{ "uniprot_canonical_ac": "P12729-1", "uniprot_ac": "P12729", "uniprot_id": "PSA_DICDI", "mass": { "chemical_mass": 17879.0, "monoisotopic_mass": 17879.0 }, "refseq": { "ac": "XP_647406", "name": "cell surface glycoprotein PsA precursor", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_647406" }, "gene_names": [ { "name": "pspA", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P12729", "id": "P12729" }, { "name": "D19", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P12729", "id": "P12729" }, { "name": "DDB_G0267412", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P12729", "id": "P12729" }, { "name": "ponG", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P12729", "id": "P12729" }, { "name": "psaA", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P12729", "id": "P12729" }, { "name": "pspA", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_647406", "id": "XP_647406" } ], "protein_names": [ { "name": "Prespore-specific protein A", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P12729" }, { "name": "Cell surface antigen PsA", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P12729" }, { "name": "Ponticulin-like protein G", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P12729" }, { "name": "Protein D19", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P12729" }, { "name": "cell surface glycoprotein PsA precursor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_647406", "id": "XP_647406" }, { "name": "ponticulin-related protein", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_647406", "id": "XP_647406" } ], "function": [ { "annotation": "May bind F-actin and nucleates actin assembly.", "evidence": [ { "database": "UniProtKB", "id": "P12729", "url": "https://www.uniprot.org/uniprot/P12729#function" }, { "database": "PubMed", "id": "18522444", "url": "https://glygen.org/publication/PubMed/18522444" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Dictyostelium discoideum", "taxid": 44689, "evidence": [ { "database": "UniProtKB", "id": "P12729", "url": "https://www.uniprot.org/uniprot/P12729" } ], "common_name": "Cellular slime molds" } ], "gene": [ { "name": "pspA", "url": "https://www.uniprot.org/uniprot/P12729", "locus": {} } ], "crossref": [ { "id": "DDB_G0267412", "url": "http://dictybase.org/gene/DDB_G0267412", "database": "dictyBase", "categories": [ "Organism-specific" ] }, { "id": "8616213", "url": "https://www.ncbi.nlm.nih.gov/gene/8616213", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "ddi:DDB_G0267412", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+ddi:DDB_G0267412", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "YANAYDY", "url": "https://omabrowser.org/oma/group/YANAYDY/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "PR_P12729", "url": "http://purl.obolibrary.org/obo/PR_P12729", "database": "PRO", "categories": [ "Protein" ] }, { "id": "XP_647406", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_647406", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "P12729", "url": "https://www.uniprot.org/uniprot/P12729", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P12729-1", "url": "https://www.uniprot.org/uniprot/P12729-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MKFQHTFIALLSLLTYANAYDYFTTTLANQNPVCASVDVIQNVCTEVCGRFVRYIPDATNTNQFTFAEYTTNQCTVQVTPAVTNTFTCADQTSSHALGSDWSGVCKITATPAPTVTPTVTPTVTPTVTPTPTNTPNPTPSQTSTTTGSASTVVASLSLIIFSMILSLC", "length": 168, "header": "sp|P12729-1|PSA_DICDI Isoform 1 of Prespore-specific protein A OS=Dictyostelium discoideum OX=44689 GN=pspA PE=1 SV=1 CANONICAL=P12729-1" }, "isoforms": [ { "isoform_ac": "P12729-1", "url": "", "sequence": { "sequence": "MKFQHTFIALLSLLTYANAYDYFTTTLANQNPVCASVDVIQNVCTEVCGRFVRYIPDATNTNQFTFAEYTTNQCTVQVTPAVTNTFTCADQTSSHALGSDWSGVCKITATPAPTVTPTVTPTVTPTVTPTPTNTPNPTPSQTSTTTGSASTVVASLSLIIFSMILSLC", "length": 168, "header": "sp|P12729-1|PSA_DICDI Isoform 1 of Prespore-specific protein A OS=Dictyostelium discoideum OX=44689 GN=pspA PE=1 SV=1 CANONICAL=P12729-1" }, "locus": {} } ], "glycosylation": [ { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "predicted", "site_seq": "T", "relation": "attached", "comment": "O-linked (GlcNAc) threonine O-GlcNAcylation", "start_pos": 110, "start_aa": "Thr", "end_pos": 110, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr110", "evidence": [ { "id": "P12729", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P12729#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "predicted", "site_seq": "T", "relation": "attached", "comment": "O-linked (GlcNAc) threonine O-GlcNAcylation", "start_pos": 114, "start_aa": "Thr", "end_pos": 114, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr114", "evidence": [ { "id": "P12729", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P12729#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "predicted", "site_seq": "T", "relation": "attached", "comment": "O-linked (GlcNAc) threonine O-GlcNAcylation", "start_pos": 116, "start_aa": "Thr", "end_pos": 116, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr116", "evidence": [ { "id": "P12729", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P12729#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "predicted", "site_seq": "T", "relation": "attached", "comment": "O-linked (GlcNAc) threonine O-GlcNAcylation", "start_pos": 118, "start_aa": "Thr", "end_pos": 118, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr118", "evidence": [ { "id": "P12729", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P12729#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "predicted", "site_seq": "T", "relation": "attached", "comment": "O-linked (GlcNAc) threonine O-GlcNAcylation", "start_pos": 120, "start_aa": "Thr", "end_pos": 120, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr120", "evidence": [ { "id": "P12729", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P12729#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "predicted", "site_seq": "T", "relation": "attached", "comment": "O-linked (GlcNAc) threonine O-GlcNAcylation", "start_pos": 122, "start_aa": "Thr", "end_pos": 122, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr122", "evidence": [ { "id": "P12729", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P12729#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "predicted", "site_seq": "T", "relation": "attached", "comment": "O-linked (GlcNAc) threonine O-GlcNAcylation", "start_pos": 124, "start_aa": "Thr", "end_pos": 124, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr124", "evidence": [ { "id": "P12729", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P12729#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "predicted", "site_seq": "T", "relation": "attached", "comment": "O-linked (GlcNAc) threonine O-GlcNAcylation", "start_pos": 126, "start_aa": "Thr", "end_pos": 126, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr126", "evidence": [ { "id": "P12729", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P12729#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "predicted", "site_seq": "T", "relation": "attached", "comment": "O-linked (GlcNAc) threonine O-GlcNAcylation", "start_pos": 128, "start_aa": "Thr", "end_pos": 128, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr128", "evidence": [ { "id": "P12729", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P12729#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "predicted", "site_seq": "T", "relation": "attached", "comment": "O-linked (GlcNAc) threonine O-GlcNAcylation", "start_pos": 130, "start_aa": "Thr", "end_pos": 130, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr130", "evidence": [ { "id": "P12729", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P12729#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "predicted", "site_seq": "T", "relation": "attached", "comment": "O-linked (GlcNAc) threonine O-GlcNAcylation", "start_pos": 132, "start_aa": "Thr", "end_pos": 132, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr132", "evidence": [ { "id": "P12729", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P12729#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "predicted", "site_seq": "T", "relation": "attached", "comment": "O-linked (GlcNAc) threonine O-GlcNAcylation", "start_pos": 134, "start_aa": "Thr", "end_pos": 134, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr134", "evidence": [ { "id": "P12729", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P12729#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "predicted", "site_seq": "T", "relation": "attached", "comment": "O-linked (GlcNAc) threonine O-GlcNAcylation", "start_pos": 138, "start_aa": "Thr", "end_pos": 138, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr138", "evidence": [ { "id": "P12729", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P12729#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "predicted", "site_seq": "S", "relation": "attached", "comment": "O-linked (GlcNAc) serine O-GlcNAcylation", "start_pos": 140, "start_aa": "Ser", "end_pos": 140, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser140", "evidence": [ { "id": "P12729", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P12729#ptm_processing" } ] } ], "phosphorylation": [], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_predicted" ], "publication": [ { "title": "Size polymorphisms due to changes in the number of O-glycosylated tandem repeats in the Dictyostelium discoideum glycoprotein PsA.", "journal": "Genetics", "date": "1992", "authors": "Gooley A A, Marshchalek R, Williams K L", "evidence": [ { "database": "UniProtKB", "id": "P12729", "url": "https://www.uniprot.org/uniprot/P12729" } ], "reference": [ { "type": "PubMed", "id": "1582556", "url": "https://glygen.org/publication/PubMed/1582556" } ] }, { "title": "The genome of the social amoeba Dictyostelium discoideum.", "journal": "Nature", "date": "2005", "authors": "Eichinger L, Pachebat J A, Gl\u00f6ckner G, Rajandream M-A, Sucgang R, Berriman M, Song J, Olsen R, Szafranski K, Xu Q, Tunggal B, Kummerfeld S, Madera M, Konfortov B A, Rivero F, Bankier A T, Lehmann R, Hamlin N, Davies R, Gaudet P, Fey P, Pilcher K, Chen G, Saunders D, Sodergren E, Davis P, Kerhornou A, Nie X, Hall N, Anjard C, Hemphill L, Bason N, Farbrother P, Desany B, Just E, Morio T, Rost R, Churcher C, Cooper J, Haydock S, van Driessche N, Cronin A, Goodhead I, Muzny D, Mourier T, Pain A, Lu M, Harper D, Lindsay R, Hauser H, James K, Quiles M, Madan Babu M, Saito T, Buchrieser C, Wardroper A, Felder M, Thangavelu M, Johnson D, Knights A, Loulseged H, Mungall K, Oliver K, Price C, Quail M A, Urushihara H, Hernandez J, Rabbinowitsch E, Steffen D, Sanders M, Ma J, Kohara Y, Sharp S, Simmonds M, Spiegler S, Tivey A, Sugano S, White B, Walker D, Woodward J, Winckler T, Tanaka Y, Shaulsky G, Schleicher M, Weinstock G, Rosenthal A, Cox E C, Chisholm R L, Gibbs R, Loomis W F, Platzer M, Kay R R, Williams J, Dear P H, Noegel A A, Barrell B, Kuspa A", "evidence": [ { "database": "UniProtKB", "id": "P12729", "url": "https://www.uniprot.org/uniprot/P12729" } ], "reference": [ { "type": "PubMed", "id": "15875012", "url": "https://glygen.org/publication/PubMed/15875012" } ] }, { "title": "Minimal F-actin cytoskeletal system for planar supported phospholipid bilayers.", "journal": "Langmuir : the ACS journal of surfaces and colloids", "date": "2008-06-01", "authors": "Barfoot Richard J, Sheikh Khizar H, Johnson Benjamin R G, Colyer John, Miles Robert E, Jeuken Lars J C, Bushby Richard J, Evans Stephen D", "evidence": [ { "database": "UniProtKB", "id": "P12729", "url": "https://www.uniprot.org/uniprot/P12729" } ], "reference": [ { "type": "PubMed", "id": "18522444", "url": "https://glygen.org/publication/PubMed/18522444" } ] }, { "title": "Identification of sequences regulating the transcription of a Dictyostelium gene selectively expressed in prespore cells.", "journal": "Nucleic Acids Res.", "date": "1989", "authors": "Early A E, Williams J G", "evidence": [ { "database": "UniProtKB", "id": "P12729", "url": "https://www.uniprot.org/uniprot/P12729" } ], "reference": [ { "type": "PubMed", "id": "2550894", "url": "https://glygen.org/publication/PubMed/2550894" } ] }, { "title": "Structural characterization of Dictyostelium discoideum prespore-specific gene D19 and of its product, cell surface glycoprotein PsA.", "journal": "Mol. Cell. Biol.", "date": "1988", "authors": "Early A E, Williams J G, Meyer H E, Por S B, Smith E, Williams K L, Gooley A A", "evidence": [ { "database": "UniProtKB", "id": "P12729", "url": "https://www.uniprot.org/uniprot/P12729" } ], "reference": [ { "type": "PubMed", "id": "2850494", "url": "https://glygen.org/publication/PubMed/2850494" } ] }, { "title": "Structural and functional characterization of genes encoding Dictyostelium prestalk and prespore cell-specific proteins.", "journal": "Dev. Genet.", "date": "1988", "authors": "Early A, McRobbie S J, Duffy K T, Jermyn K A, Tilly R, Ceccarelli A, Williams J G", "evidence": [ { "database": "UniProtKB", "id": "P12729", "url": "https://www.uniprot.org/uniprot/P12729" } ], "reference": [ { "type": "PubMed", "id": "3243026", "url": "https://glygen.org/publication/PubMed/3243026" } ] }, { "title": "Post-translational modifications of the Dictyostelium discoideum glycoprotein PsA. Glycosylphosphatidylinositol membrane anchor and composition of O-linked oligosaccharides.", "journal": "European journal of biochemistry", "date": "1993-09-15", "authors": "Haynes P A, Gooley A A, Ferguson M A, Redmond J W, Williams K L", "evidence": [ { "database": "UniProtKB", "id": "P12729", "url": "https://www.uniprot.org/uniprot/P12729" } ], "reference": [ { "type": "PubMed", "id": "8404891", "url": "https://glygen.org/publication/PubMed/8404891" } ] }, { "title": "Recombinant prespore-specific antigen from Dictyostelium discoideum is a beta-sheet glycoprotein with a spacer peptide modified by O-linked N-acetylglucosamine.", "journal": "European journal of biochemistry", "date": "1996-06-01", "authors": "Zachara N E, Packer N H, Temple M D, Slade M B, Jardine D R, Karuso P, Moss C J, Mabbutt B C, Curmi P M, Williams K L, Gooley A A", "evidence": [ { "database": "UniProtKB", "id": "P12729", "url": "https://www.uniprot.org/uniprot/P12729" } ], "reference": [ { "type": "PubMed", "id": "8681966", "url": "https://glygen.org/publication/PubMed/8681966" } ] } ], "pathway": [ { "id": "ddi:DDB_G0267412", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+ddi:DDB_G0267412", "resource": "KEGG Pathway" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "actin binding", "id": "GO:0003779", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003779", "evidence": [ { "database": "UniProtKB", "id": "P12729", "url": "https://www.uniprot.org/uniprot/P12729" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 4, "go_terms": [ { "name": "extracellular region", "id": "GO:0005576", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576", "evidence": [ { "database": "UniProtKB", "id": "P12729", "url": "https://www.uniprot.org/uniprot/P12729" } ], "pmid": "" }, { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "P12729", "url": "https://www.uniprot.org/uniprot/P12729" } ], "pmid": "" }, { "name": "cell surface", "id": "GO:0009986", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009986", "evidence": [ { "database": "UniProtKB", "id": "P12729", "url": "https://www.uniprot.org/uniprot/P12729" } ], "pmid": "" }, { "name": "side of membrane", "id": "GO:0098552", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0098552", "evidence": [ { "database": "UniProtKB", "id": "P12729", "url": "https://www.uniprot.org/uniprot/P12729" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 5, "go_terms": [ { "name": "cell-cell adhesion via plasma-membrane adhesion molecules", "id": "GO:0098742", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0098742", "evidence": [ { "database": "UniProtKB", "id": "P12729", "url": "https://www.uniprot.org/uniprot/P12729" } ], "pmid": "" }, { "name": "GPI anchor biosynthetic process", "id": "GO:0006506", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006506", "evidence": [ { "database": "UniProtKB", "id": "P12729", "url": "https://www.uniprot.org/uniprot/P12729" } ], "pmid": "" }, { "name": "response to catechin", "id": "GO:1902168", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1902168", "evidence": [ { "database": "UniProtKB", "id": "P12729", "url": "https://www.uniprot.org/uniprot/P12729" } ], "pmid": "" }, { "name": "mannosyl-inositol phosphorylceramide biosynthetic process", "id": "GO:0051999", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051999", "evidence": [ { "database": "UniProtKB", "id": "P12729", "url": "https://www.uniprot.org/uniprot/P12729" } ], "pmid": "" }, { "name": "slug development involved in sorocarp development", "id": "GO:0031153", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031153", "evidence": [ { "database": "UniProtKB", "id": "P12729", "url": "https://www.uniprot.org/uniprot/P12729" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [ { "annotation": "O-glycosylated in the repeat region. The oligosaccharides contain N-acetylglucosamine and fucose as the major constituents.", "evidence": [ { "database": "UniProtKB", "id": "P12729", "url": "https://www.uniprot.org/uniprot/P12729" }, { "database": "PubMed", "id": "8404891", "url": "https://glygen.org/publication/PubMed/8404891" }, { "database": "PubMed", "id": "8681966", "url": "https://glygen.org/publication/PubMed/8681966" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [ 110, 114, 116, 118, 120, 122, 124, 126, 128, 130, 132, 134, 138, 140 ], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 14 }, { "field": "total_sites", "count": 14 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 14 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 14 }, { "field": "total_sites", "count": 14 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 14 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 8 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }