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G52527GH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 257, "start_aa": "Asn", "end_pos": 257, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn257", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G72797UR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 257, "start_aa": "Asn", "end_pos": 257, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn257", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G73686WG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 257, "start_aa": "Asn", "end_pos": 257, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn257", "evidence": [ { "id": "P13473@N257", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P13473@N257" } ] }, { "glytoucan_ac": "G74724QE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 257, "start_aa": "Asn", "end_pos": 257, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn257", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G81263BG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 257, "start_aa": "Asn", "end_pos": 257, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn257", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G84452RH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 257, "start_aa": "Asn", "end_pos": 257, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn257", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G90093AU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 257, "start_aa": "Asn", "end_pos": 257, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn257", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G96577RX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 257, "start_aa": "Asn", "end_pos": 257, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn257", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 257, "start_aa": "Asn", "end_pos": 257, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn257", "evidence": [ { "id": "P13473", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13473#ptm_processing" }, { "id": "19159218", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19159218" }, { "id": "16335952", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16335952" }, { "id": "24190977", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24190977" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" }, { "id": "23090970", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23090970" } ] }, { "glytoucan_ac": "G00912UN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "P13473", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G02315DX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G05724UK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G06110VR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G06356OH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G11629QQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G11870QZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G12313PD", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G14669DU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G18183SM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G20210JR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G20312EM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G20425TQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G22589VJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "P13473", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G23294PN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G23453IV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G25379SA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G25418HZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G25451PN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G26403SG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G30769VJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G31916IQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G34617SM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G37881RL", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G39595FH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G40926MX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "P13473", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "P13473@N275", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P13473@N275" } ] }, { "glytoucan_ac": "G41882MT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G44215PV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G44753VC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "P13473@N275", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P13473@N275" } ] }, { "glytoucan_ac": "G45883VE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G46902YN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G47012YE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G48584BU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G50427EO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G51640FO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G52527GH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G55383ZG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G57888GL", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G59536GA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G64394MX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G64527OM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G65019XG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G66163OV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G66933CM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "P13473", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G70101JE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G72291OX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G74724QE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G75983OB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G76417NN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G77582RK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G79286RS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G80223IX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G81263BG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G82463GQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G83229XP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G84452RH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G86795LJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G89098OM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G92597CK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "P13473", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G95865ZB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "P13473", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G96577RX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "P13473", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "P13473", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13473#ptm_processing" }, { "id": "8323299", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8323299" } ] }, { "glytoucan_ac": "G05724UK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 300, "start_aa": "Asn", "end_pos": 300, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn300", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 300, "start_aa": "Asn", "end_pos": 300, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn300", "evidence": [ { "id": "P13473", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13473#ptm_processing" }, { "id": "8323299", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8323299" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) (polylactosaminoglycan) asparagine", "start_pos": 307, "start_aa": "Asn", "end_pos": 307, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn307", "evidence": [ { "id": "P13473", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13473#ptm_processing" }, { "id": "8323299", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8323299" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 317, "start_aa": "Asn", "end_pos": 317, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn317", "evidence": [ { "id": "P13473", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13473#ptm_processing" }, { "id": "8323299", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8323299" } ] }, { "glytoucan_ac": "G06356OH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 32, "start_aa": "Asn", "end_pos": 32, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn32", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G11870QZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 32, "start_aa": "Asn", "end_pos": 32, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn32", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G22625SJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 32, "start_aa": "Asn", "end_pos": 32, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn32", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G23863VK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 32, "start_aa": "Asn", "end_pos": 32, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn32", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G26759AS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 32, "start_aa": "Asn", "end_pos": 32, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn32", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G31596VW", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 32, "start_aa": "Asn", "end_pos": 32, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn32", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G34617SM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 32, "start_aa": "Asn", "end_pos": 32, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn32", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G44215PV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 32, "start_aa": "Asn", "end_pos": 32, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn32", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G46687AB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 32, "start_aa": "Asn", "end_pos": 32, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn32", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G46902YN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 32, "start_aa": "Asn", "end_pos": 32, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn32", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G50045TK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 32, "start_aa": "Asn", "end_pos": 32, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn32", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G62894KT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 32, "start_aa": "Asn", "end_pos": 32, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn32", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G64394MX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 32, "start_aa": "Asn", "end_pos": 32, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn32", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G65092SV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 32, "start_aa": "Asn", "end_pos": 32, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn32", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G66163OV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 32, "start_aa": "Asn", "end_pos": 32, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn32", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G66621EA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 32, "start_aa": "Asn", "end_pos": 32, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn32", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G69834CE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 32, "start_aa": "Asn", "end_pos": 32, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn32", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G74430RZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 32, "start_aa": "Asn", "end_pos": 32, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn32", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G76915KR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 32, "start_aa": "Asn", "end_pos": 32, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn32", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G79286RS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 32, "start_aa": "Asn", "end_pos": 32, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn32", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G80223IX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 32, "start_aa": "Asn", "end_pos": 32, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn32", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G81263BG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 32, "start_aa": "Asn", "end_pos": 32, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn32", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G81295CK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 32, "start_aa": "Asn", "end_pos": 32, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn32", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G86234IN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 32, "start_aa": "Asn", "end_pos": 32, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn32", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G96416FQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 32, "start_aa": "Asn", "end_pos": 32, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn32", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G96577RX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 32, "start_aa": "Asn", "end_pos": 32, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn32", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 32, "start_aa": "Asn", "end_pos": 32, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn32", "evidence": [ { "id": "P13473", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "P13473", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13473#ptm_processing" }, { "id": "16335952", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16335952" } ] }, { "glytoucan_ac": "G00406II", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 356, "start_aa": "Asn", "end_pos": 356, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn356", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G01650EU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 356, "start_aa": "Asn", "end_pos": 356, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn356", "evidence": [ { "id": "P13473", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "P13473@N356", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P13473@N356" } ] }, { "glytoucan_ac": "G02315DX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 356, "start_aa": "Asn", "end_pos": 356, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn356", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G02815KT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 356, "start_aa": "Asn", "end_pos": 356, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn356", "evidence": [ { "id": "P13473@N356", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P13473@N356" } ] }, { "glytoucan_ac": "G03574QJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 356, "start_aa": "Asn", "end_pos": 356, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn356", "evidence": [ { "id": "P13473", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G05724UK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 356, "start_aa": "Asn", "end_pos": 356, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn356", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G06110VR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 356, "start_aa": "Asn", "end_pos": 356, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn356", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G06231AO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 356, "start_aa": "Asn", "end_pos": 356, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn356", "evidence": [ { "id": "P13473", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G06356OH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 356, "start_aa": "Asn", "end_pos": 356, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn356", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G08293MJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 356, "start_aa": "Asn", "end_pos": 356, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn356", "evidence": [ { "id": "P13473@N356", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P13473@N356" } ] }, { "glytoucan_ac": "G09197ZW", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 356, "start_aa": "Asn", "end_pos": 356, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn356", "evidence": [ { "id": "P13473", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G10773YW", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 356, "start_aa": "Asn", "end_pos": 356, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn356", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G11870QZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 356, "start_aa": "Asn", "end_pos": 356, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn356", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G12313PD", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 356, "start_aa": "Asn", "end_pos": 356, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn356", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G14669DU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 356, "start_aa": "Asn", "end_pos": 356, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn356", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G16175ZV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 356, "start_aa": "Asn", "end_pos": 356, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn356", "evidence": [ { "id": "P13473", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G18183SM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 356, "start_aa": "Asn", "end_pos": 356, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn356", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G20210JR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 356, "start_aa": "Asn", "end_pos": 356, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn356", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G20312EM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 356, "start_aa": "Asn", "end_pos": 356, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn356", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G20425TQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 356, "start_aa": "Asn", "end_pos": 356, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn356", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G23294PN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 356, "start_aa": "Asn", "end_pos": 356, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn356", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G23453IV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 356, "start_aa": "Asn", "end_pos": 356, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn356", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G23863VK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 356, "start_aa": "Asn", "end_pos": 356, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn356", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G23984SE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 356, "start_aa": "Asn", "end_pos": 356, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn356", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G25079LO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 356, "start_aa": "Asn", "end_pos": 356, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn356", "evidence": [ { "id": "P13473", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G25418HZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 356, "start_aa": "Asn", "end_pos": 356, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn356", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G25451PN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 356, "start_aa": "Asn", "end_pos": 356, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn356", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G25637MV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 356, "start_aa": "Asn", "end_pos": 356, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn356", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G28541PG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 356, "start_aa": "Asn", "end_pos": 356, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn356", "evidence": [ { "id": "P13473@N356", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P13473@N356" } ] }, { "glytoucan_ac": "G29880MM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 356, "start_aa": "Asn", "end_pos": 356, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn356", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G30769VJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 356, "start_aa": "Asn", "end_pos": 356, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn356", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G31544HA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 356, "start_aa": "Asn", "end_pos": 356, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn356", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G31852PQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "high-energy collision-induced dissociation", "start_pos": 356, "start_aa": "Asn", "end_pos": 356, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn356", "evidence": [ { "id": "P13473", "database": "UniCarbKB", "url": "" }, { "id": "34089345", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34089345" }, { "id": "10.1007/s00018-021-03863-1", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1007/s00018-021-03863-1" } ] }, { "glytoucan_ac": "G31916IQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 356, "start_aa": "Asn", "end_pos": 356, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn356", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G33609NS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 356, "start_aa": "Asn", "end_pos": 356, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn356", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G37399XV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 356, "start_aa": "Asn", "end_pos": 356, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn356", "evidence": [ { "id": "P13473", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "P13473@N356", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P13473@N356" } ] }, { "glytoucan_ac": "G37881RL", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 356, "start_aa": "Asn", "end_pos": 356, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn356", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G39188ZX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 356, "start_aa": "Asn", "end_pos": 356, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn356", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G39619TI", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 356, "start_aa": "Asn", "end_pos": 356, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn356", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G41126SR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 356, "start_aa": "Asn", "end_pos": 356, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn356", "evidence": [ { "id": "P13473", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G41247ZX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "high-energy collision-induced dissociation", "start_pos": 356, "start_aa": "Asn", "end_pos": 356, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn356", "evidence": [ { "id": "P13473", "database": "UniCarbKB", "url": "" }, { "id": "34089345", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34089345" }, { "id": "10.1007/s00018-021-03863-1", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1007/s00018-021-03863-1" } ] }, { "glytoucan_ac": "G44215PV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 356, "start_aa": "Asn", "end_pos": 356, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn356", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G46687AB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 356, "start_aa": "Asn", "end_pos": 356, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn356", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G46902YN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 356, "start_aa": "Asn", "end_pos": 356, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn356", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G47012YE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 356, "start_aa": "Asn", "end_pos": 356, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn356", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G48584BU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 356, "start_aa": "Asn", "end_pos": 356, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn356", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G50045TK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 356, "start_aa": "Asn", "end_pos": 356, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn356", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G50372IH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 356, "start_aa": "Asn", "end_pos": 356, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn356", "evidence": [ { "id": "P13473", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G51640FO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 356, "start_aa": "Asn", "end_pos": 356, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn356", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G56610MH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 356, "start_aa": "Asn", "end_pos": 356, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn356", "evidence": [ { "id": "P13473", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G56784JY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 356, "start_aa": "Asn", "end_pos": 356, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn356", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G59536GA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 356, "start_aa": "Asn", "end_pos": 356, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn356", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G59626AS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 356, "start_aa": "Asn", "end_pos": 356, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn356", "evidence": [ { "id": "P13473", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "P13473@N356", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P13473@N356" } ] }, { "glytoucan_ac": "G60177UT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 356, "start_aa": "Asn", "end_pos": 356, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn356", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G60923RB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 356, "start_aa": "Asn", "end_pos": 356, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn356", "evidence": [ { "id": "P13473", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G62595EF", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 356, "start_aa": "Asn", "end_pos": 356, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn356", "evidence": [ { "id": "P13473", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G62765YT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "high-energy collision-induced dissociation", "start_pos": 356, "start_aa": "Asn", "end_pos": 356, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn356", "evidence": [ { "id": "P13473", "database": "UniCarbKB", "url": "" }, { "id": "34089345", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34089345" }, { "id": "10.1007/s00018-021-03863-1", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1007/s00018-021-03863-1" } ] }, { "glytoucan_ac": "G64527OM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 356, "start_aa": "Asn", "end_pos": 356, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn356", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G65092SV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 356, "start_aa": "Asn", "end_pos": 356, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn356", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G66163OV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 356, "start_aa": "Asn", "end_pos": 356, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn356", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G66621EA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 356, "start_aa": "Asn", "end_pos": 356, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn356", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G66933CM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 356, "start_aa": "Asn", "end_pos": 356, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn356", "evidence": [ { "id": "P13473", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G70101JE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 356, "start_aa": "Asn", "end_pos": 356, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn356", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G72291OX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 356, "start_aa": "Asn", "end_pos": 356, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn356", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G72735IY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 356, "start_aa": "Asn", "end_pos": 356, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn356", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G72797UR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 356, "start_aa": "Asn", "end_pos": 356, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn356", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G74724QE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 356, "start_aa": "Asn", "end_pos": 356, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn356", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G75983OB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 356, "start_aa": "Asn", "end_pos": 356, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn356", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G77582RK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 356, "start_aa": "Asn", "end_pos": 356, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn356", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G79286RS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 356, "start_aa": "Asn", "end_pos": 356, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn356", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G79568CQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 356, "start_aa": "Asn", "end_pos": 356, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn356", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G80223IX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 356, "start_aa": "Asn", "end_pos": 356, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn356", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G81263BG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 356, "start_aa": "Asn", "end_pos": 356, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn356", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G82119TF", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 356, "start_aa": "Asn", "end_pos": 356, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn356", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G82463GQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 356, "start_aa": "Asn", "end_pos": 356, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn356", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G82830MN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 356, "start_aa": "Asn", "end_pos": 356, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn356", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G83229XP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 356, "start_aa": "Asn", "end_pos": 356, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn356", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G84452RH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 356, "start_aa": "Asn", "end_pos": 356, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn356", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G84820NF", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 356, "start_aa": "Asn", "end_pos": 356, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn356", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G86795LJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 356, "start_aa": "Asn", "end_pos": 356, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn356", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G87051GH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 356, "start_aa": "Asn", "end_pos": 356, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn356", "evidence": [ { "id": "P13473", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G89098OM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 356, "start_aa": "Asn", "end_pos": 356, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn356", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G90093AU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 356, "start_aa": "Asn", "end_pos": 356, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn356", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G92062TF", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 356, "start_aa": "Asn", "end_pos": 356, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn356", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G95133RI", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 356, "start_aa": "Asn", "end_pos": 356, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn356", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G95865ZB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 356, "start_aa": "Asn", "end_pos": 356, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn356", "evidence": [ { "id": "P13473@N356", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P13473@N356" } ] }, { "glytoucan_ac": "G96577RX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 356, "start_aa": "Asn", "end_pos": 356, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn356", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 356, "start_aa": "Asn", "end_pos": 356, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn356", "evidence": [ { "id": "P13473", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "P13473", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13473#ptm_processing" }, { "id": "19159218", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19159218" }, { "id": "24190977", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24190977" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" }, { "id": "23090970", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23090970" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 358, "start_aa": "Thr", "end_pos": 358, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr358", "evidence": [ { "id": "P13473", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P13473" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "28411811", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28411811" }, { "id": "34725712", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725712" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "36240223", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/36240223" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 38, "start_aa": "Asn", "end_pos": 38, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn38", "evidence": [ { "id": "P13473", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "P13473", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13473#ptm_processing" }, { "id": "16335952", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16335952" } ] }, { "glytoucan_ac": "G02315DX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 49, "start_aa": "Asn", "end_pos": 49, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn49", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G05724UK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 49, "start_aa": "Asn", "end_pos": 49, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn49", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G06110VR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 49, "start_aa": "Asn", "end_pos": 49, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn49", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G06356OH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 49, "start_aa": "Asn", "end_pos": 49, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn49", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G10019LZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 49, "start_aa": "Asn", "end_pos": 49, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn49", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G12313PD", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 49, "start_aa": "Asn", "end_pos": 49, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn49", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G14260UH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 49, "start_aa": "Asn", "end_pos": 49, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn49", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G14669DU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 49, "start_aa": "Asn", "end_pos": 49, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn49", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G20210JR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 49, "start_aa": "Asn", "end_pos": 49, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn49", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G20425TQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 49, "start_aa": "Asn", "end_pos": 49, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn49", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G23294PN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 49, "start_aa": "Asn", "end_pos": 49, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn49", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G26403SG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 49, "start_aa": "Asn", "end_pos": 49, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn49", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G30769VJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 49, "start_aa": "Asn", "end_pos": 49, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn49", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G31916IQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 49, "start_aa": "Asn", "end_pos": 49, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn49", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G34617SM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 49, "start_aa": "Asn", "end_pos": 49, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn49", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G39188ZX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 49, "start_aa": "Asn", "end_pos": 49, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn49", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G40926MX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 49, "start_aa": "Asn", "end_pos": 49, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn49", "evidence": [ { "id": "P13473", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G41882MT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 49, "start_aa": "Asn", "end_pos": 49, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn49", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G44215PV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 49, "start_aa": "Asn", "end_pos": 49, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn49", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G47518TP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 49, "start_aa": "Asn", "end_pos": 49, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn49", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 49, "start_aa": "Asn", "end_pos": 49, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn49", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G51640FO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 49, "start_aa": "Asn", "end_pos": 49, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn49", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G52527GH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 49, "start_aa": "Asn", "end_pos": 49, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn49", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G55383ZG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 49, "start_aa": "Asn", "end_pos": 49, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn49", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G56784JY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 49, "start_aa": "Asn", "end_pos": 49, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn49", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G59536GA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 49, "start_aa": "Asn", "end_pos": 49, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn49", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G62461SM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 49, "start_aa": "Asn", "end_pos": 49, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn49", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G65019XG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 49, "start_aa": "Asn", "end_pos": 49, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn49", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G66163OV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 49, "start_aa": "Asn", "end_pos": 49, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn49", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G66933CM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 49, "start_aa": "Asn", "end_pos": 49, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn49", "evidence": [ { "id": "P13473", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G72291OX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 49, "start_aa": "Asn", "end_pos": 49, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn49", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G74724QE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 49, "start_aa": "Asn", "end_pos": 49, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn49", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G75983OB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 49, "start_aa": "Asn", "end_pos": 49, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn49", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G76417NN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 49, "start_aa": "Asn", "end_pos": 49, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn49", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G81263BG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 49, "start_aa": "Asn", "end_pos": 49, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn49", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G82463GQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 49, "start_aa": "Asn", "end_pos": 49, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn49", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G86795LJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 49, "start_aa": "Asn", "end_pos": 49, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn49", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G95133RI", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 49, "start_aa": "Asn", "end_pos": 49, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn49", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 49, "start_aa": "Asn", "end_pos": 49, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn49", "evidence": [ { "id": "P13473", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "P13473", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13473#ptm_processing" }, { "id": "16335952", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16335952" }, { "id": "12754519", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/12754519" }, { "id": "24190977", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24190977" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" }, { "id": "23090970", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23090970" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 57, "start_aa": "Thr", "end_pos": 57, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr57", "evidence": [ { "id": "P13473", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P13473" }, { "id": "30620550", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30620550" } ] }, { "glytoucan_ac": "G03930BU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 58, "start_aa": "Asn", "end_pos": 58, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn58", "evidence": [ { "id": "P13473", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G05724UK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 58, "start_aa": "Asn", "end_pos": 58, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn58", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G06356OH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 58, "start_aa": "Asn", "end_pos": 58, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn58", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G10773YW", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 58, "start_aa": "Asn", "end_pos": 58, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn58", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G11629QQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 58, "start_aa": "Asn", "end_pos": 58, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn58", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G11870QZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 58, "start_aa": "Asn", "end_pos": 58, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn58", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G12313PD", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 58, "start_aa": "Asn", "end_pos": 58, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn58", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G14669DU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 58, "start_aa": "Asn", "end_pos": 58, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn58", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G14994KB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 58, "start_aa": "Asn", "end_pos": 58, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn58", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G15169WU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 58, "start_aa": "Asn", "end_pos": 58, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn58", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G20210JR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 58, "start_aa": "Asn", "end_pos": 58, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn58", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G20312EM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 58, "start_aa": "Asn", "end_pos": 58, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn58", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G22625SJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 58, "start_aa": "Asn", "end_pos": 58, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn58", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G23294PN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 58, "start_aa": "Asn", "end_pos": 58, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn58", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G23984SE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 58, "start_aa": "Asn", "end_pos": 58, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn58", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G25418HZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 58, "start_aa": "Asn", "end_pos": 58, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn58", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G25451PN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 58, "start_aa": "Asn", "end_pos": 58, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn58", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G25637MV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 58, "start_aa": "Asn", "end_pos": 58, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn58", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G26403SG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 58, "start_aa": "Asn", "end_pos": 58, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn58", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G29880MM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 58, "start_aa": "Asn", "end_pos": 58, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn58", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G31596VW", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 58, "start_aa": "Asn", "end_pos": 58, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn58", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G31916IQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 58, "start_aa": "Asn", "end_pos": 58, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn58", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G34617SM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 58, "start_aa": "Asn", "end_pos": 58, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn58", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G39188ZX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 58, "start_aa": "Asn", "end_pos": 58, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn58", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G44215PV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 58, "start_aa": "Asn", "end_pos": 58, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn58", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G47012YE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 58, "start_aa": "Asn", "end_pos": 58, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn58", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G47518TP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 58, "start_aa": "Asn", "end_pos": 58, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn58", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 58, "start_aa": "Asn", "end_pos": 58, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn58", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G50427EO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 58, "start_aa": "Asn", "end_pos": 58, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn58", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G52527GH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 58, "start_aa": "Asn", "end_pos": 58, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn58", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G55383ZG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 58, "start_aa": "Asn", "end_pos": 58, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn58", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G58001LT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 58, "start_aa": "Asn", "end_pos": 58, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn58", "evidence": [ { "id": "P13473", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G62894KT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 58, "start_aa": "Asn", "end_pos": 58, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn58", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G63381RX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 58, "start_aa": "Asn", "end_pos": 58, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn58", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G64394MX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 58, "start_aa": "Asn", "end_pos": 58, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn58", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G64527OM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 58, "start_aa": "Asn", "end_pos": 58, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn58", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G66760KM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 58, "start_aa": "Asn", "end_pos": 58, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn58", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G69834CE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 58, "start_aa": "Asn", "end_pos": 58, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn58", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G70101JE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 58, "start_aa": "Asn", "end_pos": 58, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn58", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G70375MX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 58, "start_aa": "Asn", "end_pos": 58, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn58", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G70822IO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 58, "start_aa": "Asn", "end_pos": 58, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn58", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G72291OX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 58, "start_aa": "Asn", "end_pos": 58, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn58", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G72667IM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 58, "start_aa": "Asn", "end_pos": 58, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn58", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G74724QE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 58, "start_aa": "Asn", "end_pos": 58, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn58", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G75983OB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 58, "start_aa": "Asn", "end_pos": 58, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn58", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G76417NN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 58, "start_aa": "Asn", "end_pos": 58, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn58", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G77582RK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 58, "start_aa": "Asn", "end_pos": 58, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn58", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G79286RS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 58, "start_aa": "Asn", "end_pos": 58, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn58", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G80223IX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 58, "start_aa": "Asn", "end_pos": 58, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn58", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G80333GO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 58, "start_aa": "Asn", "end_pos": 58, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn58", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G81263BG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 58, "start_aa": "Asn", "end_pos": 58, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn58", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G82119TF", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 58, "start_aa": "Asn", "end_pos": 58, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn58", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G82463GQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 58, "start_aa": "Asn", "end_pos": 58, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn58", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G83229XP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 58, "start_aa": "Asn", "end_pos": 58, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn58", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G84452RH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 58, "start_aa": "Asn", "end_pos": 58, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn58", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G84820NF", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 58, "start_aa": "Asn", "end_pos": 58, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn58", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G86795LJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 58, "start_aa": "Asn", "end_pos": 58, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn58", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G89098OM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 58, "start_aa": "Asn", "end_pos": 58, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn58", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G90093AU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 58, "start_aa": "Asn", "end_pos": 58, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn58", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G91473PK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 58, "start_aa": "Asn", "end_pos": 58, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn58", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G96577RX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 58, "start_aa": "Asn", "end_pos": 58, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn58", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 58, "start_aa": "Asn", "end_pos": 58, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn58", "evidence": [ { "id": "P13473", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "P13473", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13473#ptm_processing" }, { "id": "8323299", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8323299" }, { "id": "24190977", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24190977" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" } ] }, { "glytoucan_ac": "G74724QE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 75, "start_aa": "Asn", "end_pos": 75, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn75", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G86234IN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 75, "start_aa": "Asn", "end_pos": 75, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn75", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 75, "start_aa": "Asn", "end_pos": 75, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn75", "evidence": [ { "id": "P13473", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13473#ptm_processing" }, { "id": "8323299", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8323299" }, { "id": "24190977", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24190977" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" } ] }, { "glytoucan_ac": "G00031MO", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "8323299", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8323299" } ] }, { "glytoucan_ac": "G29931IJ", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "8323299", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8323299" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "8323299", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8323299" } ] }, { "glytoucan_ac": "G63628AV", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "8323299", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8323299" } ] }, { "glytoucan_ac": "G64973KT", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "356", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/356" }, { "id": "8323299", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8323299" } ] } ], "phosphorylation": [ { "start_pos": 267, "end_pos": 267, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P13473", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P13473" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Ser267" }, { "start_pos": 269, "end_pos": 269, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P13473", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P13473" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Thr269" }, { "start_pos": 281, "end_pos": 281, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P13473", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P13473" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Tyr281" } ], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported_with_glycan", "glycoprotein_reported" ], "publication": [ { "title": "Tumor cells express pauci- and oligomannosidic N-glycans in glycoproteins recognized by the mannose receptor (CD206)", "journal": "Cell Mol Life Sci", "date": "2021", "authors": "Stavenhagen K., Laan L.C., Gao C., Mehta A.Y., Heimburg-Molinaro J., Glickman J.N., van Die I., Cummings R.D.", "evidence": [ { "database": "UniCarbKB", "id": "P13473", "url": "" } ], "reference": [ { "type": "DOI", "id": "10.1007/s00018-021-03863-1", "url": "https://glygen.org/publication/DOI/10.1007/s00018-021-03863-1" } ] }, { "title": "Precision mapping of the human O-GalNAc glycoproteome through SimpleCell technology", "journal": "EMBO J", "date": "2013", "authors": "Steentoft C., Vakhrushev S.Y., Joshi H.J., Kong Y., Vester-Christensen M.B., Schjoldager K.T., Lavrsen K., Dabelsteen S., Pedersen N.B., Marcos-Silva L., Gupta R., Bennett E.P., Mandel U., Brunak S., Wandall H.H., Levery S.B., Clausen H.", "evidence": [ { "database": "UniCarbKB", "id": "P13473", "url": "" } ], "reference": [ { "type": "DOI", "id": "10.1038/emboj.2013.79", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "title": "Probing the O-Glycoproteome of Gastric Cancer Cell Lines for Biomarker Discovery", "journal": "Molecular & Cellular Proteomics", "date": "2015", "authors": "Campos D., Freitas D., Gomes J., Magalh\u00e3es A., Steentoft C., Gomes C., Vester-Christensen M. B., Ferreira J. A., Afonso L. P., Santos L. L., Pinto de Sousa J., Mandel U., Clausen H., Vakhrushev S. Y., Reis C. A.", "evidence": [ { "database": "UniCarbKB", "id": "P13473", "url": "" } ], "reference": [ { "type": "DOI", "id": "10.1074/mcp.M114.046862", "url": "https://glygen.org/publication/DOI/10.1074/mcp.M114.046862" } ] }, { "title": "Unique properties of lamp2a compared to other lamp2 isoforms.", "journal": "Journal of cell science", "date": "2000", "authors": "Cuervo AM, Dice JF", "evidence": [ { "database": "UniProtKB", "id": "P13473", "url": "https://www.uniprot.org/uniprot/P13473" }, { "database": "Reactome", "id": "R-HSA-9613829", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9613829" } ], "reference": [ { "type": "PubMed", "id": "11082038", "url": "https://glygen.org/publication/PubMed/11082038" } ] }, { "title": "Identification and quantification of N-linked glycoproteins using hydrazide chemistry, stable isotope labeling and mass spectrometry.", "journal": "Nature biotechnology", "date": "2003", "authors": "Zhang H, Li XJ, Martin DB, Aebersold R", "evidence": [ { "database": "UniProtKB", "id": "P13473", "url": "https://www.uniprot.org/uniprot/P13473#ptm_processing" }, { "database": "UniProtKB", "id": "P13473", "url": "https://www.uniprot.org/uniprot/P13473" } ], "reference": [ { "type": "PubMed", "id": "12754519", "url": "https://glygen.org/publication/PubMed/12754519" } ] }, { "title": "Isolation of dense granules from human platelets.", "journal": "Methods in enzymology", "date": "1992", "authors": "Fukami MH", "evidence": [ { "database": "Reactome", "id": "R-HSA-114608", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-114608" } ], "reference": [ { "type": "PubMed", "id": "1435334", "url": "https://glygen.org/publication/PubMed/1435334" } ] }, { "title": "Characterization of the proteins released from activated platelets leads to localization of novel platelet proteins in human atherosclerotic lesions.", "journal": "Blood", "date": "2004", "authors": "Coppinger JA, Cagney G, Toomey S, Kislinger T, Belton O, McRedmond JP, Cahill DJ, Emili A, Fitzgerald DJ, Maguire PB", "evidence": [ { "database": "Reactome", "id": "R-HSA-114608", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-114608" } ], "reference": [ { "type": "PubMed", "id": "14630798", "url": "https://glygen.org/publication/PubMed/14630798" } ] }, { "title": "The nucleotide transporter MRP4 (ABCC4) is highly expressed in human platelets and present in dense granules, indicating a role in mediator storage.", "journal": "Blood", "date": "2004", "authors": "Jedlitschky G, Tirschmann K, Lubenow LE, Nieuwenhuis HK, Akkerman JW, Greinacher A, Kroemer HK", "evidence": [ { "database": "Reactome", "id": "R-HSA-114608", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-114608" } ], "reference": [ { "type": "PubMed", "id": "15297306", "url": "https://glygen.org/publication/PubMed/15297306" } ] }, { "title": "Signal peptide prediction based on analysis of experimentally verified cleavage sites.", "journal": "Protein Sci.", "date": "2004", "authors": "Zhang Z, Henzel WJ", "evidence": [ { "database": "UniProtKB", "id": "P13473", "url": "https://www.uniprot.org/uniprot/P13473" } ], "reference": [ { "type": "PubMed", "id": "15340161", "url": "https://glygen.org/publication/PubMed/15340161" } ] }, { "title": "Glycogen storage diseases presenting as hypertrophic cardiomyopathy.", "journal": "The New England journal of medicine", "date": "2005", "authors": "Arad M, Maron BJ, Gorham JM, Johnson WH Jr, Saul JP, Perez-Atayde AR, Spirito P, Wright GB, Kanter RJ, Seidman CE, Seidman JG", "evidence": [ { "database": "UniProtKB", "id": "P13473", "url": "https://www.uniprot.org/uniprot/P13473" } ], "reference": [ { "type": "PubMed", "id": "15673802", "url": "https://glygen.org/publication/PubMed/15673802" } ] }, { "title": "Lamp-2a facilitates MHC class II presentation of cytoplasmic antigens.", "journal": "Immunity", "date": "2005-05", "authors": "Zhou Delu, Li Ping, Lin Yinling, Lott Jeremy M, Hislop Andrew D, Canaday David H, Brutkiewicz Randy R, Blum Janice S", "evidence": [ { "database": "UniProtKB", "id": "P13473", "url": "https://www.uniprot.org/uniprot/P13473" } ], "reference": [ { "type": "PubMed", "id": "15894275", "url": "https://glygen.org/publication/PubMed/15894275" } ] }, { "title": "Asymptomatic hyperCKemia in a case of Danon disease due to a missense mutation in Lamp-2 gene.", "journal": "Neuromuscular disorders : NMD", "date": "2005", "authors": "Musumeci O, Rodolico C, Nishino I, Di Guardo G, Migliorato A, Aguennouz M, Mazzeo A, Messina C, Vita G, Toscano A", "evidence": [ { "database": "UniProtKB", "id": "P13473", "url": "https://www.uniprot.org/uniprot/P13473" } ], "reference": [ { "type": "PubMed", "id": "15907287", "url": "https://glygen.org/publication/PubMed/15907287" } ] }, { "title": "Unifying nomenclature for the isoforms of the lysosomal membrane protein LAMP-2.", "journal": "Traffic", "date": "2005", "authors": "Eskelinen Eeva-Liisa, Cuervo Ana Maria, Taylor Matthew R G, Nishino Ichizo, Blum Janice S, Dice J Fred, Sandoval Ignacio V, Lippincott-Schwartz Jennifer, August J Thomas, Saftig Paul", "evidence": [ { "database": "UniProtKB", "id": "P13473", "url": "https://www.uniprot.org/uniprot/P13473" } ], "reference": [ { "type": "PubMed", "id": "16190986", "url": "https://glygen.org/publication/PubMed/16190986" } ] }, { "title": "Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.", "journal": "Journal of proteome research", "date": "2005", "authors": "Liu T, Qian WJ, Gritsenko MA, Camp DG 2nd, Monroe ME, Moore RJ, Smith RD", "evidence": [ { "database": "UniProtKB", "id": "P13473", "url": "https://www.uniprot.org/uniprot/P13473#ptm_processing" }, { "database": "UniProtKB", "id": "P13473", "url": "https://www.uniprot.org/uniprot/P13473" } ], "reference": [ { "type": "PubMed", "id": "16335952", "url": "https://glygen.org/publication/PubMed/16335952" } ] }, { "title": "Integral and associated lysosomal membrane proteins.", "journal": "Traffic", "date": "2007", "authors": "Schroder B, Wrocklage C, Pan C, Jager R, Kosters B, Schafer H, Elsasser HP, Mann M, Hasilik A", "evidence": [ { "database": "UniProtKB", "id": "P13473", "url": "https://www.uniprot.org/uniprot/P13473" } ], "reference": [ { "type": "PubMed", "id": "17897319", "url": "https://glygen.org/publication/PubMed/17897319" } ] }, { "title": "The chaperone-mediated autophagy receptor organizes in dynamic protein complexes at the lysosomal membrane.", "journal": "Molecular and cellular biology", "date": "2008", "authors": "Bandyopadhyay U, Kaushik S, Varticovski L, Cuervo AM", "evidence": [ { "database": "UniProtKB", "id": "P13473", "url": "https://www.uniprot.org/uniprot/P13473" }, { "database": "Reactome", "id": "R-HSA-9613829", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9613829" } ], "reference": [ { "type": "PubMed", "id": "18644871", "url": "https://glygen.org/publication/PubMed/18644871" } ] }, { "title": "Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.", "journal": "Journal of proteome research", "date": "2009", "authors": "Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H", "evidence": [ { "database": "UniProtKB", "id": "P13473", "url": "https://www.uniprot.org/uniprot/P13473#ptm_processing" }, { "database": "UniProtKB", "id": "P13473", "url": "https://www.uniprot.org/uniprot/P13473" } ], "reference": [ { "type": "PubMed", "id": "19159218", "url": "https://glygen.org/publication/PubMed/19159218" } ] }, { "title": "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.", "journal": "Science signaling", "date": "2010", "authors": "Olsen JV, Vermeulen M, Santamaria A, Kumar C, Miller ML, Jensen LJ, Gnad F, Cox J, Jensen TS, Nigg EA, Brunak S, Mann M", "evidence": [ { "database": "iPTMnet", "id": "P13473-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P13473-1" } ], "reference": [ { "type": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ] }, { "title": "LAMP-2-deficient human B cells exhibit altered MHC class II presentation of exogenous antigens.", "journal": "Immunology", "date": "2010-11", "authors": "Crotzer Victoria L, Glosson Nicole, Zhou Delu, Nishino Ichizo, Blum Janice S", "evidence": [ { "database": "UniProtKB", "id": "P13473", "url": "https://www.uniprot.org/uniprot/P13473" } ], "reference": [ { "type": "PubMed", "id": "20518820", "url": "https://glygen.org/publication/PubMed/20518820" } ] }, { "title": "Identification of regulators of chaperone-mediated autophagy.", "journal": "Molecular cell", "date": "2010", "authors": "Bandyopadhyay U, Sridhar S, Kaushik S, Kiffin R, Cuervo AM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9613829", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9613829" } ], "reference": [ { "type": "PubMed", "id": "20797626", "url": "https://glygen.org/publication/PubMed/20797626" } ] }, { "title": "Chaperone-mediated autophagy at a glance.", "journal": "Journal of cell science", "date": "2011", "authors": "Kaushik S, Bandyopadhyay U, Sridhar S, Kiffin R, Martinez-Vicente M, Kon M, Orenstein SJ, Wong E, Cuervo AM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9613829", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9613829" } ], "reference": [ { "type": "PubMed", "id": "21282471", "url": "https://glygen.org/publication/PubMed/21282471" } ] }, { "title": "The polylactosaminoglycans of human lysosomal membrane glycoproteins lamp-1 and lamp-2. Localization on the peptide backbones.", "journal": "The Journal of biological chemistry", "date": "1990", "authors": "Carlsson SR, Fukuda M", "evidence": [ { "database": "UniProtKB", "id": "P13473", "url": "https://www.uniprot.org/uniprot/P13473" } ], "reference": [ { "type": "PubMed", "id": "2243102", "url": "https://glygen.org/publication/PubMed/2243102" } ] }, { "title": "The lysosomal polypeptide transporter TAPL is stabilized by interaction with LAMP-1 and LAMP-2.", "journal": "J. Cell Sci.", "date": "2012", "authors": "Demirel \u00d6zlem, Jan Irina, Wolters Dirk, Blanz Judith, Saftig Paul, Tamp\u00e9 Robert, Abele Rupert", "evidence": [ { "database": "UniProtKB", "id": "P13473", "url": "https://www.uniprot.org/uniprot/P13473" } ], "reference": [ { "type": "PubMed", "id": "22641697", "url": "https://glygen.org/publication/PubMed/22641697" } ] }, { "title": "Quantification of the N-glycosylated secretome by super-SILAC during breast cancer progression and in human blood samples.", "journal": "Molecular & cellular proteomics : MCP", "date": "2013", "authors": "Boersema PJ, Geiger T, Wisniewski JR, Mann M", "evidence": [ { "database": "GlyGen", "id": "GLY_000143", "url": "https://data.glygen.org/GLY_000143" } ], "reference": [ { "type": "PubMed", "id": "23090970", "url": "https://glygen.org/publication/PubMed/23090970" } ] }, { "title": "Proteome wide purification and identification of O-GlcNAc-modified proteins using click chemistry and mass spectrometry.", "journal": "Journal of proteome research", "date": "2013", "authors": "Hahne H, Sobotzki N, Nyberg T, Helm D, Borodkin VS, van Aalten DM, Agnew B, Kuster B", "evidence": [ { "database": "O-GlcNAc Database", "id": "P13473", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P13473" } ], "reference": [ { "type": "PubMed", "id": "23301498", "url": "https://glygen.org/publication/PubMed/23301498" } ] }, { "title": "Glycoproteomic analysis of the secretome of human endothelial cells.", "journal": "Molecular & cellular proteomics : MCP", "date": "2013", "authors": "Yin X, Bern M, Xing Q, Ho J, Viner R, Mayr M", "evidence": [ { "database": "UniCarbKB", "id": "P13473", "url": "" }, { "database": "GlyConnect", "id": "356", "url": "https://glyconnect.expasy.org/browser/proteins/356" } ], "reference": [ { "type": "PubMed", "id": "23345538", "url": "https://glygen.org/publication/PubMed/23345538" } ] }, { "title": "Precision mapping of the human O-GalNAc glycoproteome through SimpleCell technology.", "journal": "The EMBO journal", "date": "2013", "authors": "Steentoft C, Vakhrushev SY, Joshi HJ, Kong Y, Vester-Christensen MB, Schjoldager KT, Lavrsen K, Dabelsteen S, Pedersen NB, Marcos-Silva L, Gupta R, Bennett EP, Mandel U, Brunak S, Wandall HH, Levery SB, Clausen H", "evidence": [ { "database": "UniCarbKB", "id": "P13473", "url": "" } ], "reference": [ { "type": "PubMed", "id": "23584533", "url": "https://glygen.org/publication/PubMed/23584533" } ] }, { "title": "High precision platelet releasate definition by quantitative reversed protein profiling--brief report.", "journal": "Arteriosclerosis, thrombosis, and vascular biology", "date": "2013", "authors": "Wijten P, van Holten T, Woo LL, Bleijerveld OB, Roest M, Heck AJ, Scholten A", "evidence": [ { "database": "Reactome", "id": "R-HSA-114608", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-114608" } ], "reference": [ { "type": "PubMed", "id": "23640497", "url": "https://glygen.org/publication/PubMed/23640497" } ] }, { "title": "Proteome profiling of human neutrophil granule subsets, secretory vesicles, and cell membrane: correlation with transcriptome profiling of neutrophil precursors.", "journal": "Journal of leukocyte biology", "date": "2013", "authors": "Rorvig S, Ostergaard O, Heegaard NH, Borregaard N", "evidence": [ { "database": "Reactome", "id": "R-HSA-6798695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6798695" } ], "reference": [ { "type": "PubMed", "id": "23650620", "url": "https://glygen.org/publication/PubMed/23650620" } ] }, { "title": "N-linked glycosylation enrichment for in-depth cell surface proteomics of diffuse large B-cell lymphoma subtypes.", "journal": "Molecular & cellular proteomics : MCP", "date": "2014", "authors": "Deeb SJ, Cox J, Schmidt-Supprian M, Mann M", "evidence": [ { "database": "GlyGen", "id": "GLY_000143", "url": "https://data.glygen.org/GLY_000143" } ], "reference": [ { "type": "PubMed", "id": "24190977", "url": "https://glygen.org/publication/PubMed/24190977" } ] }, { "title": "Degradation of AF1Q by chaperone-mediated autophagy.", "journal": "Experimental cell research", "date": "2014-09-10", "authors": "Li Peng, Ji Min, Lu Fei, Zhang Jingru, Li Huanjie, Cui Taixing, Li Wang Xing, Tang Dongqi, Ji Chunyan", "evidence": [ { "database": "UniProtKB", "id": "P13473", "url": "https://www.uniprot.org/uniprot/P13473" } ], "reference": [ { "type": "PubMed", "id": "24880125", "url": "https://glygen.org/publication/PubMed/24880125" } ] }, { "title": "Structure of transmembrane domain of lysosome-associated membrane protein type 2a (LAMP-2A) reveals key features for substrate specificity in chaperone-mediated autophagy.", "journal": "J. Biol. Chem.", "date": "2014", "authors": "Rout Ashok K, Strub Marie-Paule, Piszczek Grzegorz, Tjandra Nico", "evidence": [ { "database": "UniProtKB", "id": "P13473", "url": "https://www.uniprot.org/uniprot/P13473" } ], "reference": [ { "type": "PubMed", "id": "25342746", "url": "https://glygen.org/publication/PubMed/25342746" } ] }, { "title": "Probing the O-glycoproteome of gastric cancer cell lines for biomarker discovery.", "journal": "Molecular & cellular proteomics : MCP", "date": "2015", "authors": "Campos D, Freitas D, Gomes J, Magalhaes A, Steentoft C, Gomes C, Vester-Christensen MB, Ferreira JA, Afonso LP, Santos LL, Pinto de Sousa J, Mandel U, Clausen H, Vakhrushev SY, Reis CA", "evidence": [ { "database": "UniCarbKB", "id": "P13473", "url": "" } ], "reference": [ { "type": "PubMed", "id": "25813380", "url": "https://glygen.org/publication/PubMed/25813380" } ] }, { "title": "Lysosomal mTORC2/PHLPP1/Akt Regulate Chaperone-Mediated Autophagy.", "journal": "Molecular cell", "date": "2015", "authors": "Arias E, Koga H, Diaz A, Mocholi E, Patel B, Cuervo AM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9613829", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9613829" } ], "reference": [ { "type": "PubMed", "id": "26118642", "url": "https://glygen.org/publication/PubMed/26118642" } ] }, { "title": "LAMP-2C Inhibits MHC Class II Presentation of Cytoplasmic Antigens by Disrupting Chaperone-Mediated Autophagy.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2016-03-15", "authors": "P\u00e9rez Liliana, McLetchie Shawna, Gardiner Gail J, Deffit Sarah N, Zhou Delu, Blum Janice S", "evidence": [ { "database": "UniProtKB", "id": "P13473", "url": "https://www.uniprot.org/uniprot/P13473" } ], "reference": [ { "type": "PubMed", "id": "26856698", "url": "https://glygen.org/publication/PubMed/26856698" } ] }, { "title": "LAMP-2 is required for incorporating syntaxin-17 into autophagosomes and for their fusion with lysosomes.", "journal": "Biology open", "date": "2016", "authors": "Hubert V, Peschel A, Langer B, Groger M, Rees A, Kain R", "evidence": [ { "database": "UniProtKB", "id": "P13473", "url": "https://www.uniprot.org/uniprot/P13473" } ], "reference": [ { "type": "PubMed", "id": "27628032", "url": "https://glygen.org/publication/PubMed/27628032" } ] }, { "title": "A novel strategy for global mapping of O-GlcNAc proteins and peptides using selective enzymatic deglycosylation, HILIC enrichment and mass spectrometry identification.", "journal": "Talanta", "date": "2017", "authors": "Shen B, Zhang W, Shi Z, Tian F, Deng Y, Sun C, Wang G, Qin W, Qian X", "evidence": [ { "database": "O-GlcNAc Database", "id": "P13473", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P13473" } ], "reference": [ { "type": "PubMed", "id": "28411811", "url": "https://glygen.org/publication/PubMed/28411811" } ] }, { "title": "Purification and characterization of human lysosomal membrane glycoproteins.", "journal": "Archives of biochemistry and biophysics", "date": "1989", "authors": "Mane SM, Marzella L, Bainton DF, Holt VK, Cha Y, Hildreth JE, August JT", "evidence": [ { "database": "UniProtKB", "id": "P13473", "url": "https://www.uniprot.org/uniprot/P13473" } ], "reference": [ { "type": "PubMed", "id": "2912382", "url": "https://glygen.org/publication/PubMed/2912382" } ] }, { "title": "Large-scale intact glycopeptide identification by Mascot database search.", "journal": "Scientific reports", "date": "2018", "authors": "Bollineni RC, Koehler CJ, Gislefoss RE, Anonsen JH, Thiede B", "evidence": [ { "database": "GlyConnect", "id": "356", "url": "https://glyconnect.expasy.org/browser/proteins/356" } ], "reference": [ { "type": "PubMed", "id": "29391424", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "title": "The coming of age of chaperone-mediated autophagy.", "journal": "Nature reviews. Molecular cell biology", "date": "2018", "authors": "Kaushik S, Cuervo AM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9613829", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9613829" } ], "reference": [ { "type": "PubMed", "id": "29626215", "url": "https://glygen.org/publication/PubMed/29626215" } ] }, { "title": "Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and alpha-1B-Glycoprotein.", "journal": "Analytical chemistry", "date": "2018", "authors": "Sun S, Hu Y, Jia L, Eshghi ST, Liu Y, Shah P, Zhang H", "evidence": [ { "database": "UniCarbKB", "id": "P13473", "url": "" }, { "database": "GlyConnect", "id": "356", "url": "https://glyconnect.expasy.org/browser/proteins/356" } ], "reference": [ { "type": "PubMed", "id": "29671580", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "title": "Reanalysis of Global Proteomic and Phosphoproteomic Data Identified a Large Number of Glycopeptides.", "journal": "Analytical chemistry", "date": "2018", "authors": "Hu Y, Shah P, Clark DJ, Ao M, Zhang H", "evidence": [ { "database": "UniCarbKB", "id": "P13473", "url": "" }, { "database": "GlyConnect", "id": "356", "url": "https://glyconnect.expasy.org/browser/proteins/356" } ], "reference": [ { "type": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "title": "An Isotope-Coded Photocleavable Probe for Quantitative Profiling of Protein O-GlcNAcylation.", "journal": "ACS chemical biology", "date": "2019", "authors": "Li J, Li Z, Duan X, Qin K, Dang L, Sun S, Cai L, Hsieh-Wilson LC, Wu L, Yi W", "evidence": [ { "database": "O-GlcNAc Atlas", "id": "P13473", "url": "https://oglcnac.org/atlas/detail/P13473" } ], "reference": [ { "type": "PubMed", "id": "30620550", "url": "https://glygen.org/publication/PubMed/30620550" } ] }, { "title": "Cloning of cDNAs encoding human lysosomal membrane glycoproteins, h-lamp-1 and h-lamp-2. Comparison of their deduced amino acid sequences.", "journal": "J. Biol. Chem.", "date": "1988", "authors": "Fukuda M, Viitala J, Matteson J, Carlsson S R", "evidence": [ { "database": "UniProtKB", "id": "P13473", "url": "https://www.uniprot.org/uniprot/P13473" } ], "reference": [ { "type": "PubMed", "id": "3198605", "url": "https://glygen.org/publication/PubMed/3198605" } ] }, { "title": "Lysosome-Associated Membrane Proteins Support the Furin-Mediated Processing of the Mumps Virus Fusion Protein.", "journal": "Journal of virology", "date": "2020", "authors": "Ueo A, Kubota M, Shirogane Y, Ohno S, Hashiguchi T, Yanagi Y", "evidence": [ { "database": "UniProtKB", "id": "P13473", "url": "https://www.uniprot.org/uniprot/P13473" } ], "reference": [ { "type": "PubMed", "id": "32295904", "url": "https://glygen.org/publication/PubMed/32295904" } ] }, { "title": "O-GlcNAc modification regulates MTA1 transcriptional activity during breast cancer cell genotoxic adaptation.", "journal": "Biochimica et biophysica acta. General subjects", "date": "2021", "authors": "Xie X, Wu Q, Zhang K, Liu Y, Zhang N, Chen Q, Wang L, Li W, Zhang J, Liu Y", "evidence": [ { "database": "O-GlcNAc Database", "id": "P13473", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P13473" } ], "reference": [ { "type": "PubMed", "id": "34019948", "url": "https://glygen.org/publication/PubMed/34019948" } ] }, { "title": "Tumor cells express pauci- and oligomannosidic N-glycans in glycoproteins recognized by the mannose receptor (CD206).", "journal": "Cellular and molecular life sciences : CMLS", "date": "2021", "authors": "Stavenhagen K, Laan LC, Gao C, Mehta AY, Heimburg-Molinaro J, Glickman JN, van Die I, Cummings RD", "evidence": [ { "database": "UniCarbKB", "id": "P13473", "url": "" } ], "reference": [ { "type": "PubMed", "id": "34089345", "url": "https://glygen.org/publication/PubMed/34089345" } ] }, { "title": "Truncation of the TPR domain of OGT alters substrate and glycosite selection.", "journal": "Analytical and bioanalytical chemistry", "date": "2021", "authors": "Ramirez DH, Yang B, D'Souza AK, Shen D, Woo CM", "evidence": [ { "database": "O-GlcNAc Database", "id": "P13473", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P13473" } ], "reference": [ { "type": "PubMed", "id": "34725712", "url": "https://glygen.org/publication/PubMed/34725712" } ] }, { "title": "Simultaneously Identifying and Distinguishing Glycoproteins with O-GlcNAc and O-GalNAc (the Tn Antigen) in Human Cancer Cells.", "journal": "Analytical chemistry", "date": "2022", "authors": "Xu S, Zheng J, Xiao H, Wu R", "evidence": [ { "database": "O-GlcNAc Database", "id": "P13473", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P13473" } ], "reference": [ { "type": "PubMed", "id": "35132862", "url": "https://glygen.org/publication/PubMed/35132862" } ] }, { "title": "Design and Preparation of Novel Nitro-Oxide-Grafted Nanospheres with Enhanced Hydrogen Bonding Interaction for O-GlcNAc Analysis.", "journal": "ACS applied materials & interfaces", "date": "2022-10-26", "authors": "Wu Ci, Shi Song, Hou Chunyan, Luo Yang, Byers Stephen, Ma Junfeng", "evidence": [ { "database": "O-GlcNAc Database", "id": "P13473", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P13473" } ], "reference": [ { "type": "PubMed", "id": "36240223", "url": "https://glygen.org/publication/PubMed/36240223" } ] }, { "title": "Deficiency of cancer/testis antigen gene CT55 causes male infertility in humans and mice.", "journal": "Cell Death Differ.", "date": "2023", "authors": "Zhang Guohui, Jiang Chuan, Yang Yushang, Wang Yan, Zhou Haimeng, Dai Siyu, Liu Mohan, Yang Yanting, Yang Li, Shen Qiongyan, Zhang Tao, Zhang Xiaodong, Yang Yihong, Shen Ying", "evidence": [ { "database": "UniProtKB", "id": "P13473", "url": "https://www.uniprot.org/uniprot/P13473" } ], "reference": [ { "type": "PubMed", "id": "36481789", "url": "https://glygen.org/publication/PubMed/36481789" } ] }, { "title": "Palmitoylation prevents sustained inflammation by limiting NLRP3 inflammasome activation through chaperone-mediated autophagy.", "journal": "Molecular cell", "date": "2022-12-20", "authors": "Wang Liqiu, Cai Jing, Zhao Xin, Ma Ling, Zeng Ping, Zhou Lingli, Liu Yukun, Yang Shuai, Cai Zhe, Zhang Song, Zhou Liang, Yang Jiahui, Liu Tao, Jin Shouheng, Cui Jun", "evidence": [ { "database": "UniProtKB", "id": "P13473", "url": "https://www.uniprot.org/uniprot/P13473" } ], "reference": [ { "type": "PubMed", "id": "36586411", "url": "https://glygen.org/publication/PubMed/36586411" } ] }, { "title": "Identification of a novel splicing-altering LAMP2 variant in a Chinese family with Danon disease.", "journal": "ESC heart failure", "date": "2023-08", "authors": "Fu Di, Wang Shuai, Luo Yonghong, Wu Sha, Peng Daoquan", "evidence": [ { "database": "RefSeq", "id": "NP_001116078", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001116078" } ], "reference": [ { "type": "PubMed", "id": "37277924", "url": "https://glygen.org/publication/PubMed/37277924" } ] }, { "title": "Identification and functional analysis of a novel de novo missense mutation located in the initiation codon of LAMP2 associated with early onset female Danon disease.", "journal": "Molecular genetics & genomic medicine", "date": "2023-09", "authors": "Wang Yongxiang, Bai Ming, Zhang Piyi, Peng Yu, Chen Zixian, He Zhiyu, Xu Jin, Zhu Youqi, Yan Dongdong, Wang Runqing, Zhang Zheng", "evidence": [ { "database": "RefSeq", "id": "NP_001116078", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001116078" } ], "reference": [ { "type": "PubMed", "id": "37288668", "url": "https://glygen.org/publication/PubMed/37288668" } ] }, { "title": "Lysosomal LAMP proteins regulate lysosomal pH by direct inhibition of the TMEM175 channel.", "journal": "Molecular cell", "date": "2023-07-20", "authors": "Zhang Jiyuan, Zeng Weizhong, Han Yan, Lee Wan-Ru, Liou Jen, Jiang Youxing", "evidence": [ { "database": "UniProtKB", "id": "P13473", "url": "https://www.uniprot.org/uniprot/P13473" }, { "database": "RefSeq", "id": "NP_001116078", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001116078" } ], "reference": [ { "type": "PubMed", "id": "37390818", "url": "https://glygen.org/publication/PubMed/37390818" } ] }, { "title": "Danon Disease: Entire LAMP2 Gene Deletion with Unusual Clinical Presentation-Case Report and Review of the Literature.", "journal": "Genes", "date": "2023-07-27", "authors": "Shalata Adel, Bar-Shai Marina, Hadid Yarin, Mahroum Muhammad, Mintz Hila, Shalata Zaher Eldin, Radzishevsky Evgeny, Genizi Jacob, Lorber Avraham, Ben-Yosef Tamar, Yaniv Liat", "evidence": [ { "database": "RefSeq", "id": "NP_001116078", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001116078" } ], "reference": [ { "type": "PubMed", "id": "37628591", "url": "https://glygen.org/publication/PubMed/37628591" } ] }, { "title": "Characterization of the proteins of isolated human platelet alpha-granules. Evidence for a separate alpha-granule-pool of the glycoproteins IIb and IIIa.", "journal": "Biochimica et biophysica acta", "date": "1981", "authors": "Gogstad GO, Hagen I, Korsmo R, Solum NO", "evidence": [ { "database": "Reactome", "id": "R-HSA-114608", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-114608" } ], "reference": [ { "type": "PubMed", "id": "6457647", "url": "https://glygen.org/publication/PubMed/6457647" } ] }, { "title": "An alternatively spliced form of the human lysosome-associated membrane protein-2 gene is expressed in a tissue-specific manner.", "journal": "Biochem. Biophys. Res. Commun.", "date": "1995", "authors": "Konecki D S, Foetisch K, Zimmer K P, Schlotter M, Lichter-Konecki U", "evidence": [ { "database": "UniProtKB", "id": "P13473", "url": "https://www.uniprot.org/uniprot/P13473" } ], "reference": [ { "type": "PubMed", "id": "7488019", "url": "https://glygen.org/publication/PubMed/7488019" } ] }, { "title": "Complete cDNA sequence of human lysosome-associated membrane protein-2.", "journal": "Biochem. Biophys. Res. Commun.", "date": "1994", "authors": "Konecki D S, Foetisch K, Schlotter M, Lichter-Konecki U", "evidence": [ { "database": "UniProtKB", "id": "P13473", "url": "https://www.uniprot.org/uniprot/P13473" } ], "reference": [ { "type": "PubMed", "id": "7999007", "url": "https://glygen.org/publication/PubMed/7999007" } ] }, { "title": "Assignment of O-glycan attachment sites to the hinge-like regions of human lysosomal membrane glycoproteins lamp-1 and lamp-2.", "journal": "Archives of biochemistry and biophysics", "date": "1993", "authors": "Carlsson SR, Lycksell PO, Fukuda M", "evidence": [ { "database": "UniProtKB", "id": "P13473", "url": "https://www.uniprot.org/uniprot/P13473#ptm_processing" }, { "database": "UniProtKB", "id": "P13473", "url": "https://www.uniprot.org/uniprot/P13473" }, { "database": "UniCarbKB", "id": "P13473", "url": "" }, { "database": "Automatic Literature Mining", "id": "8323299", "url": "https://research.bioinformatics.udel.edu/glyco/pmid/8323299" }, { "database": "GlyConnect", "id": "356", "url": "https://glyconnect.expasy.org/browser/proteins/356" } ], "reference": [ { "type": "PubMed", "id": "8323299", "url": "https://glygen.org/publication/PubMed/8323299" } ] }, { "title": "Molecular and cellular characterization of Mex-/methylation-resistant phenotype. Gene and cDNA cloning, serum dependence, and tumor suppression of transfectant strains.", "journal": "J. Biol. Chem.", "date": "1993", "authors": "Fritz G, Dosch J, Thielmann H W, Kaina B", "evidence": [ { "database": "UniProtKB", "id": "P13473", "url": "https://www.uniprot.org/uniprot/P13473" } ], "reference": [ { "type": "PubMed", "id": "8407947", "url": "https://glygen.org/publication/PubMed/8407947" } ] }, { "title": "Platelet alpha-granules.", "journal": "Blood reviews", "date": "1993", "authors": "Harrison P, Cramer EM", "evidence": [ { "database": "Reactome", "id": "R-HSA-114608", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-114608" } ], "reference": [ { "type": "PubMed", "id": "8467233", "url": "https://glygen.org/publication/PubMed/8467233" } ] }, { "title": "The genes of major lysosomal membrane glycoproteins, lamp-1 and lamp-2. 5'-flanking sequence of lamp-2 gene and comparison of exon organization in two genes.", "journal": "J. Biol. Chem.", "date": "1993", "authors": "Sawada R, Jardine K A, Fukuda M", "evidence": [ { "database": "UniProtKB", "id": "P13473", "url": "https://www.uniprot.org/uniprot/P13473" } ], "reference": [ { "type": "PubMed", "id": "8517882", "url": "https://glygen.org/publication/PubMed/8517882" } ] }, { "title": "A receptor for the selective uptake and degradation of proteins by lysosomes.", "journal": "Science (New York, N.Y.)", "date": "1996", "authors": "Cuervo AM, Dice JF", "evidence": [ { "database": "UniProtKB", "id": "P13473", "url": "https://www.uniprot.org/uniprot/P13473" }, { "database": "Reactome", "id": "R-HSA-9613829", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9613829" } ], "reference": [ { "type": "PubMed", "id": "8662539", "url": "https://glygen.org/publication/PubMed/8662539" } ] }, { "title": "Targeting of proteins to granule subsets is determined by timing and not by sorting: The specific granule protein NGAL is localized to azurophil granules when expressed in HL-60 cells.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1996", "authors": "Le Cabec V, Cowland JB, Calafat J, Borregaard N", "evidence": [ { "database": "Reactome", "id": "R-HSA-6798695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6798695" } ], "reference": [ { "type": "PubMed", "id": "8692836", "url": "https://glygen.org/publication/PubMed/8692836" } ] }, { "title": "A population of rat liver lysosomes responsible for the selective uptake and degradation of cytosolic proteins.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Cuervo AM, Dice JF, Knecht E", "evidence": [ { "database": "Reactome", "id": "R-HSA-9613829", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9613829" } ], "reference": [ { "type": "PubMed", "id": "9038169", "url": "https://glygen.org/publication/PubMed/9038169" } ] }, { "title": "An intralysosomal hsp70 is required for a selective pathway of lysosomal protein degradation.", "journal": "The Journal of cell biology", "date": "1997", "authors": "Agarraberes FA, Terlecky SR, Dice JF", "evidence": [ { "database": "Reactome", "id": "R-HSA-9613829", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9613829" } ], "reference": [ { "type": "PubMed", "id": "9151685", "url": "https://glygen.org/publication/PubMed/9151685" } ] } ], "pathway": [ { "id": "hsa:3920", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:3920", "resource": "KEGG Pathway" }, { "id": "R-HSA-114608", "name": "Platelet degranulation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-114608", "resource": "Reactome", "description": "Platelet degranulation" }, { "id": "R-HSA-6798695", "name": "Neutrophil degranulation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6798695", "resource": "Reactome", "description": "Neutrophil degranulation" }, { "id": "R-HSA-9613829", "name": "Chaperone Mediated Autophagy", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9613829", "resource": "Reactome", "description": "Chaperone Mediated Autophagy" } ], "orthologs": [ { "uniprot_canonical_ac": "P17046-1", "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "Lamp2", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MRLLSPVTGSKLVLLFLFLGAVRSDALKLNLTDSKGTCLYAEWEMNFTITYEALKVNETVTITVPDKVTYNGSSCGDDKNGAKIMIQYGSTLSWAVNFTKEASQYFINNITLSYNTNDTKTFPGAVPKGILTVIIPVGSQLPLGVIFKCSSVLTFNLSPVVQHYWGIHLQAFVQNGTVSKHEQVCKEDKTATTVAPIIHTTVPSPTTTLTPTSIPVPTPTVGNYTISNGNATCLLATMGLQLNITEEKVPFIFNINPAITNFTGSCQPQTAQLRLNNSQIKYLDFIFAVKNEKRFYLKEVNVNMYLANGSAFHVSNNNLSFWDAPLGSSYMCNKEQVVSVSRTFQINTFNLKVQPFNVTKGEYSTAQDCSADEDNFLVPIAVGAALGGVLILVLLAYFIGLKRHHTGYEQF", "length": 411 }, "evidence": [ { "id": "45924488", "url": "http://www.informatics.jax.org/homology/45924488", "database": "MGI" }, { "id": "P13473", "url": "https://omabrowser.org/oma/group/P13473/", "database": "OMA" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "P17047-1", "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "Lamp2", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MCLSPVKGAKLILIFLFLGAVQSNALIVNLTDSKGTCLYAEWEMNFTITYETTNQTNKTITIAVPDKATHDGSSCGDDRNSAKIMIQFGFAVSWAVNFTKEASHYSIHDIVLSYNTSDSTVFPGAVAKGVHTVKNPENFKVPLDVIFKCNSVLTYNLTPVVQKYWGIHLQAFVQNGTVSKNEQVCEEDQTPTTVAPIIHTTAPSTTTTLTPTSTPTPTPTPTPTVGNYSIRNGNTTCLLATMGLQLNITEEKVPFIFNINPATTNFTGSCQPQSAQLRLNNSQIKYLDFIFAVKNEKRFYLKEVNVYMYLANGSAFNISNKNLSFWDAPLGSSYMCNKEQVLSVSRAFQINTFNLKVQPFNVTKGQYSTAQDCSADEDNFLVPIAVGAALGGVLILVLLAYFIGLKRHHTGYEQF", "length": 415 }, "evidence": [ { "id": "45924488", "url": "http://www.informatics.jax.org/homology/45924488", "database": "MGI" }, { "id": "P13473", "url": "https://omabrowser.org/oma/group/P13473/", "database": "OMA" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 14, "go_terms": [ { "name": "autophagosome maturation", "id": "GO:0097352", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0097352", "evidence": [ { "database": "UniProtKB", "id": "P13473", "url": "https://www.uniprot.org/uniprot/P13473" } ], "pmid": "" }, { "name": "chaperone-mediated autophagy", "id": "GO:0061684", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0061684", "evidence": [ { "database": "UniProtKB", "id": "P13473", "url": "https://www.uniprot.org/uniprot/P13473" } ], "pmid": "" }, { "name": "muscle cell cellular homeostasis", "id": "GO:0046716", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046716", "evidence": [ { "database": "UniProtKB", "id": "P13473", "url": "https://www.uniprot.org/uniprot/P13473" } ], "pmid": "" }, { "name": "protein targeting", "id": "GO:0006605", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006605", "evidence": [ { "database": "UniProtKB", "id": "P13473", "url": "https://www.uniprot.org/uniprot/P13473" } ], "pmid": "" }, { "name": "protein stabilization", "id": "GO:0050821", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050821", "evidence": [ { "database": "UniProtKB", "id": "P13473", "url": "https://www.uniprot.org/uniprot/P13473" } ], "pmid": "" }, { "name": "regulation of protein stability", "id": "GO:0031647", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031647", "evidence": [ { "database": "UniProtKB", "id": "P13473", "url": "https://www.uniprot.org/uniprot/P13473" } ], "pmid": "" }, { "name": "negative regulation of protein-containing complex assembly", "id": "GO:0031333", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031333", "evidence": [ { "database": "UniProtKB", "id": "P13473", "url": "https://www.uniprot.org/uniprot/P13473" } ], "pmid": "" }, { "name": "cellular response to starvation", "id": "GO:0009267", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009267", "evidence": [ { "database": "UniProtKB", "id": "P13473", "url": "https://www.uniprot.org/uniprot/P13473" } ], "pmid": "" }, { "name": "protein catabolic process", "id": "GO:0030163", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030163", "evidence": [ { "database": "UniProtKB", "id": "P13473", "url": "https://www.uniprot.org/uniprot/P13473" } ], "pmid": "" }, { "name": "protein import", "id": "GO:0017038", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0017038", "evidence": [ { "database": "UniProtKB", "id": "P13473", "url": "https://www.uniprot.org/uniprot/P13473" } ], "pmid": "" }, { "name": "lysosomal lumen acidification", "id": "GO:0007042", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007042", "evidence": [ { "database": "UniProtKB", "id": "P13473", "url": "https://www.uniprot.org/uniprot/P13473" } ], "pmid": "" }, { "name": "lysosomal protein catabolic process", "id": "GO:1905146", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1905146", "evidence": [ { "database": "UniProtKB", "id": "P13473", "url": "https://www.uniprot.org/uniprot/P13473" } ], "pmid": "" }, { "name": "protein targeting to lysosome involved in chaperone-mediated autophagy", "id": "GO:0061740", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0061740", "evidence": [ { "database": "UniProtKB", "id": "P13473", "url": "https://www.uniprot.org/uniprot/P13473" } ], "pmid": "" }, { "name": "negative regulation of NLRP3 inflammasome complex assembly", "id": "GO:1900226", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1900226", "evidence": [ { "database": "UniProtKB", "id": "P13473", "url": "https://www.uniprot.org/uniprot/P13473" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 20, "go_terms": [ { "name": "autophagosome membrane", "id": "GO:0000421", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000421", "evidence": [ { "database": "UniProtKB", "id": "P13473", "url": "https://www.uniprot.org/uniprot/P13473" } ], "pmid": "" }, { "name": "extracellular space", "id": "GO:0005615", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005615", "evidence": [ { "database": "UniProtKB", "id": "P13473", "url": "https://www.uniprot.org/uniprot/P13473" } ], "pmid": "" }, { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "P13473", "url": "https://www.uniprot.org/uniprot/P13473" } ], "pmid": "" }, { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "P13473", "url": "https://www.uniprot.org/uniprot/P13473" } ], "pmid": "" }, { "name": "intracellular membrane-bounded organelle", "id": "GO:0043231", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043231", "evidence": [ { "database": "UniProtKB", "id": "P13473", "url": "https://www.uniprot.org/uniprot/P13473" } ], "pmid": "" }, { "name": "perinuclear region of cytoplasm", "id": "GO:0048471", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048471", "evidence": [ { "database": "UniProtKB", "id": "P13473", "url": "https://www.uniprot.org/uniprot/P13473" } ], "pmid": "" }, { "name": "extracellular exosome", "id": "GO:0070062", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070062", "evidence": [ { "database": "UniProtKB", "id": "P13473", "url": "https://www.uniprot.org/uniprot/P13473" } ], "pmid": "" }, { "name": "lysosome", "id": "GO:0005764", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005764", "evidence": [ { "database": "UniProtKB", "id": "P13473", "url": "https://www.uniprot.org/uniprot/P13473" } ], "pmid": "" }, { "name": "lysosomal membrane", "id": "GO:0005765", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005765", "evidence": [ { "database": "UniProtKB", "id": "P13473", "url": "https://www.uniprot.org/uniprot/P13473" } ], "pmid": "" }, { "name": "late endosome membrane", "id": "GO:0031902", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031902", "evidence": [ { "database": "UniProtKB", "id": "P13473", "url": "https://www.uniprot.org/uniprot/P13473" } ], "pmid": "" }, { "name": "phagocytic vesicle membrane", "id": "GO:0030670", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030670", "evidence": [ { "database": "UniProtKB", "id": "P13473", "url": "https://www.uniprot.org/uniprot/P13473" } ], "pmid": "" }, { "name": "ficolin-1-rich granule membrane", "id": "GO:0101003", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0101003", "evidence": [ { "database": "UniProtKB", "id": "P13473", "url": "https://www.uniprot.org/uniprot/P13473" } ], "pmid": "" }, { "name": "late endosome", "id": "GO:0005770", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005770", "evidence": [ { "database": "UniProtKB", "id": "P13473", "url": "https://www.uniprot.org/uniprot/P13473" } ], "pmid": "" }, { "name": "azurophil granule membrane", "id": "GO:0035577", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035577", "evidence": [ { "database": "UniProtKB", "id": "P13473", "url": "https://www.uniprot.org/uniprot/P13473" } ], "pmid": "" }, { "name": "trans-Golgi network", "id": "GO:0005802", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005802", "evidence": [ { "database": "UniProtKB", "id": "P13473", "url": "https://www.uniprot.org/uniprot/P13473" } ], "pmid": "" }, { "name": "lysosomal lumen", "id": "GO:0043202", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043202", "evidence": [ { "database": "UniProtKB", "id": "P13473", "url": "https://www.uniprot.org/uniprot/P13473" } ], "pmid": "" }, { "name": "autolysosome", "id": "GO:0044754", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0044754", "evidence": [ { "database": "UniProtKB", "id": "P13473", "url": "https://www.uniprot.org/uniprot/P13473" } ], "pmid": "" }, { "name": "platelet dense granule membrane", "id": "GO:0031088", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031088", "evidence": [ { "database": "UniProtKB", "id": "P13473", "url": "https://www.uniprot.org/uniprot/P13473" } ], "pmid": "" }, { "name": "chaperone-mediated autophagy translocation complex", "id": "GO:0061742", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0061742", "evidence": [ { "database": "UniProtKB", "id": "P13473", "url": "https://www.uniprot.org/uniprot/P13473" } ], "pmid": "" }, { "name": "endosome membrane", "id": "GO:0010008", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010008", "evidence": [ { "database": "UniProtKB", "id": "P13473", "url": "https://www.uniprot.org/uniprot/P13473" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 4, "go_terms": [ { "name": "enzyme binding", "id": "GO:0019899", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019899", "evidence": [ { "database": "UniProtKB", "id": "P13473", "url": "https://www.uniprot.org/uniprot/P13473" } ], "pmid": "" }, { "name": "protein domain specific binding", "id": "GO:0019904", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019904", "evidence": [ { "database": "UniProtKB", "id": "P13473", "url": "https://www.uniprot.org/uniprot/P13473" } ], "pmid": "" }, { "name": "signaling adaptor activity", "id": "GO:0035591", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035591", "evidence": [ { "database": "UniProtKB", "id": "P13473", "url": "https://www.uniprot.org/uniprot/P13473" } ], "pmid": "" }, { "name": "ion channel inhibitor activity", "id": "GO:0008200", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008200", "evidence": [ { "database": "UniProtKB", "id": "P13473", "url": "https://www.uniprot.org/uniprot/P13473" } ], "pmid": "" } ] } ] }, "pro_annotation": [ { "name": "lysosome-associated membrane glycoprotein 2 N-glycosylated 1 (human)", "definition": "A lysosome-associated membrane glycoprotein 2 (human) that has been N-glycosylated at the residue equivalent to Asn-229 of the amino acid sequence represented by UniProtKB:P13473-1, in which the glycan composition is represented by GlyTouCan:G92050GC. Example: UniProtKB:P13473-1, Asn-229, MOD:00160~GNO:G92050GC. [PRO:DNx, PMID:23345538]", "evidence": [ { "id": "PR:000055031", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055031" } ] }, { "name": "lysosome-associated membrane glycoprotein 2 N-glycosylated 2 (human)", "definition": "A lysosome-associated membrane glycoprotein 2 (human) that has been N-glycosylated at the residue equivalent to Asn-257 of the amino acid sequence represented by UniProtKB:P13473-1, in which the glycan composition is represented by GlyTouCan:G00912UN. Example: UniProtKB:P13473-1, Asn-257, MOD:00160~GNO:G00912UN. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000055032", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055032" } ] }, { "name": "lysosome-associated membrane glycoprotein 2 N-glycosylated 3 (human)", "definition": "A lysosome-associated membrane glycoprotein 2 (human) that has been N-glycosylated at the residue equivalent to Asn-257 of the amino acid sequence represented by UniProtKB:P13473-1, in which the glycan composition is represented by GlyTouCan:G27947YN. Example: UniProtKB:P13473-1, Asn-257, MOD:00160~GNO:G27947YN. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000055033", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055033" } ] }, { "name": "lysosome-associated membrane glycoprotein 2 N-glycosylated 4 (human)", "definition": "A lysosome-associated membrane glycoprotein 2 (human) that has been N-glycosylated at the residue equivalent to Asn-275 of the amino acid sequence represented by UniProtKB:P13473-1, in which the glycan composition is represented by GlyTouCan:G00912UN. Example: UniProtKB:P13473-1, Asn-275, MOD:00160~GNO:G00912UN. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000055034", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055034" } ] }, { "name": "lysosome-associated membrane glycoprotein 2 N-glycosylated 5 (human)", "definition": "A lysosome-associated membrane glycoprotein 2 (human) that has been N-glycosylated at the residue equivalent to Asn-275 of the amino acid sequence represented by UniProtKB:P13473-1, in which the glycan composition is represented by GlyTouCan:G22589VJ. Example: UniProtKB:P13473-1, Asn-275, MOD:00160~GNO:G22589VJ. [PRO:DNx, PMID:29741879]", "evidence": [ { "id": "PR:000055035", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055035" } ] }, { "name": "lysosome-associated membrane glycoprotein 2 N-glycosylated 6 (human)", "definition": "A lysosome-associated membrane glycoprotein 2 (human) that has been N-glycosylated at the residue equivalent to Asn-275 of the amino acid sequence represented by UniProtKB:P13473-1, in which the glycan composition is represented by GlyTouCan:G40926MX. Example: UniProtKB:P13473-1, Asn-275, MOD:00160~GNO:G40926MX. [PRO:DNx, PMID:29741879]", "evidence": [ { "id": "PR:000055036", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055036" } ] }, { "name": "lysosome-associated membrane glycoprotein 2 N-glycosylated 7 (human)", "definition": "A lysosome-associated membrane glycoprotein 2 (human) that has been N-glycosylated at the residue equivalent to Asn-275 of the amino acid sequence represented by UniProtKB:P13473-1, in which the glycan composition is represented by GlyTouCan:G66933CM. Example: UniProtKB:P13473-1, Asn-275, MOD:00160~GNO:G66933CM. [PRO:DNx, PMID:29741879]", "evidence": [ { "id": "PR:000055037", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055037" } ] }, { "name": "lysosome-associated membrane glycoprotein 2 N-glycosylated 8 (human)", "definition": "A lysosome-associated membrane glycoprotein 2 (human) that has been N-glycosylated at the residue equivalent to Asn-275 of the amino acid sequence represented by UniProtKB:P13473-1, in which the glycan composition is represented by GlyTouCan:G92597CK. Example: UniProtKB:P13473-1, Asn-275, MOD:00160~GNO:G92597CK. [PRO:DNx, PMID:29741879]", "evidence": [ { "id": "PR:000055038", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055038" } ] }, { "name": "lysosome-associated membrane glycoprotein 2 N-glycosylated 9 (human)", "definition": "A lysosome-associated membrane glycoprotein 2 (human) that has been N-glycosylated at the residue equivalent to Asn-275 of the amino acid sequence represented by UniProtKB:P13473-1, in which the glycan composition is represented by GlyTouCan:G95865ZB. Example: UniProtKB:P13473-1, Asn-275, MOD:00160~GNO:G95865ZB. [PRO:DNx, PMID:29741879]", "evidence": [ { "id": "PR:000055039", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055039" } ] }, { "name": "lysosome-associated membrane glycoprotein 2 N-glycosylated 10 (human)", "definition": "A lysosome-associated membrane glycoprotein 2 (human) that has been N-glycosylated at the residue equivalent to Asn-356 of the amino acid sequence represented by UniProtKB:P13473-1, in which the glycan composition is represented by GlyTouCan:G01650EU. Example: UniProtKB:P13473-1, Asn-356, MOD:00160~GNO:G01650EU. [PRO:DNx, PMID:29741879]", "evidence": [ { "id": "PR:000055040", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055040" } ] }, { "name": "lysosome-associated membrane glycoprotein 2 N-glycosylated 11 (human)", "definition": "A lysosome-associated membrane glycoprotein 2 (human) that has been N-glycosylated at the residue equivalent to Asn-356 of the amino acid sequence represented by UniProtKB:P13473-1, in which the glycan composition is represented by GlyTouCan:G03574QJ. Example: UniProtKB:P13473-1, Asn-356, MOD:00160~GNO:G03574QJ. [PRO:DNx, PMID:29741879]", "evidence": [ { "id": "PR:000055041", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055041" } ] }, { "name": "lysosome-associated membrane glycoprotein 2 N-glycosylated 12 (human)", "definition": "A lysosome-associated membrane glycoprotein 2 (human) that has been N-glycosylated at the residue equivalent to Asn-356 of the amino acid sequence represented by UniProtKB:P13473-1, in which the glycan composition is represented by GlyTouCan:G06231AO. Example: UniProtKB:P13473-1, Asn-356, MOD:00160~GNO:G06231AO. [PRO:DNx, PMID:29741879]", "evidence": [ { "id": "PR:000055042", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055042" } ] }, { "name": "lysosome-associated membrane glycoprotein 2 N-glycosylated 13 (human)", "definition": "A lysosome-associated membrane glycoprotein 2 (human) that has been N-glycosylated at the residue equivalent to Asn-356 of the amino acid sequence represented by UniProtKB:P13473-1, in which the glycan composition is represented by GlyTouCan:G09197ZW. Example: UniProtKB:P13473-1, Asn-356, MOD:00160~GNO:G09197ZW. [PRO:DNx, PMID:29741879]", "evidence": [ { "id": "PR:000055043", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055043" } ] }, { "name": "lysosome-associated membrane glycoprotein 2 N-glycosylated 14 (human)", "definition": "A lysosome-associated membrane glycoprotein 2 (human) that has been N-glycosylated at the residue equivalent to Asn-356 of the amino acid sequence represented by UniProtKB:P13473-1, in which the glycan composition is represented by GlyTouCan:G16175ZV. Example: UniProtKB:P13473-1, Asn-356, MOD:00160~GNO:G16175ZV. [PRO:DNx, PMID:29741879]", "evidence": [ { "id": "PR:000055044", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055044" } ] }, { "name": "lysosome-associated membrane glycoprotein 2 N-glycosylated 15 (human)", "definition": "A lysosome-associated membrane glycoprotein 2 (human) that has been N-glycosylated at the residue equivalent to Asn-356 of the amino acid sequence represented by UniProtKB:P13473-1, in which the glycan composition is represented by GlyTouCan:G25079LO. Example: UniProtKB:P13473-1, Asn-356, MOD:00160~GNO:G25079LO. [PRO:DNx, PMID:29741879]", "evidence": [ { "id": "PR:000055045", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055045" } ] }, { "name": "lysosome-associated membrane glycoprotein 2 N-glycosylated 16 (human)", "definition": "A lysosome-associated membrane glycoprotein 2 (human) that has been N-glycosylated at the residue equivalent to Asn-356 of the amino acid sequence represented by UniProtKB:P13473-1, in which the glycan composition is represented by GlyTouCan:G37399XV. Example: UniProtKB:P13473-1, Asn-356, MOD:00160~GNO:G37399XV. [PRO:DNx, PMID:29741879]", "evidence": [ { "id": "PR:000055046", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055046" } ] }, { "name": "lysosome-associated membrane glycoprotein 2 N-glycosylated 17 (human)", "definition": "A lysosome-associated membrane glycoprotein 2 (human) that has been N-glycosylated at the residue equivalent to Asn-356 of the amino acid sequence represented by UniProtKB:P13473-1, in which the glycan composition is represented by GlyTouCan:G41126SR. Example: UniProtKB:P13473-1, Asn-356, MOD:00160~GNO:G41126SR. [PRO:DNx, PMID:29741879]", "evidence": [ { "id": "PR:000055047", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055047" } ] }, { "name": "lysosome-associated membrane glycoprotein 2 N-glycosylated 18 (human)", "definition": "A lysosome-associated membrane glycoprotein 2 (human) that has been N-glycosylated at the residue equivalent to Asn-356 of the amino acid sequence represented by UniProtKB:P13473-1, in which the glycan composition is represented by GlyTouCan:G50372IH. Example: UniProtKB:P13473-1, Asn-356, MOD:00160~GNO:G50372IH. [PRO:DNx, PMID:29741879]", "evidence": [ { "id": "PR:000055048", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055048" } ] }, { "name": "lysosome-associated membrane glycoprotein 2 N-glycosylated 19 (human)", "definition": "A lysosome-associated membrane glycoprotein 2 (human) that has been N-glycosylated at the residue equivalent to Asn-356 of the amino acid sequence represented by UniProtKB:P13473-1, in which the glycan composition is represented by GlyTouCan:G56610MH. Example: UniProtKB:P13473-1, Asn-356, MOD:00160~GNO:G56610MH. [PRO:DNx, PMID:29741879]", "evidence": [ { "id": "PR:000055049", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055049" } ] }, { "name": "lysosome-associated membrane glycoprotein 2 N-glycosylated 20 (human)", "definition": "A lysosome-associated membrane glycoprotein 2 (human) that has been N-glycosylated at the residue equivalent to Asn-356 of the amino acid sequence represented by UniProtKB:P13473-1, in which the glycan composition is represented by GlyTouCan:G59626AS. Example: UniProtKB:P13473-1, Asn-356, MOD:00160~GNO:G59626AS. [PRO:DNx, PMID:29741879]", "evidence": [ { "id": "PR:000055050", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055050" } ] }, { "name": "lysosome-associated membrane glycoprotein 2 N-glycosylated 21 (human)", "definition": "A lysosome-associated membrane glycoprotein 2 (human) that has been N-glycosylated at the residue equivalent to Asn-356 of the amino acid sequence represented by UniProtKB:P13473-1, in which the glycan composition is represented by GlyTouCan:G60923RB. Example: UniProtKB:P13473-1, Asn-356, MOD:00160~GNO:G60923RB. [PRO:DNx, PMID:29741879]", "evidence": [ { "id": "PR:000055051", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055051" } ] }, { "name": "lysosome-associated membrane glycoprotein 2 N-glycosylated 22 (human)", "definition": "A lysosome-associated membrane glycoprotein 2 (human) that has been N-glycosylated at the residue equivalent to Asn-356 of the amino acid sequence represented by UniProtKB:P13473-1, in which the glycan composition is represented by GlyTouCan:G62595EF. Example: UniProtKB:P13473-1, Asn-356, MOD:00160~GNO:G62595EF. [PRO:DNx, PMID:29741879]", "evidence": [ { "id": "PR:000055052", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055052" } ] }, { "name": "lysosome-associated membrane glycoprotein 2 N-glycosylated 23 (human)", "definition": "A lysosome-associated membrane glycoprotein 2 (human) that has been N-glycosylated at the residue equivalent to Asn-356 of the amino acid sequence represented by UniProtKB:P13473-1, in which the glycan composition is represented by GlyTouCan:G66933CM. Example: UniProtKB:P13473-1, Asn-356, MOD:00160~GNO:G66933CM. [PRO:DNx, PMID:29741879]", "evidence": [ { "id": "PR:000055053", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055053" } ] }, { "name": "lysosome-associated membrane glycoprotein 2 N-glycosylated 24 (human)", "definition": "A lysosome-associated membrane glycoprotein 2 (human) that has been N-glycosylated at the residue equivalent to Asn-356 of the amino acid sequence represented by UniProtKB:P13473-1, in which the glycan composition is represented by GlyTouCan:G87051GH. Example: UniProtKB:P13473-1, Asn-356, MOD:00160~GNO:G87051GH. [PRO:DNx, PMID:29741879]", "evidence": [ { "id": "PR:000055054", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055054" } ] }, { "name": "lysosome-associated membrane glycoprotein 2 N-glycosylated 25 (human)", "definition": "A lysosome-associated membrane glycoprotein 2 (human) that has been N-glycosylated at the residue equivalent to Asn-49 of the amino acid sequence represented by UniProtKB:P13473-1, in which the glycan composition is represented by GlyTouCan:G40926MX. Example: UniProtKB:P13473-1, Asn-49, MOD:00160~GNO:G40926MX. [PRO:DNx, PMID:29741879]", "evidence": [ { "id": "PR:000055055", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055055" } ] }, { "name": "lysosome-associated membrane glycoprotein 2 N-glycosylated 26 (human)", "definition": "A lysosome-associated membrane glycoprotein 2 (human) that has been N-glycosylated at the residue equivalent to Asn-49 of the amino acid sequence represented by UniProtKB:P13473-1, in which the glycan composition is represented by GlyTouCan:G66933CM. Example: UniProtKB:P13473-1, Asn-49, MOD:00160~GNO:G66933CM. [PRO:DNx, PMID:29741879]", "evidence": [ { "id": "PR:000055056", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055056" } ] }, { "name": "lysosome-associated membrane glycoprotein 2 N-glycosylated 27 (human)", "definition": "A lysosome-associated membrane glycoprotein 2 (human) that has been N-glycosylated at the residue equivalent to Asn-58 of the amino acid sequence represented by UniProtKB:P13473-1, in which the glycan composition is represented by GlyTouCan:G03930BU. Example: UniProtKB:P13473-1, Asn-58, MOD:00160~GNO:G03930BU. [PRO:DNx, PMID:29741879]", "evidence": [ { "id": "PR:000055057", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055057" } ] }, { "name": "lysosome-associated membrane glycoprotein 2 N-glycosylated 28 (human)", "definition": "A lysosome-associated membrane glycoprotein 2 (human) that has been N-glycosylated at the residue equivalent to Asn-58 of the amino acid sequence represented by UniProtKB:P13473-1, in which the glycan composition is represented by GlyTouCan:G58001LT. Example: UniProtKB:P13473-1, Asn-58, MOD:00160~GNO:G58001LT. [PRO:DNx, PMID:29741879]", "evidence": [ { "id": "PR:000055058", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055058" } ] }, { "name": "lysosome-associated membrane glycoprotein 2 O-glycosylated 1 (human)", "definition": "A lysosome-associated membrane glycoprotein 2 (human) that has been O-glycosylated at the residue equivalent to Ser-195 of the amino acid sequence represented by UniProtKB:P13473-1, in which the glycan structure is represented by GlyTouCan:G00031MO. Example: UniProtKB:P13473-1, Ser-195, MOD:00002~GNO:G00031MO. [PRO:DNx, PMID:8323299]", "evidence": [ { "id": "PR:000055059", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055059" } ] }, { "name": "lysosome-associated membrane glycoprotein 2 O-glycosylated 2 (human)", "definition": "A lysosome-associated membrane glycoprotein 2 (human) that has been O-glycosylated at the residue equivalent to Ser-195 of the amino acid sequence represented by UniProtKB:P13473-1, in which the glycan structure is represented by GlyTouCan:G64973KT. Example: UniProtKB:P13473-1, Ser-195, MOD:00002~GNO:G64973KT. [PRO:DNx, PMID:8323299]", "evidence": [ { "id": "PR:000055060", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055060" } ] }, { "name": "lysosome-associated membrane glycoprotein 2 O-glycosylated 3 (human)", "definition": "A lysosome-associated membrane glycoprotein 2 (human) that has been O-glycosylated at the residue equivalent to Ser-207 of the amino acid sequence represented by UniProtKB:P13473-1, in which the glycan structure is represented by GlyTouCan:G00031MO. Example: UniProtKB:P13473-1, Ser-207, MOD:00002~GNO:G00031MO. [PRO:DNx, PMID:8323299]", "evidence": [ { "id": "PR:000055061", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055061" } ] }, { "name": "lysosome-associated membrane glycoprotein 2 O-glycosylated 4 (human)", "definition": "A lysosome-associated membrane glycoprotein 2 (human) that has been O-glycosylated at the residue equivalent to Ser-207 of the amino acid sequence represented by UniProtKB:P13473-1, in which the glycan structure is represented by GlyTouCan:G64973KT. Example: UniProtKB:P13473-1, Ser-207, MOD:00002~GNO:G64973KT. [PRO:DNx, PMID:8323299]", "evidence": [ { "id": "PR:000055062", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055062" } ] }, { "name": "lysosome-associated membrane glycoprotein 2 O-glycosylated 5 (human)", "definition": "A lysosome-associated membrane glycoprotein 2 (human) that has been O-glycosylated at the residue equivalent to Thr-196 of the amino acid sequence represented by UniProtKB:P13473-1, in which the glycan structure is represented by GlyTouCan:G00031MO. Example: UniProtKB:P13473-1, Thr-196, MOD:00005~GNO:G00031MO. [PRO:DNx, PMID:8323299]", "evidence": [ { "id": "PR:000055063", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055063" } ] }, { "name": "lysosome-associated membrane glycoprotein 2 O-glycosylated 6 (human)", "definition": "A lysosome-associated membrane glycoprotein 2 (human) that has been O-glycosylated at the residue equivalent to Thr-196 of the amino acid sequence represented by UniProtKB:P13473-1, in which the glycan structure is represented by GlyTouCan:G64973KT. Example: UniProtKB:P13473-1, Thr-196, MOD:00005~GNO:G64973KT. [PRO:DNx, PMID:8323299]", "evidence": [ { "id": "PR:000055064", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055064" } ] }, { "name": "lysosome-associated membrane glycoprotein 2 O-glycosylated 7 (human)", "definition": "A lysosome-associated membrane glycoprotein 2 (human) that has been O-glycosylated at the residue equivalent to Thr-200 of the amino acid sequence represented by UniProtKB:P13473-1, in which the glycan structure is represented by GlyTouCan:G00031MO. Example: UniProtKB:P13473-1, Thr-200, MOD:00005~GNO:G00031MO. [PRO:DNx, PMID:8323299]", "evidence": [ { "id": "PR:000055065", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055065" } ] }, { "name": "lysosome-associated membrane glycoprotein 2 O-glycosylated 8 (human)", "definition": "A lysosome-associated membrane glycoprotein 2 (human) that has been O-glycosylated at the residue equivalent to Thr-200 of the amino acid sequence represented by UniProtKB:P13473-1, in which the glycan structure is represented by GlyTouCan:G64973KT. Example: UniProtKB:P13473-1, Thr-200, MOD:00005~GNO:G64973KT. [PRO:DNx, PMID:8323299]", "evidence": [ { "id": "PR:000055066", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055066" } ] }, { "name": "lysosome-associated membrane glycoprotein 2 O-glycosylated 9 (human)", "definition": "A lysosome-associated membrane glycoprotein 2 (human) that has been O-glycosylated at the residue equivalent to Thr-203 of the amino acid sequence represented by UniProtKB:P13473-1, in which the glycan structure is represented by GlyTouCan:G00031MO. Example: UniProtKB:P13473-1, Thr-203, MOD:00005~GNO:G00031MO. [PRO:DNx, PMID:8323299]", "evidence": [ { "id": "PR:000055067", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055067" } ] }, { "name": "lysosome-associated membrane glycoprotein 2 O-glycosylated 10 (human)", "definition": "A lysosome-associated membrane glycoprotein 2 (human) that has been O-glycosylated at the residue equivalent to Thr-203 of the amino acid sequence represented by UniProtKB:P13473-1, in which the glycan structure is represented by GlyTouCan:G64973KT. Example: UniProtKB:P13473-1, Thr-203, MOD:00005~GNO:G64973KT. [PRO:DNx, PMID:8323299]", "evidence": [ { "id": "PR:000055068", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055068" } ] }, { "name": "lysosome-associated membrane glycoprotein 2 O-glycosylated 11 (human)", "definition": "A lysosome-associated membrane glycoprotein 2 (human) that has been O-glycosylated at the residue equivalent to Thr-204 of the amino acid sequence represented by UniProtKB:P13473-1, in which the glycan structure is represented by GlyTouCan:G00031MO. Example: UniProtKB:P13473-1, Thr-204, MOD:00005~GNO:G00031MO. [PRO:DNx, PMID:8323299]", "evidence": [ { "id": "PR:000055069", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055069" } ] }, { "name": "lysosome-associated membrane glycoprotein 2 O-glycosylated 12 (human)", "definition": "A lysosome-associated membrane glycoprotein 2 (human) that has been O-glycosylated at the residue equivalent to Thr-204 of the amino acid sequence represented by UniProtKB:P13473-1, in which the glycan structure is represented by GlyTouCan:G64973KT. Example: UniProtKB:P13473-1, Thr-204, MOD:00005~GNO:G64973KT. [PRO:DNx, PMID:8323299]", "evidence": [ { "id": "PR:000055070", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055070" } ] }, { "name": "lysosome-associated membrane glycoprotein 2 O-glycosylated 13 (human)", "definition": "A lysosome-associated membrane glycoprotein 2 (human) that has been O-glycosylated at the residue equivalent to Thr-209 of the amino acid sequence represented by UniProtKB:P13473-1, in which the glycan structure is represented by GlyTouCan:G00031MO. Example: UniProtKB:P13473-1, Thr-209, MOD:00005~GNO:G00031MO. [PRO:DNx, PMID:8323299]", "evidence": [ { "id": "PR:000055071", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055071" } ] }, { "name": "lysosome-associated membrane glycoprotein 2 O-glycosylated 14 (human)", "definition": "A lysosome-associated membrane glycoprotein 2 (human) that has been O-glycosylated at the residue equivalent to Thr-209 of the amino acid sequence represented by UniProtKB:P13473-1, in which the glycan structure is represented by GlyTouCan:G64973KT. Example: UniProtKB:P13473-1, Thr-209, MOD:00005~GNO:G64973KT. [PRO:DNx, PMID:8323299]", "evidence": [ { "id": "PR:000055072", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055072" } ] }, { "name": "lysosome-associated membrane glycoprotein 2 O-glycosylated 15 (human)", "definition": "A lysosome-associated membrane glycoprotein 2 (human) that has been O-glycosylated at the residue equivalent to Thr-210 of the amino acid sequence represented by UniProtKB:P13473-1, in which the glycan structure is represented by GlyTouCan:G00031MO. Example: UniProtKB:P13473-1, Thr-210, MOD:00005~GNO:G00031MO. [PRO:DNx, PMID:8323299]", "evidence": [ { "id": "PR:000055073", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055073" } ] }, { "name": "lysosome-associated membrane glycoprotein 2 O-glycosylated 16 (human)", "definition": "A lysosome-associated membrane glycoprotein 2 (human) that has been O-glycosylated at the residue equivalent to Thr-210 of the amino acid sequence represented by UniProtKB:P13473-1, in which the glycan structure is represented by GlyTouCan:G64973KT. Example: UniProtKB:P13473-1, Thr-210, MOD:00005~GNO:G64973KT. [PRO:DNx, PMID:8323299]", "evidence": [ { "id": "PR:000055074", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055074" } ] }, { "name": "lysosome-associated membrane glycoprotein 2 O-glycosylated 17 (human)", "definition": "A lysosome-associated membrane glycoprotein 2 (human) that has been O-glycosylated at the residue equivalent to Thr-211 of the amino acid sequence represented by UniProtKB:P13473-1, in which the glycan structure is represented by GlyTouCan:G00031MO. Example: UniProtKB:P13473-1, Thr-211, MOD:00005~GNO:G00031MO. [PRO:DNx, PMID:8323299]", "evidence": [ { "id": "PR:000055075", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055075" } ] }, { "name": "lysosome-associated membrane glycoprotein 2 O-glycosylated 18 (human)", "definition": "A lysosome-associated membrane glycoprotein 2 (human) that has been O-glycosylated at the residue equivalent to Thr-211 of the amino acid sequence represented by UniProtKB:P13473-1, in which the glycan structure is represented by GlyTouCan:G64973KT. Example: UniProtKB:P13473-1, Thr-211, MOD:00005~GNO:G64973KT. [PRO:DNx, PMID:8323299]", "evidence": [ { "id": "PR:000055076", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055076" } ] } ], "site_annotation": [ { "start_pos": 101, "end_pos": 103, "annotation": "n_glycosylation_sequon" }, { "start_pos": 123, "end_pos": 125, "annotation": "n_glycosylation_sequon" }, { "start_pos": 179, "end_pos": 181, "annotation": "n_glycosylation_sequon" }, { "start_pos": 229, "end_pos": 231, "annotation": "n_glycosylation_sequon" }, { "start_pos": 242, "end_pos": 244, "annotation": "n_glycosylation_sequon" }, { "start_pos": 257, "end_pos": 259, "annotation": "n_glycosylation_sequon" }, { "start_pos": 275, "end_pos": 277, "annotation": "n_glycosylation_sequon" }, { "start_pos": 300, "end_pos": 302, "annotation": "n_glycosylation_sequon" }, { "start_pos": 307, "end_pos": 309, "annotation": "n_glycosylation_sequon" }, { "start_pos": 317, "end_pos": 319, "annotation": "n_glycosylation_sequon" }, { "start_pos": 32, "end_pos": 34, "annotation": "n_glycosylation_sequon" }, { "start_pos": 356, "end_pos": 358, "annotation": "n_glycosylation_sequon" }, { "start_pos": 38, "end_pos": 40, "annotation": "n_glycosylation_sequon" }, { "start_pos": 49, "end_pos": 51, "annotation": "n_glycosylation_sequon" }, { "start_pos": 58, "end_pos": 60, "annotation": "n_glycosylation_sequon" }, { "start_pos": 75, "end_pos": 77, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "O- and N-glycosylated; some of the 16 N-linked glycans are polylactosaminoglycans.", "evidence": [ { "database": "UniProtKB", "id": "P13473", "url": "https://www.uniprot.org/uniprot/P13473" }, { "database": "PubMed", "id": "19159218", "url": "https://glygen.org/publication/PubMed/19159218" }, { "database": "PubMed", "id": "16335952", "url": "https://glygen.org/publication/PubMed/16335952" }, { "database": "PubMed", "id": "12754519", "url": "https://glygen.org/publication/PubMed/12754519" }, { "database": "PubMed", "id": "2912382", "url": "https://glygen.org/publication/PubMed/2912382" }, { "database": "PubMed", "id": "8323299", "url": "https://glygen.org/publication/PubMed/8323299" }, { "database": "PubMed", "id": "2243102", "url": "https://glygen.org/publication/PubMed/2243102" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [ 32, 38, 49, 58, 75, 101, 123, 179, 229, 242, 257, 275, 300, 307, 317, 356 ], "o_linked_sites": [ 57, 181, 188, 192, 194, 195, 196, 200, 203, 204, 205, 207, 209, 210, 211, 213, 358 ], "snv_sites": [ 32, 34, 57, 58, 60, 69, 101, 122, 123, 125, 156, 194, 196, 204, 207, 210, 257, 259, 275, 277, 307, 356, 358 ], "glycation_sites": [], "phosphorylation_sites": [ 267, 269, 281 ], "sequon_annotation_sites": [ { "start_pos": 101, "end_pos": 103 }, { "start_pos": 123, "end_pos": 125 }, { "start_pos": 179, "end_pos": 181 }, { "start_pos": 229, "end_pos": 231 }, { "start_pos": 242, "end_pos": 244 }, { "start_pos": 257, "end_pos": 259 }, { "start_pos": 275, "end_pos": 277 }, { "start_pos": 300, "end_pos": 302 }, { "start_pos": 307, "end_pos": 309 }, { "start_pos": 317, "end_pos": 319 }, { "start_pos": 32, "end_pos": 34 }, { "start_pos": 356, "end_pos": 358 }, { "start_pos": 38, "end_pos": 40 }, { "start_pos": 49, "end_pos": 51 }, { "start_pos": 58, "end_pos": 60 }, { "start_pos": 75, "end_pos": 77 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 425 }, { "field": "total_sites", "count": 31 }, { "field": "n_linked_glycans", "count": 148 }, { "field": "n_linked_glycan_sites", "count": 28 }, { "field": "o_linked_glycans", "count": 6 }, { "field": "o_linked_glycan_sites", "count": 25 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 26 }, { "field": "total_sites", "count": 26 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 16 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 10 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 398 }, { "field": "total_sites", "count": 26 }, { "field": "n_linked_glycans", "count": 148 }, { "field": "n_linked_glycan_sites", "count": 12 }, { "field": "o_linked_glycans", "count": 6 }, { "field": "o_linked_glycan_sites", "count": 14 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 30 }, { "field": "total_sites", "count": 23 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 10 }, { "field": "total_sites", "count": 9 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 20 }, { "field": "total_sites", "count": 17 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 67 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }