{ "uniprot_canonical_ac": "P12318-1", "uniprot_ac": "P12318", "uniprot_id": "FCG2A_HUMAN", "mass": { "chemical_mass": 35001.0, "monoisotopic_mass": 35001.0 }, "refseq": { "ac": "NP_001129691", "name": "low affinity immunoglobulin gamma Fc region receptor II-a isoform 1 precursor", "summary": "This gene encodes one member of a family of immunoglobulin Fc receptor genes found on the surface of many immune response cells. The protein encoded by this gene is a cell surface receptor found on phagocytic cells such as macrophages and neutrophils, and is involved in the process of phagocytosis and clearing of immune complexes. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2008].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001129691" }, "gene_names": [ { "name": "FCGR2A", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P12318", "id": "P12318" }, { "name": "CD32; CD32A; CDw32; FCG2; FcgammaRIIa; FcGR; FCGR2; FCGR2A1; IGFR2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001129691", "id": "NP_001129691" }, { "name": "CD32", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P12318", "id": "P12318" }, { "name": "FCG2", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P12318", "id": "P12318" }, { "name": "FCGR2A1", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P12318", "id": "P12318" }, { "name": "FCGR2A", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001129691", "id": "NP_001129691" }, { "name": "IGFR2", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P12318", "id": "P12318" } ], "protein_names": [ { "name": "Low affinity immunoglobulin gamma Fc region receptor II-a", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P12318" }, { "name": "CDw32", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P12318" }, { "name": "Fc-gamma RII-a", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P12318" }, { "name": "Fc-gamma-RIIa", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P12318" }, { "name": "FcRII-a", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P12318" }, { "name": "IgG Fc receptor II-a", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P12318" }, { "name": "Immunoglobulin G Fc receptor II; low affinity immunoglobulin gamma Fc region receptor II-a; fcRII-a; fc-gamma-RIIa; igG Fc receptor II-a; Fc fragment of IgG, low affinity IIa, receptor (CD32); Fc gamma receptor RIIa3; Fc fragment of IgG receptor IIa", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001129691", "id": "NP_001129691" }, { "name": "low affinity immunoglobulin gamma Fc region receptor II-a isoform 1 precursor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001129691", "id": "NP_001129691" } ], "function": [ { "annotation": "Association between functional FCGR3A F158V and FCGR2A R131H polymorphisms and responsiveness to rituximab in patients with autoimmune diseases: a meta-analysis. Review article", "evidence": [ { "database": "RefSeq", "id": "NP_001129691", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001129691" }, { "database": "PubMed", "id": "37149714", "url": "https://glygen.org/publication/PubMed/37149714" } ] }, { "annotation": "Association between the functional FCGR3A F158V and FCGR2A R131H polymorphisms and responsiveness to biologics in rheumatoid arthritis patients: A meta-analysis.", "evidence": [ { "database": "RefSeq", "id": "NP_001129691", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001129691" }, { "database": "PubMed", "id": "37114884", "url": "https://glygen.org/publication/PubMed/37114884" } ] }, { "annotation": "Binds to the Fc region of immunoglobulins gamma. Low affinity receptor. By binding to IgG it initiates cellular responses against pathogens and soluble antigens. Promotes phagocytosis of opsonized antigens.", "evidence": [ { "database": "UniProtKB", "id": "P12318", "url": "https://www.uniprot.org/uniprot/P12318#function" }, { "database": "PubMed", "id": "19011614", "url": "https://glygen.org/publication/PubMed/19011614" } ] }, { "annotation": "Comparative Analysis of FCGR Gene Polymorphism in Pulmonary Sarcoidosis and Tuberculosis. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_001129691", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001129691" }, { "database": "PubMed", "id": "37174624", "url": "https://glygen.org/publication/PubMed/37174624" } ] }, { "annotation": "Cytoskeleton Dependent Mobility Dynamics of FcgammaRIIA Facilitates Platelet Haptotaxis and Capture of Opsonized Bacteria. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_001129691", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001129691" }, { "database": "PubMed", "id": "35626650", "url": "https://glygen.org/publication/PubMed/35626650" } ] }, { "annotation": "Relationship Between Human FCgammaRIIA rs1801274 G Allele and Risk of Death Among Different SARS-CoV-2 Variants.", "evidence": [ { "database": "RefSeq", "id": "NP_001129691", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001129691" }, { "database": "PubMed", "id": "38029355", "url": "https://glygen.org/publication/PubMed/38029355" } ] }, { "annotation": "This gene encodes one member of a family of immunoglobulin Fc receptor genes found on the surface of many immune response cells. The protein encoded by this gene is a cell surface receptor found on phagocytic cells such as macrophages and neutrophils, and is involved in the process of phagocytosis and clearing of immune complexes. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2008].", "evidence": [ { "database": "RefSeq", "id": "NP_001129691", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001129691" } ] } ], "disease": [], "snv": [ { "evidence": [ { "id": "rs912139222", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs912139222" }, { "id": "rs912139222", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs912139222#frequency_tab" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 110, "end_pos": 110, "sequence_org": "S", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (SLS->NLS).", "chr_id": "1", "chr_pos": "161509889", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S110", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs754949042", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs754949042" }, { "id": "rs754949042", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs754949042" }, { "id": "rs754949042", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs754949042" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 164, "end_pos": 164, "sequence_org": "K", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (KFS->NFS).", "chr_id": "1", "chr_pos": "161510052", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "K164", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P12318", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P12318" } ], "glycoeffect": [], "start_pos": 167, "end_pos": 167, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "H", "sequence_mut": "R", "comment": "Somatic mutation passed 1 out of 6 filters: num. of cancers (3).", "chr_id": "1", "chr_pos": "161509955", "ref_nt": "A", "alt_nt": "G", "minor_allelic_frequency": "", "site_lbl": "H167", "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] }, { "disease_id": "DOID:2531", "recommended_name": { "id": "DOID:2531", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2531", "name": "hematologic cancer", "description": "An organ system cancer located in the hematological system that is characterized by uncontrolled cellular proliferation in blood, bone marrow and lymph nodes." }, "synonyms": [ { "id": "DOID:2531", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2531", "name": "Hematologic malignancy", "description": "" }, { "id": "DOID:2531", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2531", "name": "Hematologic neoplasm", "description": "" }, { "id": "DOID:2531", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2531", "name": "Hematological tumors", "description": "" }, { "id": "DOID:2531", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2531", "name": "blood cancer", "description": "" }, { "id": "DOID:2531", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2531", "name": "hematopoietic and lymphoid system tumor", "description": "" }, { "id": "DOID:2531", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2531", "name": "hematopoietic cancer", "description": "" }, { "id": "DOID:2531", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2531", "name": "hematopoietic neoplasm", "description": "" }, { "id": "DOID:2531", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2531", "name": "hematopoietic tumors", "description": "" }, { "id": "DOID:2531", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2531", "name": "malignant hematopoietic neoplasm", "description": "" } ] }, { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "P12318", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P12318" }, { "id": "rs770453527", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs770453527" }, { "id": "rs770453527", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs770453527" }, { "id": "rs770453527", "database": "NCI-TCGA", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs770453527" }, { "id": "rs770453527", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs770453527#frequency_tab" }, { "id": "rs770453527", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs770453527" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 171, "end_pos": 171, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "T", "sequence_mut": "N", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (TFS->NFS).", "chr_id": "1", "chr_pos": "161509967", "ref_nt": "C", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "T171", "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease", "ebi", "germline" ] }, { "evidence": [ { "id": "P12318", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P12318" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 178, "end_pos": 178, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "N", "sequence_mut": "K", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NHS->KHS).", "chr_id": "1", "chr_pos": "161509989", "ref_nt": "C", "alt_nt": "G", "minor_allelic_frequency": "", "site_lbl": "N178", "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "P12318", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P12318" } ], "glycoeffect": [], "start_pos": 274, "end_pos": 274, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "L", "sequence_mut": "P", "comment": "Somatic mutation passed 1 out of 6 filters: num. of cancers (3).", "chr_id": "1", "chr_pos": "161518015", "ref_nt": "T", "alt_nt": "C", "minor_allelic_frequency": "", "site_lbl": "L274", "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] }, { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] }, { "disease_id": "DOID:2531", "recommended_name": { "id": "DOID:2531", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2531", "name": "hematologic cancer", "description": "An organ system cancer located in the hematological system that is characterized by uncontrolled cellular proliferation in blood, bone marrow and lymph nodes." }, "synonyms": [ { "id": "DOID:2531", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2531", "name": "Hematologic malignancy", "description": "" }, { "id": "DOID:2531", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2531", "name": "Hematologic neoplasm", "description": "" }, { "id": "DOID:2531", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2531", "name": "Hematological tumors", "description": "" }, { "id": "DOID:2531", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2531", "name": "blood cancer", "description": "" }, { "id": "DOID:2531", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2531", "name": "hematopoietic and lymphoid system tumor", "description": "" }, { "id": "DOID:2531", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2531", "name": "hematopoietic cancer", "description": "" }, { "id": "DOID:2531", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2531", "name": "hematopoietic neoplasm", "description": "" }, { "id": "DOID:2531", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2531", "name": "hematopoietic tumors", "description": "" }, { "id": "DOID:2531", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2531", "name": "malignant hematopoietic neoplasm", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "P12318", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P12318" }, { "id": "rs748691249", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs748691249" }, { "id": "rs748691249", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs748691249" }, { "id": "rs748691249", "database": "NCI-TCGA", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs748691249" }, { "id": "rs748691249", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs748691249#frequency_tab" }, { "id": "rs748691249", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs748691249" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 70, "end_pos": 70, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "S", "sequence_mut": "N", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (SDS->NDS).", "chr_id": "1", "chr_pos": "161506436", "ref_nt": "G", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "S70", "disease": [ { "disease_id": "DOID:1115", "recommended_name": { "id": "DOID:1115", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1115", "name": "sarcoma", "description": "A cell type cancer that has_material_basis_in abnormally proliferating cells derives from embryonic mesoderm." }, "synonyms": [ { "id": "DOID:1115", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1115", "name": "connective and soft tissue neoplasm", "description": "" }, { "id": "DOID:1115", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1115", "name": "tumor of soft tissue and skeleton", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease", "ebi", "germline" ] }, { "evidence": [ { "id": "rs748385327", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs748385327" }, { "id": "rs748385327", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs748385327" }, { "id": "rs748385327", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs748385327#frequency_tab" }, { "id": "rs748385327", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs748385327" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 97, "end_pos": 97, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDS->KDS).", "chr_id": "1", "chr_pos": "161506518", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N97", "keywords": [ "ebi", "germline" ] } ], "mutagenesis": [], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "90.84", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000143226", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000143226" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "92.47", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000143226", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000143226" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "98.21", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000143226", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000143226" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "92.63", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000143226", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000143226" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "86.98", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000143226", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000143226" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "81.67", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000143226", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000143226" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "86.72", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000143226", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000143226" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "79.53", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000143226", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000143226" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "86.44", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000143226", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000143226" } ] } ], "expression_disease": [ { "significant": "No", "trend": "up", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "P12318", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P12318" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "P12318", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P12318" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "P12318", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P12318" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "P12318", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P12318" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "P12318", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P12318" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "P12318", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P12318" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "P12318", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P12318" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "P12318", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P12318" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "P12318", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P12318" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "P12318", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P12318" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "P12318", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P12318" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "P12318", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P12318" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P12318", "url": "https://www.uniprot.org/uniprot/P12318" } ], "common_name": "Human" } ], "gene": [ { "name": "FCGR2A", "url": "https://www.uniprot.org/uniprot/P12318", "locus": { "chromosome": "1", "start_pos": 161524013, "end_pos": 161505430, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000143226", "url": "https://www.ensembl.org/id/ENSG00000143226" } ] } } ], "crossref": [ { "id": "ENSG00000143226", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000143226", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "P12318", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P12318", "database": "BioMuta", "categories": [ "Variation" ] }, { "id": "cd05752", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd05752", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd05753", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd05753", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "CHEMBL5841", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL5841", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "FCGR2A", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=FCGR2A", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "2212", "url": "https://www.ncbi.nlm.nih.gov/gene/2212", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "2998", "url": "https://glyconnect.expasy.org/browser/proteins/2998", "database": "GlyConnect", "categories": [ "Glycoproteomics", "Glycan" ] }, { "id": "3616", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=3616", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "P12318", "url": "https://www.ebi.ac.uk/intact/interactors/id:P12318*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR003598", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003598", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR003599", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003599", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR007110", "url": "https://www.ebi.ac.uk/interpro/entry/IPR007110", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013783", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013783", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036179", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036179", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:2212", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:2212", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "146790", "url": "http://www.omim.org/entry/146790", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_P12318", "url": "https://www.nextprot.org/entry/NX_P12318", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "LKCHGAH", "url": "https://omabrowser.org/oma/group/LKCHGAH/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5261894at2759", "url": "http://www.orthodb.org/?query=5261894at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR11481", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11481", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11481:SF106", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11481:SF106", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "1FCG", "url": "https://www.rcsb.org/structure/1FCG", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1H9V", "url": "https://www.rcsb.org/structure/1H9V", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3D5O", "url": "https://www.rcsb.org/structure/3D5O", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3RY4", "url": "https://www.rcsb.org/structure/3RY4", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3RY5", "url": "https://www.rcsb.org/structure/3RY5", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3RY6", "url": "https://www.rcsb.org/structure/3RY6", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF13895", "url": "http://pfam.xfam.org/family/PF13895", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "P12318", "url": "https://pharos.nih.gov/targets/P12318", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_P12318", "url": "http://purl.obolibrary.org/obo/PR_P12318", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-2029481", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029481", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-2029485", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029485", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-6798695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6798695", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9664323", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9664323", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001129691", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001129691", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A8V8TN00", "url": "https://www.uniprot.org/uniprot/A0A8V8TN00", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8V8TN00-1", "url": "https://www.uniprot.org/uniprot/A0A8V8TN00-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8V8TN30", "url": "https://www.uniprot.org/uniprot/A0A8V8TN30", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8V8TN30-1", "url": "https://www.uniprot.org/uniprot/A0A8V8TN30-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8V8TPS4", "url": "https://www.uniprot.org/uniprot/A0A8V8TPS4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8V8TPS4-1", "url": "https://www.uniprot.org/uniprot/A0A8V8TPS4-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F5GX41", "url": "https://www.uniprot.org/uniprot/F5GX41", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F5GX41-1", "url": "https://www.uniprot.org/uniprot/F5GX41-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F5GXY9", "url": "https://www.uniprot.org/uniprot/F5GXY9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F5GXY9-1", "url": "https://www.uniprot.org/uniprot/F5GXY9-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P12318", "url": "https://www.uniprot.org/uniprot/P12318", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P12318-1", "url": "https://www.uniprot.org/uniprot/P12318-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P12318-2", "url": "https://www.uniprot.org/uniprot/P12318-2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "V9GY55", "url": "https://www.uniprot.org/uniprot/V9GY55", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "V9GY55-1", "url": "https://www.uniprot.org/uniprot/V9GY55-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "V9GY83", "url": "https://www.uniprot.org/uniprot/V9GY83", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "V9GY83-1", "url": "https://www.uniprot.org/uniprot/V9GY83-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MTMETQMSQNVCPRNLWLLQPLTVLLLLASADSQAAAPPKAVLKLEPPWINVLQEDSVTLTCQGARSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIMLRCHSWKDKPLVKVTFFQNGKSQKFSHLDPTFSIPQANHSHSGDYHCTGNIGYTLFSSKPVTITVQVPSMGSSSPMGIIVAVVIATAVAAIVAAVVALIYCRKKRISANSTDPVKAAQFEPPGRQMIAIRKRQLEETNNDYETADGGYMTLNPRAPTDDDKNIYLTLPPNDHVNSNN", "length": 317, "header": "sp|P12318-1|FCG2A_HUMAN Isoform 1 of Low affinity immunoglobulin gamma Fc region receptor II-a OS=Homo sapiens OX=9606 GN=FCGR2A PE=1 SV=4 CANONICAL=P12318-1" }, "isoforms": [ { "isoform_ac": "A0A8V8TN00-1", "url": "", "sequence": { "sequence": "MTMETQMSQNVCPRNLWLLQPLTVLLLLASADSQAEWLVLQTPHLEFQEGETIMLRCHSWKDKPLVKVTFFQNGKSQKFSHLDPTFSIPQANHSHSGDYHCTGNIGYTLFSSKPVTITVQVPSMGSSSPMGIIVAVVIATAVAAIVAAVVALIYCRKKRISANSTDPVKAAQFEPPGRQMIAIRKRQLEETNNDYETADGGYMTLNPRAPTDDDKNIYLTLPPNDHVNSNN", "length": 231, "header": "tr|A0A8V8TN00-1|A0A8V8TN00_HUMAN Computationally mapped isoform of Fc gamma receptor IIa OS=Homo sapiens OX=9606 GN=FCGR2A PE=1 SV=1 CANONICAL=P12318-1" }, "locus": { "chromosome": "1", "start_pos": 161518145, "end_pos": 161505468, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000699278.1", "url": "https://www.ensembl.org/id/ENST00000699278.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000514259.1", "url": "https://www.ensembl.org/id/ENSP00000514259.1" } ] } }, { "isoform_ac": "A0A8V8TN30-1", "url": "", "sequence": { "sequence": "MLRCHSWKDKPLVKVTFFQNGKSQKFSHLDPTFSIPQANHSHSGDYHCTGNIGYTLFSSKPVTITVQVPSMGSSSPMGIIVAVVIATAVAAIVAAVVALIYCRKKRISANSTDPVKAAQFEPPGRQMIAIRKRQLEETNNDYETADGGYMTLNPRAPTDDDKNIYLTLPPNDHVNSNN", "length": 178, "header": "tr|A0A8V8TN30-1|A0A8V8TN30_HUMAN Computationally mapped isoform of Fc gamma receptor IIa OS=Homo sapiens OX=9606 GN=FCGR2A PE=1 SV=1 CANONICAL=P12318-1" }, "locus": { "chromosome": "1", "start_pos": 161518145, "end_pos": 161509873, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000699279.1", "url": "https://www.ensembl.org/id/ENST00000699279.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000514260.1", "url": "https://www.ensembl.org/id/ENSP00000514260.1" } ] } }, { "isoform_ac": "A0A8V8TPS4-1", "url": "", "sequence": { "sequence": "MTMETQMSQNVCPRNLWLLQPLTVLLLLASADSQAAAPPKAVLKLEPPWINVLQEDSVTLTCQGARSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIMLRCHSWKDKPLVKVTFFQNGKSQKFSHLDPTFSIPQANHSHSGDYHCTGNIGYTLFSSKPVTITVQANSTDPVKAAQFEPPGRQMIAIRKRQLEETNNDYETADGGYMTLNPRAPTDDDKNIYLTLPPNDHVNSNN", "length": 276, "header": "tr|A0A8V8TPS4-1|A0A8V8TPS4_HUMAN Computationally mapped isoform of Fc gamma receptor IIa OS=Homo sapiens OX=9606 GN=FCGR2A PE=1 SV=1 CANONICAL=P12318-1" }, "locus": { "chromosome": "1", "start_pos": 161518145, "end_pos": 161505468, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000699277.1", "url": "https://www.ensembl.org/id/ENST00000699277.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000514258.1", "url": "https://www.ensembl.org/id/ENSP00000514258.1" } ] } }, { "isoform_ac": "F5GX41-1", "url": "", "sequence": { "sequence": "MTMETQMSQNVCPRNLWLLQPLTVLLLLASADSQAAAPPKAVLKLEPPWINVLQEDSVTLTCQGARSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSGQWRKAPGWTWEGQDG", "length": 137, "header": "tr|F5GX41-1|FCG2A_HUMAN Computationally mapped isoform of Low affinity immunoglobulin gamma Fc region receptor II-a OS=Homo sapiens OX=9606 GN=FCGR2A PE=1 SV=1 CANONICAL=P12318-1" }, "locus": { "chromosome": "1", "start_pos": 161506638, "end_pos": 161505468, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000536731.5", "url": "https://www.ensembl.org/id/ENST00000536731.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000441156.1", "url": "https://www.ensembl.org/id/ENSP00000441156.1" } ] } }, { "isoform_ac": "F5GXY9-1", "url": "", "sequence": { "sequence": "MTMETQMSQNVCPRNLWLLQPLTVLLLLASADSQAAPPKAVLKLEPPWINVLQEDSVTLTCQGARSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSGQWRKAPGWTWEGQDG", "length": 136, "header": "tr|F5GXY9-1|FCG2A_HUMAN Computationally mapped isoform of Low affinity immunoglobulin gamma Fc region receptor II-a OS=Homo sapiens OX=9606 GN=FCGR2A PE=1 SV=1 CANONICAL=P12318-1" }, "locus": { "chromosome": "1", "start_pos": 161506638, "end_pos": 161505468, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000483665.6", "url": "https://www.ensembl.org/id/ENST00000483665.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000440148.1", "url": "https://www.ensembl.org/id/ENSP00000440148.1" } ] } }, { "isoform_ac": "P12318-1", "url": "", "sequence": { "sequence": "MTMETQMSQNVCPRNLWLLQPLTVLLLLASADSQAAAPPKAVLKLEPPWINVLQEDSVTLTCQGARSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIMLRCHSWKDKPLVKVTFFQNGKSQKFSHLDPTFSIPQANHSHSGDYHCTGNIGYTLFSSKPVTITVQVPSMGSSSPMGIIVAVVIATAVAAIVAAVVALIYCRKKRISANSTDPVKAAQFEPPGRQMIAIRKRQLEETNNDYETADGGYMTLNPRAPTDDDKNIYLTLPPNDHVNSNN", "length": 317, "header": "sp|P12318-1|FCG2A_HUMAN Isoform 1 of Low affinity immunoglobulin gamma Fc region receptor II-a OS=Homo sapiens OX=9606 GN=FCGR2A PE=1 SV=4 CANONICAL=P12318-1" }, "locus": { "chromosome": "1", "start_pos": 161518145, "end_pos": 161505468, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000271450.12", "url": "https://www.ensembl.org/id/ENST00000271450.12" }, { "database": "Ensembl Peptide", "id": "ENSP00000271450.6", "url": "https://www.ensembl.org/id/ENSP00000271450.6" } ] } }, { "isoform_ac": "P12318-2", "url": "", "sequence": { "sequence": "MTMETQMSQNVCPRNLWLLQPLTVLLLLASADSQAAPPKAVLKLEPPWINVLQEDSVTLTCQGARSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIMLRCHSWKDKPLVKVTFFQNGKSQKFSHLDPTFSIPQANHSHSGDYHCTGNIGYTLFSSKPVTITVQVPSMGSSSPMGIIVAVVIATAVAAIVAAVVALIYCRKKRISANSTDPVKAAQFEPPGRQMIAIRKRQLEETNNDYETADGGYMTLNPRAPTDDDKNIYLTLPPNDHVNSNN", "length": 316, "header": "sp|P12318-2|FCG2A_HUMAN Isoform 2 of Low affinity immunoglobulin gamma Fc region receptor II-a OS=Homo sapiens OX=9606 GN=FCGR2A PE=1 SV=4 CANONICAL=P12318-1" }, "locus": { "chromosome": "1", "start_pos": 161518145, "end_pos": 161505468, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000367972.8", "url": "https://www.ensembl.org/id/ENST00000367972.8" }, { "database": "Ensembl Peptide", "id": "ENSP00000356949.4", "url": "https://www.ensembl.org/id/ENSP00000356949.4" } ] } }, { "isoform_ac": "V9GY55-1", "url": "", "sequence": { "sequence": "XSTDPVKAAQFEPPGRQMIAIRKRQLEETNNDYETADGGYMTLNPRAPTDDDKNIYLTLPPNDHVNMQLPEGCDLLREVIPGRLET", "length": 86, "header": "tr|V9GY55-1|FCG2A_HUMAN Computationally mapped isoform of Low affinity immunoglobulin gamma Fc region receptor II-a OS=Homo sapiens OX=9606 GN=FCGR2A PE=1 SV=1 CANONICAL=P12318-1" }, "locus": { "chromosome": "1", "start_pos": 161519966, "end_pos": 161513898, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000459885.1", "url": "https://www.ensembl.org/id/ENST00000459885.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000476411.1", "url": "https://www.ensembl.org/id/ENSP00000476411.1" } ] } }, { "isoform_ac": "V9GY83-1", "url": "", "sequence": { "sequence": "AAPPKAVLKLEPPWINVLQEDSVTLTCQGARSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIMLRCHSWKDKPLVKVTFFQNGKSQKFSHLDPTFSIPQANHSHSGDYHCTGNIGYTLFSSKPVTITVQAWAALHQWGSLWLWSLRLL", "length": 190, "header": "tr|V9GY83-1|V9GY83_HUMAN Computationally mapped isoform of Fc gamma receptor IIa OS=Homo sapiens OX=9606 GN=FCGR2A PE=1 SV=1 CANONICAL=P12318-1" }, "locus": { "chromosome": "1", "start_pos": 161510896, "end_pos": 161506333, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000467525.5", "url": "https://www.ensembl.org/id/ENST00000467525.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000476495.1", "url": "https://www.ensembl.org/id/ENSP00000476495.1" } ] } } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 178, "start_aa": "Asn", "end_pos": 178, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn178", "evidence": [ { "id": "P12318", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P12318#ptm_processing" }, { "id": "10397151", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10397151" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 97, "start_aa": "Asn", "end_pos": 97, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn97", "evidence": [ { "id": "P12318", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P12318#ptm_processing" }, { "id": "10397151", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10397151" } ] }, { "glytoucan_ac": "G03382KH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "2998", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2998" }, { "id": "25345863", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25345863" } ] }, { "glytoucan_ac": "G05724UK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "2998", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2998" }, { "id": "25345863", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25345863" } ] }, { "glytoucan_ac": "G06110VR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "2998", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2998" }, { "id": "25345863", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25345863" } ] }, { "glytoucan_ac": "G17689DH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "2998", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2998" }, { "id": "25345863", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25345863" } ] }, { "glytoucan_ac": "G22310AV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "2998", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2998" }, { "id": "25345863", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25345863" } ] }, { "glytoucan_ac": "G23432EQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "2998", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2998" }, { "id": "25345863", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25345863" } ] }, { "glytoucan_ac": "G23863VK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "2998", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2998" }, { "id": "25345863", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25345863" } ] }, { "glytoucan_ac": "G25520XG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "2998", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2998" }, { "id": "25345863", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25345863" } ] }, { "glytoucan_ac": "G26915XM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "2998", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2998" }, { "id": "25345863", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25345863" } ] }, { "glytoucan_ac": "G29011JC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "2998", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2998" }, { "id": "25345863", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25345863" } ] }, { "glytoucan_ac": "G31916IQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "2998", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2998" }, { "id": "25345863", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25345863" } ] }, { "glytoucan_ac": "G31936TA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "2998", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2998" }, { "id": "25345863", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25345863" } ] }, { "glytoucan_ac": "G39188ZX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "2998", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2998" }, { "id": "25345863", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25345863" } ] }, { "glytoucan_ac": "G39213VZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "2998", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2998" }, { "id": "25345863", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25345863" } ] }, { "glytoucan_ac": "G46687AB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "2998", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2998" }, { "id": "25345863", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25345863" } ] }, { "glytoucan_ac": "G49874UX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "2998", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2998" }, { "id": "25345863", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25345863" } ] }, { "glytoucan_ac": "G55220VL", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "2998", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2998" }, { "id": "25345863", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25345863" } ] }, { "glytoucan_ac": "G60145BJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "2998", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2998" }, { "id": "25345863", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25345863" } ] }, { "glytoucan_ac": "G62326NX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "2998", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2998" }, { "id": "25345863", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25345863" } ] }, { "glytoucan_ac": "G62389NM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "2998", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2998" }, { "id": "25345863", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25345863" } ] }, { "glytoucan_ac": "G63381RX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "2998", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2998" }, { "id": "25345863", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25345863" } ] }, { "glytoucan_ac": "G64527OM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "2998", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2998" }, { "id": "25345863", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25345863" } ] }, { "glytoucan_ac": "G70418MS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "2998", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2998" }, { "id": "25345863", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25345863" } ] }, { "glytoucan_ac": "G72291OX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "2998", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2998" }, { "id": "25345863", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25345863" } ] }, { "glytoucan_ac": "G72667IM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "2998", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2998" }, { "id": "25345863", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25345863" } ] }, { "glytoucan_ac": "G72797UR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "2998", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2998" }, { "id": "25345863", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25345863" } ] }, { "glytoucan_ac": "G72902CL", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "2998", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2998" }, { "id": "25345863", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25345863" } ] }, { "glytoucan_ac": "G74430RZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "2998", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2998" }, { "id": "25345863", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25345863" } ] }, { "glytoucan_ac": "G78059CC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "2998", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2998" }, { "id": "25345863", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25345863" } ] }, { "glytoucan_ac": "G80858MF", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "2998", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2998" }, { "id": "25345863", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25345863" } ] }, { "glytoucan_ac": "G82119TF", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "2998", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2998" }, { "id": "25345863", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25345863" } ] }, { "glytoucan_ac": "G84452RH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "2998", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2998" }, { "id": "25345863", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25345863" } ] }, { "glytoucan_ac": "G90093AU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "2998", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2998" }, { "id": "25345863", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25345863" } ] }, { "glytoucan_ac": "G90717TP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "2998", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2998" }, { "id": "25345863", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25345863" } ] }, { "glytoucan_ac": "G91636VS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "2998", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2998" }, { "id": "25345863", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25345863" } ] }, { "glytoucan_ac": "G93141AZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "2998", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2998" }, { "id": "25345863", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25345863" } ] }, { "glytoucan_ac": "G96095QD", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "2998", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2998" }, { "id": "25345863", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25345863" } ] }, { "glytoucan_ac": "G96771UL", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "2998", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2998" }, { "id": "25345863", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25345863" } ] } ], "phosphorylation": [ { "start_pos": 281, "end_pos": 281, "kinase_uniprot_canonical_ac": "P06241-1", "kinase_gene_name": "FYN", "residue": "Tyr", "comment": "", "evidence": [ { "database": "phospho.ELM", "id": "P12318", "url": "http://phospho.elm.eu.org/byAccession/P12318.html" }, { "database": "iPTMnet", "id": "P12318", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P12318" }, { "database": "PubMed", "id": "8756631", "url": "https://glygen.org/publication/PubMed/8756631" } ], "site_lbl": "Tyr281" }, { "start_pos": 281, "end_pos": 281, "kinase_uniprot_canonical_ac": "P07948-1", "kinase_gene_name": "LYN", "residue": "Tyr", "comment": "", "evidence": [ { "database": "phospho.ELM", "id": "P12318", "url": "http://phospho.elm.eu.org/byAccession/P12318.html" }, { "database": "iPTMnet", "id": "P12318", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P12318" }, { "database": "PubMed", "id": "8756631", "url": "https://glygen.org/publication/PubMed/8756631" } ], "site_lbl": "Tyr281" }, { "start_pos": 281, "end_pos": 281, "kinase_uniprot_canonical_ac": "P43405-1", "kinase_gene_name": "SYK", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P12318", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P12318" }, { "database": "PubMed", "id": "8756631", "url": "https://glygen.org/publication/PubMed/8756631" }, { "database": "phospho.ELM", "id": "P12318", "url": "http://phospho.elm.eu.org/byAccession/P12318.html" } ], "site_lbl": "Tyr281" }, { "start_pos": 281, "end_pos": 281, "kinase_uniprot_canonical_ac": "P51451-1", "kinase_gene_name": "BLK", "residue": "Tyr", "comment": "", "evidence": [ { "database": "phospho.ELM", "id": "P12318", "url": "http://phospho.elm.eu.org/byAccession/P12318.html" }, { "database": "iPTMnet", "id": "P12318", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P12318" }, { "database": "PubMed", "id": "8756631", "url": "https://glygen.org/publication/PubMed/8756631" } ], "site_lbl": "Tyr281" }, { "start_pos": 288, "end_pos": 288, "kinase_uniprot_canonical_ac": "P06241-1", "kinase_gene_name": "FYN", "residue": "Tyr", "comment": "", "evidence": [ { "database": "phospho.ELM", "id": "P12318", "url": "http://phospho.elm.eu.org/byAccession/P12318.html" }, { "database": "iPTMnet", "id": "P12318", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P12318" }, { "database": "PubMed", "id": "8756631", "url": "https://glygen.org/publication/PubMed/8756631" } ], "site_lbl": "Tyr288" }, { "start_pos": 288, "end_pos": 288, "kinase_uniprot_canonical_ac": "P07948-1", "kinase_gene_name": "LYN", "residue": "Tyr", "comment": "", "evidence": [ { "database": "phospho.ELM", "id": "P12318", "url": "http://phospho.elm.eu.org/byAccession/P12318.html" }, { "database": "iPTMnet", "id": "P12318", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P12318" }, { "database": "PubMed", "id": "8756631", "url": "https://glygen.org/publication/PubMed/8756631" } ], "site_lbl": "Tyr288" }, { "start_pos": 288, "end_pos": 288, "kinase_uniprot_canonical_ac": "P43405-1", "kinase_gene_name": "SYK", "residue": "Tyr", "comment": "", "evidence": [ { "database": "phospho.ELM", "id": "P12318", "url": "http://phospho.elm.eu.org/byAccession/P12318.html" }, { "database": "iPTMnet", "id": "P12318", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P12318" }, { "database": "PubMed", "id": "8756631", "url": "https://glygen.org/publication/PubMed/8756631" } ], "site_lbl": "Tyr288" }, { "start_pos": 288, "end_pos": 288, "kinase_uniprot_canonical_ac": "P51451-1", "kinase_gene_name": "BLK", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P12318", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P12318" }, { "database": "PubMed", "id": "8756631", "url": "https://glygen.org/publication/PubMed/8756631" }, { "database": "phospho.ELM", "id": "P12318", "url": "http://phospho.elm.eu.org/byAccession/P12318.html" } ], "site_lbl": "Tyr288" }, { "start_pos": 288, "end_pos": 288, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by SRC-type Tyr-kinases", "evidence": [ { "database": "UniProtKB", "id": "P12318", "url": "https://www.uniprot.org/uniprot/P12318" }, { "database": "IntAct", "id": "P12318", "url": "https://www.ebi.ac.uk/intact/interactors/id:P12318*" }, { "database": "iPTMnet", "id": "P12318", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P12318" }, { "database": "PubMed", "id": "7487883", "url": "https://glygen.org/publication/PubMed/7487883" }, { "database": "phospho.ELM", "id": "P12318", "url": "http://phospho.elm.eu.org/byAccession/P12318.html" }, { "database": "PubMed", "id": "18083107", "url": "https://glygen.org/publication/PubMed/18083107" }, { "database": "PRO", "id": "P12318", "url": "http://purl.obolibrary.org/obo/P12318" }, { "database": "PubMed", "id": "8756631", "url": "https://glygen.org/publication/PubMed/8756631" } ], "site_lbl": "Tyr288" }, { "start_pos": 304, "end_pos": 304, "kinase_uniprot_canonical_ac": "P06241-1", "kinase_gene_name": "FYN", "residue": "Tyr", "comment": "", "evidence": [ { "database": "phospho.ELM", "id": "P12318", "url": "http://phospho.elm.eu.org/byAccession/P12318.html" }, { "database": "iPTMnet", "id": "P12318", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P12318" }, { "database": "PubMed", "id": "8756631", "url": "https://glygen.org/publication/PubMed/8756631" } ], "site_lbl": "Tyr304" }, { "start_pos": 304, "end_pos": 304, "kinase_uniprot_canonical_ac": "P07948-1", "kinase_gene_name": "LYN", "residue": "Tyr", "comment": "", "evidence": [ { "database": "phospho.ELM", "id": "P12318", "url": "http://phospho.elm.eu.org/byAccession/P12318.html" }, { "database": "iPTMnet", "id": "P12318", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P12318" }, { "database": "PubMed", "id": "8756631", "url": "https://glygen.org/publication/PubMed/8756631" } ], "site_lbl": "Tyr304" }, { "start_pos": 304, "end_pos": 304, "kinase_uniprot_canonical_ac": "P43405-1", "kinase_gene_name": "SYK", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P12318", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P12318" }, { "database": "PubMed", "id": "8756631", "url": "https://glygen.org/publication/PubMed/8756631" }, { "database": "phospho.ELM", "id": "P12318", "url": "http://phospho.elm.eu.org/byAccession/P12318.html" } ], "site_lbl": "Tyr304" }, { "start_pos": 304, "end_pos": 304, "kinase_uniprot_canonical_ac": "P51451-1", "kinase_gene_name": "BLK", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P12318", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P12318" }, { "database": "PubMed", "id": "8756631", "url": "https://glygen.org/publication/PubMed/8756631" }, { "database": "phospho.ELM", "id": "P12318", "url": "http://phospho.elm.eu.org/byAccession/P12318.html" } ], "site_lbl": "Tyr304" }, { "start_pos": 304, "end_pos": 304, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by SRC-type Tyr-kinases", "evidence": [ { "database": "UniProtKB", "id": "P12318", "url": "https://www.uniprot.org/uniprot/P12318" }, { "database": "IntAct", "id": "P12318", "url": "https://www.ebi.ac.uk/intact/interactors/id:P12318*" }, { "database": "iPTMnet", "id": "P12318", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P12318" }, { "database": "PubMed", "id": "7487883", "url": "https://glygen.org/publication/PubMed/7487883" }, { "database": "PRO", "id": "P12318", "url": "http://purl.obolibrary.org/obo/P12318" }, { "database": "PubMed", "id": "8756631", "url": "https://glygen.org/publication/PubMed/8756631" } ], "site_lbl": "Tyr304" } ], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "The interaction between N-WASP and the Arp2/3 complex links Cdc42-dependent signals to actin assembly.", "journal": "Cell", "date": "1999", "authors": "Rohatgi R, Ma L, Miki H, Lopez M, Kirchhausen T, Takenawa T, Kirschner MW", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "10219243", "url": "https://glygen.org/publication/PubMed/10219243" } ] }, { "title": "Phospholipases and phagocytosis: the role of phospholipid-derived second messengers in phagocytosis.", "journal": "The international journal of biochemistry & cell biology", "date": "1999", "authors": "Lennartz MR", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029485", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029485" } ], "reference": [ { "type": "PubMed", "id": "10224668", "url": "https://glygen.org/publication/PubMed/10224668" } ] }, { "title": "Crystal structure of the human leukocyte Fc receptor, Fc gammaRIIa.", "journal": "Nat. Struct. Biol.", "date": "1999", "authors": "Maxwell K F, Powell M S, Hulett M D, Barton P A, McKenzie I F, Garrett T P, Hogarth P M", "evidence": [ { "database": "UniProtKB", "id": "P12318", "url": "https://www.uniprot.org/uniprot/P12318" } ], "reference": [ { "type": "PubMed", "id": "10331870", "url": "https://glygen.org/publication/PubMed/10331870" } ] }, { "title": "Biochemical analysis and crystallisation of Fc gamma RIIa, the low affinity receptor for IgG.", "journal": "Immunology letters", "date": "1999", "authors": "Powell MS, Barton PA, Emmanouilidis D, Wines BD, Neumann GM, Peitersz GA, Maxwell KF, Garrett TP, Hogarth PM", "evidence": [ { "database": "UniProtKB", "id": "P12318", "url": "https://www.uniprot.org/uniprot/P12318#ptm_processing" }, { "database": "UniProtKB", "id": "P12318", "url": "https://www.uniprot.org/uniprot/P12318" } ], "reference": [ { "type": "PubMed", "id": "10397151", "url": "https://glygen.org/publication/PubMed/10397151" } ] }, { "title": "Localization of p21-activated kinase 1 (PAK1) to pseudopodia, membrane ruffles, and phagocytic cups in activated human neutrophils.", "journal": "Journal of leukocyte biology", "date": "1999", "authors": "Dharmawardhane S, Brownson D, Lennartz M, Bokoch GM", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "10496324", "url": "https://glygen.org/publication/PubMed/10496324" } ] }, { "title": "Activation of LIM-kinase by Pak1 couples Rac/Cdc42 GTPase signalling to actin cytoskeletal dynamics.", "journal": "Nature cell biology", "date": "1999", "authors": "Edwards DC, Sanders LC, Bokoch GM, Gill GN", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "10559936", "url": "https://glygen.org/publication/PubMed/10559936" } ] }, { "title": "Phospholipase C-gamma as a signal-transducing element.", "journal": "Experimental cell research", "date": "1999", "authors": "Carpenter G, Ji Qs", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029485", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029485" } ], "reference": [ { "type": "PubMed", "id": "10579907", "url": "https://glygen.org/publication/PubMed/10579907" } ] }, { "title": "Autoinhibition and activation mechanisms of the Wiskott-Aldrich syndrome protein.", "journal": "Nature", "date": "2000", "authors": "Kim AS, Kakalis LT, Abdul-Manan N, Liu GA, Rosen MK", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "10724160", "url": "https://glygen.org/publication/PubMed/10724160" } ] }, { "title": "GRB2 links signaling to actin assembly by enhancing interaction of neural Wiskott-Aldrich syndrome protein (N-WASp) with actin-related protein (ARP2/3) complex.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Carlier MF, Nioche P, Broutin-L'Hermite I, Boujemaa R, Le Clainche C, Egile C, Garbay C, Ducruix A, Sansonetti P, Pantaloni D", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "10781580", "url": "https://glygen.org/publication/PubMed/10781580" } ] }, { "title": "Differential involvement of Src family kinases in Fc gamma receptor-mediated phagocytosis.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2000", "authors": "Suzuki T, Kono H, Hirose N, Okada M, Yamamoto T, Yamamoto K, Honda Z", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029481", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029481" } ], "reference": [ { "type": "PubMed", "id": "10861086", "url": "https://glygen.org/publication/PubMed/10861086" } ] }, { "title": "A complex of N-WASP and WIP integrates signalling cascades that lead to actin polymerization.", "journal": "Nature cell biology", "date": "2000", "authors": "Moreau V, Frischknecht F, Reckmann I, Vincentelli R, Rabut G, Stewart D, Way M", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "10878810", "url": "https://glygen.org/publication/PubMed/10878810" } ] }, { "title": "Activation by Cdc42 and PIP(2) of Wiskott-Aldrich syndrome protein (WASp) stimulates actin nucleation by Arp2/3 complex.", "journal": "The Journal of cell biology", "date": "2000", "authors": "Higgs HN, Pollard TD", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "10995437", "url": "https://glygen.org/publication/PubMed/10995437" } ] }, { "title": "A novel neural Wiskott-Aldrich syndrome protein (N-WASP) binding protein, WISH, induces Arp2/3 complex activation independent of Cdc42.", "journal": "The Journal of cell biology", "date": "2001", "authors": "Fukuoka M, Suetsugu S, Miki H, Fukami K, Endo T, Takenawa T", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "11157975", "url": "https://glygen.org/publication/PubMed/11157975" } ] }, { "title": "The Arp2/3 complex nucleates actin filament branches from the sides of pre-existing filaments.", "journal": "Nature cell biology", "date": "2001", "authors": "Amann KJ, Pollard TD", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "11231582", "url": "https://glygen.org/publication/PubMed/11231582" } ] }, { "title": "Phosphorylation of cofilin by LIM-kinase is necessary for semaphorin 3A-induced growth cone collapse.", "journal": "Nature neuroscience", "date": "2001", "authors": "Aizawa H, Wakatsuki S, Ishii A, Moriyama K, Sasaki Y, Ohashi K, Sekine-Aizawa Y, Sehara-Fujisawa A, Mizuno K, Goshima Y, Yahara I", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "11276226", "url": "https://glygen.org/publication/PubMed/11276226" } ] }, { "title": "The mechanism of PAK activation. Autophosphorylation events in both regulatory and kinase domains control activity.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Chong C, Tan L, Lim L, Manser E", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "11278486", "url": "https://glygen.org/publication/PubMed/11278486" } ] }, { "title": "WASP and WAVE family proteins: key molecules for rapid rearrangement of cortical actin filaments and cell movement.", "journal": "Journal of cell science", "date": "2001", "authors": "Takenawa T, Miki H", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "11329366", "url": "https://glygen.org/publication/PubMed/11329366" } ] }, { "title": "Nck and phosphatidylinositol 4,5-bisphosphate synergistically activate actin polymerization through the N-WASP-Arp2/3 pathway.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Rohatgi R, Nollau P, Ho HY, Kirschner MW, Mayer BJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "11340081", "url": "https://glygen.org/publication/PubMed/11340081" } ] }, { "title": "Molecular basis for immune complex recognition: a comparison of Fc-receptor structures.", "journal": "J. Mol. Biol.", "date": "2001", "authors": "Sondermann P, Kaiser J, Jacob U", "evidence": [ { "database": "UniProtKB", "id": "P12318", "url": "https://www.uniprot.org/uniprot/P12318" } ], "reference": [ { "type": "PubMed", "id": "11397093", "url": "https://glygen.org/publication/PubMed/11397093" } ] }, { "title": "Restricted accumulation of phosphatidylinositol 3-kinase products in a plasmalemmal subdomain during Fc gamma receptor-mediated phagocytosis.", "journal": "The Journal of cell biology", "date": "2001", "authors": "Marshall JG, Booth JW, Stambolic V, Mak T, Balla T, Schreiber AD, Meyer T, Grinstein S", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029485", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029485" } ], "reference": [ { "type": "PubMed", "id": "11425868", "url": "https://glygen.org/publication/PubMed/11425868" } ] }, { "title": "CR16 forms a complex with N-WASP in brain and is a novel member of a conserved proline-rich actin-binding protein family.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2001", "authors": "Ho HY, Rohatgi R, Ma L, Kirschner MW", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "11553796", "url": "https://glygen.org/publication/PubMed/11553796" } ] }, { "title": "Effector function activities of a panel of mutants of a broadly neutralizing antibody against human immunodeficiency virus type 1.", "journal": "J. Virol.", "date": "2001", "authors": "Hezareh M, Hessell AJ, Jensen RC, van de Winkel JG, Parren PW", "evidence": [ { "database": "UniProtKB", "id": "P12318", "url": "https://www.uniprot.org/uniprot/P12318" } ], "reference": [ { "type": "PubMed", "id": "11711607", "url": "https://glygen.org/publication/PubMed/11711607" } ] }, { "title": "Different WASP family proteins stimulate different Arp2/3 complex-dependent actin-nucleating activities.", "journal": "Current biology : CB", "date": "2001", "authors": "Zalevsky J, Lempert L, Kranitz H, Mullins RD", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "11747816", "url": "https://glygen.org/publication/PubMed/11747816" } ] }, { "title": "Protein kinase C: structural and spatial regulation by phosphorylation, cofactors, and macromolecular interactions.", "journal": "Chemical reviews", "date": "2001", "authors": "Newton AC", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029485", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029485" } ], "reference": [ { "type": "PubMed", "id": "11749377", "url": "https://glygen.org/publication/PubMed/11749377" } ] }, { "title": "Pak1 kinase homodimers are autoinhibited in trans and dissociated upon activation by Cdc42 and Rac1.", "journal": "Molecular cell", "date": "2002", "authors": "Parrini MC, Lei M, Harrison SC, Mayer BJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "11804587", "url": "https://glygen.org/publication/PubMed/11804587" } ] }, { "title": "WICH, a novel verprolin homology domain-containing protein that functions cooperatively with N-WASP in actin-microspike formation.", "journal": "Biochemical and biophysical research communications", "date": "2002", "authors": "Kato M, Miki H, Kurita S, Endo T, Nakagawa H, Miyamoto S, Takenawa T", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "11829459", "url": "https://glygen.org/publication/PubMed/11829459" } ] }, { "title": "Dynamics of cytoskeletal proteins during Fcgamma receptor-mediated phagocytosis in macrophages.", "journal": "Molecular biology of the cell", "date": "2002", "authors": "Diakonova M, Bokoch G, Swanson JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "11854399", "url": "https://glygen.org/publication/PubMed/11854399" } ] }, { "title": "Myosin X is a downstream effector of PI(3)K during phagocytosis.", "journal": "Nature cell biology", "date": "2002", "authors": "Cox D, Berg JS, Cammer M, Chinegwundoh JO, Dale BM, Cheney RE, Greenberg S", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "12055636", "url": "https://glygen.org/publication/PubMed/12055636" } ] }, { "title": "May the force be with you: Myosin-X in phagocytosis.", "journal": "Nature cell biology", "date": "2002", "authors": "Chavrier P", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "12105426", "url": "https://glygen.org/publication/PubMed/12105426" } ] }, { "title": "Opsonization modulates Rac-1 activation during cell entry by Leishmania amazonensis.", "journal": "Infection and immunity", "date": "2002", "authors": "Morehead J, Coppens I, Andrews NW", "evidence": [ { "database": "Reactome", "id": "R-HSA-9664323", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9664323" } ], "reference": [ { "type": "PubMed", "id": "12117970", "url": "https://glygen.org/publication/PubMed/12117970" } ] }, { "title": "Rapid association of cytoskeletal remodeling proteins with the developing phagosomes of human neutrophils.", "journal": "Histochemistry and cell biology", "date": "2002", "authors": "Robinson JM, Badwey JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "12189515", "url": "https://glygen.org/publication/PubMed/12189515" } ] }, { "title": "The WASP-binding protein WIRE has a role in the regulation of the actin filament system downstream of the platelet-derived growth factor receptor.", "journal": "Experimental cell research", "date": "2002", "authors": "Aspenstrom P", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "12213210", "url": "https://glygen.org/publication/PubMed/12213210" } ] }, { "title": "Phosphorylation of tyrosine 291 enhances the ability of WASp to stimulate actin polymerization and filopodium formation. Wiskott-Aldrich Syndrome protein.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Cory GO, Garg R, Cramer R, Ridley AJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "12235133", "url": "https://glygen.org/publication/PubMed/12235133" } ] }, { "title": "Phosphorylation of Tyr342 in the linker region of Syk is critical for Fc epsilon RI signaling in mast cells.", "journal": "Molecular and cellular biology", "date": "2002", "authors": "Zhang J, Berenstein E, Siraganian RP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9664323", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9664323" } ], "reference": [ { "type": "PubMed", "id": "12417718", "url": "https://glygen.org/publication/PubMed/12417718" } ] }, { "title": "The role of PI3K in immune cells.", "journal": "Nature immunology", "date": "2003", "authors": "Koyasu S", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029485", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029485" } ], "reference": [ { "type": "PubMed", "id": "12660731", "url": "https://glygen.org/publication/PubMed/12660731" } ] }, { "title": "SHIP-2 inositol phosphatase is inducibly expressed in human monocytes and serves to regulate Fcgamma receptor-mediated signaling.", "journal": "J. Biol. Chem.", "date": "2003", "authors": "Pengal RA, Ganesan LP, Fang H, Marsh CB, Anderson CL, Tridandapani S", "evidence": [ { "database": "UniProtKB", "id": "P12318", "url": "https://www.uniprot.org/uniprot/P12318" } ], "reference": [ { "type": "PubMed", "id": "12690104", "url": "https://glygen.org/publication/PubMed/12690104" } ] }, { "title": "ATP hydrolysis on actin-related protein 2/3 complex causes debranching of dendritic actin arrays.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2003", "authors": "Le Clainche C, Pantaloni D, Carlier MF", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "12743368", "url": "https://glygen.org/publication/PubMed/12743368" } ] }, { "title": "Interleukin-10 therapy--review of a new approach.", "journal": "Pharmacological reviews", "date": "2003", "authors": "Asadullah K, Sterry W, Volk HD", "evidence": [ { "database": "Reactome", "id": "R-HSA-9664323", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9664323" } ], "reference": [ { "type": "PubMed", "id": "12773629", "url": "https://glygen.org/publication/PubMed/12773629" } ] }, { "title": "Class I phosphoinositide 3-kinase p110beta is required for apoptotic cell and Fcgamma receptor-mediated phagocytosis by macrophages.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Leverrier Y, Okkenhaug K, Sawyer C, Bilancio A, Vanhaesebroeck B, Ridley AJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029485", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029485" } ], "reference": [ { "type": "PubMed", "id": "12869549", "url": "https://glygen.org/publication/PubMed/12869549" } ] }, { "title": "Signal transduction by Fc gamma RIII (CD16) is mediated through the gamma chain.", "journal": "The Journal of experimental medicine", "date": "1992", "authors": "Wirthmueller U, Kurosaki T, Murakami MS, Ravetch JV", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029481", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029481" } ], "reference": [ { "type": "PubMed", "id": "1314888", "url": "https://glygen.org/publication/PubMed/1314888" } ] }, { "title": "Activation of Fc gamma RII induces tyrosine phosphorylation of multiple proteins including Fc gamma RII.", "journal": "The Journal of biological chemistry", "date": "1992", "authors": "Huang MM, Indik Z, Brass LF, Hoxie JA, Schreiber AD, Brugge JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029481", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029481" } ], "reference": [ { "type": "PubMed", "id": "1372004", "url": "https://glygen.org/publication/PubMed/1372004" } ] }, { "title": "Focal adhesion kinase regulation of N-WASP subcellular localization and function.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Wu X, Suetsugu S, Cooper LA, Takenawa T, Guan JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "14676198", "url": "https://glygen.org/publication/PubMed/14676198" } ] }, { "title": "Fcgamma RI-triggered generation of arachidonic acid and eicosanoids requires iPLA2 but not cPLA2 in human monocytic cells.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Tay HK, Melendez AJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029485", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029485" } ], "reference": [ { "type": "PubMed", "id": "15007079", "url": "https://glygen.org/publication/PubMed/15007079" } ] }, { "title": "Signalling to actin assembly via the WASP (Wiskott-Aldrich syndrome protein)-family proteins and the Arp2/3 complex.", "journal": "The Biochemical journal", "date": "2004", "authors": "Millard TH, Sharp SJ, Machesky LM", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "15040784", "url": "https://glygen.org/publication/PubMed/15040784" } ] }, { "title": "Mechanism of tyrosine phosphorylation and activation of phospholipase C-gamma 1. Tyrosine 783 phosphorylation is not sufficient for lipase activation.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Sekiya F, Poulin B, Kim YJ, Rhee SG", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029485", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029485" } ], "reference": [ { "type": "PubMed", "id": "15161916", "url": "https://glygen.org/publication/PubMed/15161916" } ] }, { "title": "Phospholipases D1 and D2 coordinately regulate macrophage phagocytosis.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2004", "authors": "Iyer SS, Barton JA, Bourgoin S, Kusner DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029485", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029485" } ], "reference": [ { "type": "PubMed", "id": "15294978", "url": "https://glygen.org/publication/PubMed/15294978" } ] }, { "title": "Regulation of WASP/WAVE proteins: making a long story short.", "journal": "The Journal of cell biology", "date": "2004", "authors": "Bompard G, Caron E", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "15452139", "url": "https://glygen.org/publication/PubMed/15452139" } ] }, { "title": "Molecular basis for a direct interaction between the Syk protein-tyrosine kinase and phosphoinositide 3-kinase.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Moon KD, Post CB, Durden DL, Zhou Q, De P, Harrison ML, Geahlen RL", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029485", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029485" } ], "reference": [ { "type": "PubMed", "id": "15536084", "url": "https://glygen.org/publication/PubMed/15536084" } ] }, { "title": "Abelson-interactor-1 promotes WAVE2 membrane translocation and Abelson-mediated tyrosine phosphorylation required for WAVE2 activation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2005", "authors": "Leng Y, Zhang J, Badour K, Arpaia E, Freeman S, Cheung P, Siu M, Siminovitch K", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "15657136", "url": "https://glygen.org/publication/PubMed/15657136" } ] }, { "title": "Phosphatidylinositol-4,5-bisphosphate hydrolysis directs actin remodeling during phagocytosis.", "journal": "The Journal of cell biology", "date": "2005", "authors": "Scott CC, Dobson W, Botelho RJ, Coady-Osberg N, Chavrier P, Knecht DA, Heath C, Stahl P, Grinstein S", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029485", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029485" } ], "reference": [ { "type": "PubMed", "id": "15809313", "url": "https://glygen.org/publication/PubMed/15809313" } ] }, { "title": "Control of infection with Leishmania major in susceptible BALB/c mice lacking the common gamma-chain for FcR is associated with reduced production of IL-10 and TGF-beta by parasitized cells.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2005", "authors": "Padigel UM, Farrell JP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9664323", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9664323" } ], "reference": [ { "type": "PubMed", "id": "15879134", "url": "https://glygen.org/publication/PubMed/15879134" } ] }, { "title": "Mechanism of filament nucleation and branch stability revealed by the structure of the Arp2/3 complex at actin branch junctions.", "journal": "PLoS biology", "date": "2005", "authors": "Egile C, Rouiller I, Xu XP, Volkmann N, Li R, Hanein D", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "16262445", "url": "https://glygen.org/publication/PubMed/16262445" } ] }, { "title": "Dynamics and function of phospholipase D and phosphatidic acid during phagocytosis.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2006", "authors": "Corrotte M, Chasserot-Golaz S, Huang P, Du G, Ktistakis NT, Frohman MA, Vitale N, Bader MF, Grant NJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029485", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029485" } ], "reference": [ { "type": "PubMed", "id": "16497229", "url": "https://glygen.org/publication/PubMed/16497229" } ] }, { "title": "Requirements for Vav guanine nucleotide exchange factors and Rho GTPases in FcgammaR- and complement-mediated phagocytosis.", "journal": "Immunity", "date": "2006", "authors": "Hall AB, Gakidis MA, Glogauer M, Wilsbacher JL, Gao S, Swat W, Brugge JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "16546099", "url": "https://glygen.org/publication/PubMed/16546099" } ] }, { "title": "Hsp90 increases LIM kinase activity by promoting its homo-dimerization.", "journal": "FASEB journal : official publication of the Federation of American Societies for Experimental Biology", "date": "2006", "authors": "Li R, Soosairajah J, Harari D, Citri A, Price J, Ng HL, Morton CJ, Parker MW, Yarden Y, Bernard O", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "16641196", "url": "https://glygen.org/publication/PubMed/16641196" } ] }, { "title": "PKD at the crossroads of DAG and PKC signaling.", "journal": "Trends in pharmacological sciences", "date": "2006", "authors": "Wang QJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029485", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029485" } ], "reference": [ { "type": "PubMed", "id": "16678913", "url": "https://glygen.org/publication/PubMed/16678913" } ] }, { "title": "Optimization of WAVE2 complex-induced actin polymerization by membrane-bound IRSp53, PIP(3), and Rac.", "journal": "The Journal of cell biology", "date": "2006", "authors": "Suetsugu S, Kurisu S, Oikawa T, Yamazaki D, Oda A, Takenawa T", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "16702231", "url": "https://glygen.org/publication/PubMed/16702231" } ] }, { "title": "Arp2/3 ATP hydrolysis: to branch or to debranch?", "journal": "Nature cell biology", "date": "2006", "authors": "Kovar DR", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "16880808", "url": "https://glygen.org/publication/PubMed/16880808" } ] }, { "title": "Differential kinase requirements in human and mouse Fc-gamma receptor phagocytosis and endocytosis.", "journal": "Journal of leukocyte biology", "date": "2006", "authors": "Huang ZY, Barreda DR, Worth RG, Indik ZK, Kim MK, Chien P, Schreiber AD", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029481", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029481" } ], "reference": [ { "type": "PubMed", "id": "16921024", "url": "https://glygen.org/publication/PubMed/16921024" } ] }, { "title": "Lim kinases, regulators of actin dynamics.", "journal": "The international journal of biochemistry & cell biology", "date": "2007", "authors": "Bernard O", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "17188549", "url": "https://glygen.org/publication/PubMed/17188549" } ] }, { "title": "Effect of WAVE2 phosphorylation on activation of the Arp2/3 complex.", "journal": "Journal of biochemistry", "date": "2007", "authors": "Nakanishi O, Suetsugu S, Yamazaki D, Takenawa T", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "17202194", "url": "https://glygen.org/publication/PubMed/17202194" } ] }, { "title": "Role of CrkII in Fcgamma receptor-mediated phagocytosis.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Lee WL, Cosio G, Ireton K, Grinstein S", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "17308335", "url": "https://glygen.org/publication/PubMed/17308335" } ] }, { "title": "Cloning and characterization of DPPL1 and DPPL2, representatives of a novel type of mammalian phosphatidate phosphatase.", "journal": "Gene", "date": "2007", "authors": "Takeuchi M, Harigai M, Momohara S, Ball E, Abe J, Furuichi K, Kamatani N", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029485", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029485" } ], "reference": [ { "type": "PubMed", "id": "17590538", "url": "https://glygen.org/publication/PubMed/17590538" } ] }, { "title": "FcgammaRIII mediates immunoglobulin G-induced interleukin-10 and is required for chronic Leishmania mexicana lesions.", "journal": "Infection and immunity", "date": "2008", "authors": "Thomas BN, Buxbaum LU", "evidence": [ { "database": "Reactome", "id": "R-HSA-9664323", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9664323" } ], "reference": [ { "type": "PubMed", "id": "18070890", "url": "https://glygen.org/publication/PubMed/18070890" } ] }, { "title": "Global survey of phosphotyrosine signaling identifies oncogenic kinases in lung cancer.", "journal": "Cell", "date": "2007", "authors": "Rikova K, Guo A, Zeng Q, Possemato A, Yu J, Haack H, Nardone J, Lee K, Reeves C, Li Y, Hu Y, Tan Z, Stokes M, Sullivan L, Mitchell J, Wetzel R, Macneill J, Ren JM, Yuan J, Bakalarski CE, Villen J, Kornhauser JM, Smith B, Li D, Zhou X, Gygi SP, Gu TL, Polakiewicz RD, Rush J, Comb MJ", "evidence": [ { "database": "iPTMnet", "id": "P12318", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P12318" } ], "reference": [ { "type": "PubMed", "id": "18083107", "url": "https://glygen.org/publication/PubMed/18083107" } ] }, { "title": "Regulation of actin assembly associated with protrusion and adhesion in cell migration.", "journal": "Physiological reviews", "date": "2008", "authors": "Le Clainche C, Carlier MF", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "18391171", "url": "https://glygen.org/publication/PubMed/18391171" } ] }, { "title": "Molecular mechanism of the Syk activation switch.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Tsang E, Giannetti AM, Shaw D, Dinh M, Tse JK, Gandhi S, Ho H, Wang S, Papp E, Bradshaw JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029481", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029481" } ], "reference": [ { "type": "PubMed", "id": "18818202", "url": "https://glygen.org/publication/PubMed/18818202" } ] }, { "title": "Structural recognition and functional activation of FcgammaR by innate pentraxins.", "journal": "Nature", "date": "2008-12-18", "authors": "Lu Jinghua, Marnell Lorraine L, Marjon Kristopher D, Mold Carolyn, Du Clos Terry W, Sun Peter D", "evidence": [ { "database": "UniProtKB", "id": "P12318", "url": "https://www.uniprot.org/uniprot/P12318" } ], "reference": [ { "type": "PubMed", "id": "19011614", "url": "https://glygen.org/publication/PubMed/19011614" } ] }, { "title": "Cdc42 regulates Fc gamma receptor-mediated phagocytosis through the activation and phosphorylation of Wiskott-Aldrich syndrome protein (WASP) and neural-WASP.", "journal": "Molecular biology of the cell", "date": "2009", "authors": "Park H, Cox D", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "19741094", "url": "https://glygen.org/publication/PubMed/19741094" } ] }, { "title": "A Cdc42 activation cycle coordinated by PI 3-kinase during Fc receptor-mediated phagocytosis.", "journal": "Molecular biology of the cell", "date": "2010", "authors": "Beemiller P, Zhang Y, Mohan S, Levinsohn E, Gaeta I, Hoppe AD, Swanson JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "19955216", "url": "https://glygen.org/publication/PubMed/19955216" } ] }, { "title": "Calcium-activated pathways and oxidative burst mediate zymosan-induced signaling and IL-10 production in human macrophages.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2010", "authors": "Kelly EK, Wang L, Ivashkiv LB", "evidence": [ { "database": "Reactome", "id": "R-HSA-9664323", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9664323" } ], "reference": [ { "type": "PubMed", "id": "20400701", "url": "https://glygen.org/publication/PubMed/20400701" } ] }, { "title": "IgG1 is pathogenic in Leishmania mexicana infection.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2010", "authors": "Chu N, Thomas BN, Patel SR, Buxbaum LU", "evidence": [ { "database": "Reactome", "id": "R-HSA-9664323", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9664323" } ], "reference": [ { "type": "PubMed", "id": "21037092", "url": "https://glygen.org/publication/PubMed/21037092" } ] }, { "title": "ERK-MAPK drives lamellipodia protrusion by activating the WAVE2 regulatory complex.", "journal": "Molecular cell", "date": "2011", "authors": "Mendoza MC, Er EE, Zhang W, Ballif BA, Elliott HL, Danuser G, Blenis J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "21419341", "url": "https://glygen.org/publication/PubMed/21419341" } ] }, { "title": "Proteome profiling of human neutrophil granule subsets, secretory vesicles, and cell membrane: correlation with transcriptome profiling of neutrophil precursors.", "journal": "Journal of leukocyte biology", "date": "2013", "authors": "Rorvig S, Ostergaard O, Heegaard NH, Borregaard N", "evidence": [ { "database": "Reactome", "id": "R-HSA-6798695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6798695" } ], "reference": [ { "type": "PubMed", "id": "23650620", "url": "https://glygen.org/publication/PubMed/23650620" } ] }, { "title": "Leishmania mexicana infection induces IgG to parasite surface glycoinositol phospholipids that can induce IL-10 in mice and humans.", "journal": "PLoS neglected tropical diseases", "date": "2013", "authors": "Buxbaum LU", "evidence": [ { "database": "Reactome", "id": "R-HSA-9664323", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9664323" } ], "reference": [ { "type": "PubMed", "id": "23675550", "url": "https://glygen.org/publication/PubMed/23675550" } ] }, { "title": "Human Fc gamma RIII (CD16). Isoforms with distinct allelic expression, extracellular domains, and membrane linkages on polymorphonuclear and natural killer cells.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1989", "authors": "Edberg JC, Redecha PB, Salmon JE, Kimberly RP", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029481", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029481" } ], "reference": [ { "type": "PubMed", "id": "2474607", "url": "https://glygen.org/publication/PubMed/2474607" } ] }, { "title": "Identification of multiple isoforms of the low-affinity human IgG Fc receptor.", "journal": "Immunogenetics", "date": "1989", "authors": "Seki T", "evidence": [ { "database": "UniProtKB", "id": "P12318", "url": "https://www.uniprot.org/uniprot/P12318" } ], "reference": [ { "type": "PubMed", "id": "2526077", "url": "https://glygen.org/publication/PubMed/2526077" } ] }, { "title": "Structure and expression of human IgG FcRII(CD32). Functional heterogeneity is encoded by the alternatively spliced products of multiple genes.", "journal": "The Journal of experimental medicine", "date": "1989", "authors": "Brooks DG, Qiu WQ, Luster AD, Ravetch JV", "evidence": [ { "database": "UniProtKB", "id": "P12318", "url": "https://www.uniprot.org/uniprot/P12318" }, { "database": "Reactome", "id": "R-HSA-2029481", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029481" } ], "reference": [ { "type": "PubMed", "id": "2529342", "url": "https://glygen.org/publication/PubMed/2529342" } ] }, { "title": "Fc gamma receptor glycosylation modulates the binding of IgG glycoforms: a requirement for stable antibody interactions.", "journal": "Journal of proteome research", "date": "2014-12-05", "authors": "Hayes Jerrard M, Frostell Asa, Cosgrave Eoin F J, Struwe Weston B, Potter Oscar, Davey Gavin P, Karlsson Robert, Anneren Cecilia, Rudd Pauline M", "evidence": [ { "database": "GlyConnect", "id": "2998", "url": "https://glyconnect.expasy.org/browser/proteins/2998" } ], "reference": [ { "type": "PubMed", "id": "25345863", "url": "https://glygen.org/publication/PubMed/25345863" } ] }, { "title": "IL-10 Production in Macrophages Is Regulated by a TLR-Driven CREB-Mediated Mechanism That Is Linked to Genes Involved in Cell Metabolism.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2015", "authors": "Sanin DE, Prendergast CT, Mountford AP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9664323", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9664323" } ], "reference": [ { "type": "PubMed", "id": "26116503", "url": "https://glygen.org/publication/PubMed/26116503" } ] }, { "title": "Isolation and expression of cDNA clones encoding a human receptor for IgG (Fc gamma RII).", "journal": "The Journal of experimental medicine", "date": "1987", "authors": "Stuart SG, Trounstine ML, Vaux DJ, Koch T, Martens CL, Mellman I, Moore KW", "evidence": [ { "database": "UniProtKB", "id": "P12318", "url": "https://www.uniprot.org/uniprot/P12318" } ], "reference": [ { "type": "PubMed", "id": "2824655", "url": "https://glygen.org/publication/PubMed/2824655" } ] }, { "title": "Molecular cloning of a human immunoglobulin G Fc receptor.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1988", "authors": "Hibbs ML, Bonadonna L, Scott BM, McKenzie IF, Hogarth PM", "evidence": [ { "database": "UniProtKB", "id": "P12318", "url": "https://www.uniprot.org/uniprot/P12318" } ], "reference": [ { "type": "PubMed", "id": "2965389", "url": "https://glygen.org/publication/PubMed/2965389" } ] }, { "title": "Isolation of cDNAs for two distinct human Fc receptors by ligand affinity cloning.", "journal": "The EMBO journal", "date": "1988", "authors": "Stengelin S, Stamenkovic I, Seed B", "evidence": [ { "database": "UniProtKB", "id": "P12318", "url": "https://www.uniprot.org/uniprot/P12318" } ], "reference": [ { "type": "PubMed", "id": "3402431", "url": "https://glygen.org/publication/PubMed/3402431" } ] }, { "title": "Cytoskeleton Dependent Mobility Dynamics of FcgammaRIIA Facilitates Platelet Haptotaxis and Capture of Opsonized Bacteria.", "journal": "Cells", "date": "2022", "authors": "Palankar R, Sachs L, Wesche J, Greinacher A", "evidence": [ { "database": "RefSeq", "id": "NP_001129691", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001129691" } ], "reference": [ { "type": "PubMed", "id": "35626650", "url": "https://glygen.org/publication/PubMed/35626650" } ] }, { "title": "Association between the functional FCGR3A F158V and FCGR2A R131H polymorphisms and responsiveness to biologics in rheumatoid arthritis patients: A meta-analysis.", "journal": "International journal of rheumatic diseases", "date": "2023-07", "authors": "Lee Young Ho, Song Gwan Gyu", "evidence": [ { "database": "RefSeq", "id": "NP_001129691", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001129691" } ], "reference": [ { "type": "PubMed", "id": "37114884", "url": "https://glygen.org/publication/PubMed/37114884" } ] }, { "title": "Association between functional FCGR3A F158V and FCGR2A R131H polymorphisms and responsiveness to rituximab in patients with autoimmune diseases: a meta-analysis.", "journal": "The pharmacogenomics journal", "date": "2023-11", "authors": "Lee Young Ho, Song Gwan Gyu", "evidence": [ { "database": "RefSeq", "id": "NP_001129691", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001129691" } ], "reference": [ { "type": "PubMed", "id": "37149714", "url": "https://glygen.org/publication/PubMed/37149714" } ] }, { "title": "Comparative Analysis of FCGR Gene Polymorphism in Pulmonary Sarcoidosis and Tuberculosis.", "journal": "Cells", "date": "2023-04-23", "authors": "Typiak Marlena, R\u0119kawiecki Bart\u0142omiej, R\u0119ba\u0142a Krzysztof, Dubaniewicz Anna", "evidence": [ { "database": "RefSeq", "id": "NP_001129691", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001129691" } ], "reference": [ { "type": "PubMed", "id": "37174624", "url": "https://glygen.org/publication/PubMed/37174624" } ] }, { "title": "Relationship Between Human FC\u03b3RIIA rs1801274 G Allele and Risk of Death Among Different SARS-CoV-2 Variants.", "journal": "Viral immunology", "date": "2023-12", "authors": "Moghaddam Nazanin, Goodarzi Mohammad Taghi, Moghaddam Sina, Sakhaee Fatemeh, Ahmadi Iraj, Anvari Enayat, Fateh Abolfazl", "evidence": [ { "database": "RefSeq", "id": "NP_001129691", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001129691" } ], "reference": [ { "type": "PubMed", "id": "38029355", "url": "https://glygen.org/publication/PubMed/38029355" } ] }, { "title": "Syk interacts with tyrosine-phosphorylated proteins in human platelets activated by collagen and cross-linking of the Fc gamma-IIA receptor.", "journal": "The Biochemical journal", "date": "1995-10-15", "authors": "Yanaga F, Poole A, Asselin J, Blake R, Schieven G L, Clark E A, Law C L, Watson S P", "evidence": [ { "database": "iPTMnet", "id": "P12318", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P12318" } ], "reference": [ { "type": "PubMed", "id": "7487883", "url": "https://glygen.org/publication/PubMed/7487883" } ] }, { "title": "Clustering of the high affinity Fc receptor for immunoglobulin G (Fc gamma RI) results in phosphorylation of its associated gamma-chain.", "journal": "The Journal of biological chemistry", "date": "1994", "authors": "Duchemin AM, Ernst LK, Anderson CL", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029481", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029481" } ], "reference": [ { "type": "PubMed", "id": "7512959", "url": "https://glygen.org/publication/PubMed/7512959" } ] }, { "title": "The high affinity Fc gamma receptor (CD64) induces phagocytosis in the absence of its cytoplasmic domain: the gamma subunit of Fc gamma RIIIA imparts phagocytic function to Fc gamma RI.", "journal": "Experimental hematology", "date": "1994", "authors": "Indik ZK, Hunter S, Huang MM, Pan XQ, Chien P, Kelly C, Levinson AI, Kimberly RP, Schreiber AD", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029481", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029481" } ], "reference": [ { "type": "PubMed", "id": "7516890", "url": "https://glygen.org/publication/PubMed/7516890" } ] }, { "title": "Tyrosine phosphorylation of phospholipase C-gamma 2 is involved in the activation of phosphoinositide hydrolysis by Fc receptors in human neutrophils.", "journal": "Biochemical and biophysical research communications", "date": "1994", "authors": "Dusi S, Donini M, Della Bianca V, Rossi F", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029485", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029485" } ], "reference": [ { "type": "PubMed", "id": "7517665", "url": "https://glygen.org/publication/PubMed/7517665" } ] }, { "title": "Substitutions and deletions in the cytoplasmic domain of the phagocytic receptor Fc gamma RIIA: effect on receptor tyrosine phosphorylation and phagocytosis.", "journal": "Blood", "date": "1994", "authors": "Mitchell MA, Huang MM, Chien P, Indik ZK, Pan XQ, Schreiber AD", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029481", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029481" } ], "reference": [ { "type": "PubMed", "id": "7521687", "url": "https://glygen.org/publication/PubMed/7521687" } ] }, { "title": "Protein-tyrosine kinase p72syk in Fc gamma RI receptor signaling.", "journal": "Blood", "date": "1994", "authors": "Durden DL, Liu YB", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029481", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029481" } ], "reference": [ { "type": "PubMed", "id": "7522622", "url": "https://glygen.org/publication/PubMed/7522622" } ] }, { "title": "Tyrosine phosphorylation and association of Syk with Fc gamma RII in monocytic THP-1 cells.", "journal": "The Biochemical journal", "date": "1995", "authors": "Ghazizadeh S, Bolen JB, Fleit HB", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029481", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029481" } ], "reference": [ { "type": "PubMed", "id": "7530449", "url": "https://glygen.org/publication/PubMed/7530449" } ] }, { "title": "Up-regulation of monocytic IL-10 by tumor necrosis factor-alpha and cAMP elevating drugs.", "journal": "International immunology", "date": "1995", "authors": "Platzer C, Meisel C, Vogt K, Platzer M, Volk HD", "evidence": [ { "database": "Reactome", "id": "R-HSA-9664323", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9664323" } ], "reference": [ { "type": "PubMed", "id": "7547677", "url": "https://glygen.org/publication/PubMed/7547677" } ] }, { "title": "Identification of signaling motifs within human Fc gamma RIIa and Fc gamma RIIb isoforms.", "journal": "Blood", "date": "1995", "authors": "Van den Herik-Oudijk IE, Capel PJ, van der Bruggen T, Van de Winkel JG", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029481", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029481" } ], "reference": [ { "type": "PubMed", "id": "7718892", "url": "https://glygen.org/publication/PubMed/7718892" } ] }, { "title": "Kiz-1, a protein with LIM zinc finger and kinase domains, is expressed mainly in neurons.", "journal": "Cell growth & differentiation : the molecular biology journal of the American Association for Cancer Research", "date": "1994", "authors": "Bernard O, Ganiatsas S, Kannourakis G, Dringen R", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "7848918", "url": "https://glygen.org/publication/PubMed/7848918" } ] }, { "title": "Physical and functional association of Src-related protein tyrosine kinases with Fc gamma RII in monocytic THP-1 cells.", "journal": "The Journal of biological chemistry", "date": "1994", "authors": "Ghazizadeh S, Bolen JB, Fleit HB", "evidence": [ { "database": "UniProtKB", "id": "P12318", "url": "https://www.uniprot.org/uniprot/P12318" } ], "reference": [ { "type": "PubMed", "id": "8132624", "url": "https://glygen.org/publication/PubMed/8132624" } ] }, { "title": "Cross-linking of Fc gamma receptor I (Fc gamma RI) and receptor II (Fc gamma RII) on monocytic cells activates a signal transduction pathway common to both Fc receptors that involves the stimulation of p72 Syk protein tyrosine kinase.", "journal": "The Journal of biological chemistry", "date": "1993", "authors": "Kiener PA, Rankin BM, Burkhardt AL, Schieven GL, Gilliland LK, Rowley RB, Bolen JB, Ledbetter JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029481", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029481" } ], "reference": [ { "type": "PubMed", "id": "8226994", "url": "https://glygen.org/publication/PubMed/8226994" } ] }, { "title": "Immunoglobulin G-mediated phagocytosis activates a calcium-independent, phosphatidylethanolamine-specific phospholipase.", "journal": "Journal of leukocyte biology", "date": "1993", "authors": "Lennartz MR, Lefkowith JB, Bromley FA, Brown EJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029485", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029485" } ], "reference": [ { "type": "PubMed", "id": "8228618", "url": "https://glygen.org/publication/PubMed/8228618" } ] }, { "title": "Association of the high-affinity receptor for IgG (Fc gamma RI) with the gamma subunit of the IgE receptor.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1993", "authors": "Ernst LK, Duchemin AM, Anderson CL", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029481", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029481" } ], "reference": [ { "type": "PubMed", "id": "8327478", "url": "https://glygen.org/publication/PubMed/8327478" } ] }, { "title": "Association of immunoglobulin G Fc receptor II with Src-like protein-tyrosine kinase Fgr in neutrophils.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1993", "authors": "Hamada F, Aoki M, Akiyama T, Toyoshima K", "evidence": [ { "database": "UniProtKB", "id": "P12318", "url": "https://www.uniprot.org/uniprot/P12318" } ], "reference": [ { "type": "PubMed", "id": "8327512", "url": "https://glygen.org/publication/PubMed/8327512" } ] }, { "title": "Involvement of p72syk, a protein-tyrosine kinase, in Fc gamma receptor signaling.", "journal": "The Journal of biological chemistry", "date": "1993", "authors": "Agarwal A, Salem P, Robbins KC", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029481", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029481" } ], "reference": [ { "type": "PubMed", "id": "8340414", "url": "https://glygen.org/publication/PubMed/8340414" } ] }, { "title": "The molecular dissection of Fc gamma receptor mediated phagocytosis.", "journal": "Blood", "date": "1995", "authors": "Indik ZK, Park JG, Hunter S, Schreiber AD", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029481", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029481" } ], "reference": [ { "type": "PubMed", "id": "8541526", "url": "https://glygen.org/publication/PubMed/8541526" } ] }, { "title": "FcR gamma-chain is essential for both surface expression and function of human Fc gamma RI (CD64) in vivo.", "journal": "Blood", "date": "1996", "authors": "van Vugt MJ, Heijnen IA, Capel PJ, Park SY, Ra C, Saito T, Verbeek JS, van de Winkel JG", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029481", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029481" } ], "reference": [ { "type": "PubMed", "id": "8611682", "url": "https://glygen.org/publication/PubMed/8611682" } ] }, { "title": "Fc gamma RIIA alleles are heritable risk factors for lupus nephritis in African Americans.", "journal": "The Journal of clinical investigation", "date": "1996", "authors": "Salmon JE, Millard S, Schachter LA, Arnett FC, Ginzler EM, Gourley MF, Ramsey-Goldman R, Peterson MG, Kimberly RP", "evidence": [ { "database": "UniProtKB", "id": "P12318", "url": "https://www.uniprot.org/uniprot/P12318" } ], "reference": [ { "type": "PubMed", "id": "8636449", "url": "https://glygen.org/publication/PubMed/8636449" } ] }, { "title": "Phospholipase C-gamma1 interacts with conserved phosphotyrosyl residues in the linker region of Syk and is a substrate for Syk.", "journal": "Molecular and cellular biology", "date": "1996", "authors": "Law CL, Chandran KA, Sidorenko SP, Clark EA", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029485", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029485" } ], "reference": [ { "type": "PubMed", "id": "8657103", "url": "https://glygen.org/publication/PubMed/8657103" } ] }, { "title": "Targeting of proteins to granule subsets is determined by timing and not by sorting: The specific granule protein NGAL is localized to azurophil granules when expressed in HL-60 cells.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1996", "authors": "Le Cabec V, Cowland JB, Calafat J, Borregaard N", "evidence": [ { "database": "Reactome", "id": "R-HSA-6798695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6798695" } ], "reference": [ { "type": "PubMed", "id": "8692836", "url": "https://glygen.org/publication/PubMed/8692836" } ] }, { "title": "In vivo and in vitro specificity of protein tyrosine kinases for immunoglobulin G receptor (FcgammaRII) phosphorylation.", "journal": "Molecular and cellular biology", "date": "1996", "authors": "Bewarder N, Weinrich V, Budde P, Hartmann D, Flaswinkel H, Reth M, Frey J", "evidence": [ { "database": "UniProtKB", "id": "P12318", "url": "https://www.uniprot.org/uniprot/P12318" }, { "database": "iPTMnet", "id": "P12318", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P12318" } ], "reference": [ { "type": "PubMed", "id": "8756631", "url": "https://glygen.org/publication/PubMed/8756631" } ] }, { "title": "Vav in natural killer cells is tyrosine phosphorylated upon cross-linking of Fc gamma RIIIA and is constitutively associated with a serine/threonine kinase.", "journal": "The Biochemical journal", "date": "1996", "authors": "Xu X, Chong AS", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "8809042", "url": "https://glygen.org/publication/PubMed/8809042" } ] }, { "title": "Abrogation of the Fc gamma receptor IIA-mediated phagocytic signal by stem-loop Syk antisense oligonucleotides.", "journal": "Molecular biology of the cell", "date": "1996", "authors": "Matsuda M, Park JG, Wang DC, Hunter S, Chien P, Schreiber AD", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029481", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029481" } ], "reference": [ { "type": "PubMed", "id": "8862523", "url": "https://glygen.org/publication/PubMed/8862523" } ] }, { "title": "Functional and physical interactions of Syk family kinases with the Vav proto-oncogene product.", "journal": "Immunity", "date": "1996", "authors": "Deckert M, Tartare-Deckert S, Couture C, Mustelin T, Altman A", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "8986718", "url": "https://glygen.org/publication/PubMed/8986718" } ] }, { "title": "Tyrosine phosphorylation and Fcgamma receptor-mediated phagocytosis.", "journal": "FEBS letters", "date": "1997", "authors": "Strzelecka A, Kwiatkowska K, Sobota A", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029481", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029481" } ], "reference": [ { "type": "PubMed", "id": "9000504", "url": "https://glygen.org/publication/PubMed/9000504" } ] }, { "title": "Identification of the major sites of autophosphorylation of the murine protein-tyrosine kinase Syk.", "journal": "Biochimica et biophysica acta", "date": "1997", "authors": "Furlong MT, Mahrenholz AM, Kim KH, Ashendel CL, Harrison ML, Geahlen RL", "evidence": [ { "database": "Reactome", "id": "R-HSA-9664323", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9664323" } ], "reference": [ { "type": "PubMed", "id": "9042338", "url": "https://glygen.org/publication/PubMed/9042338" } ] }, { "title": "syk kinase activation by a src kinase-initiated activation loop phosphorylation chain reaction.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1997", "authors": "El-Hillal O, Kurosaki T, Yamamura H, Kinet JP, Scharenberg AM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9664323", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9664323" } ], "reference": [ { "type": "PubMed", "id": "9050880", "url": "https://glygen.org/publication/PubMed/9050880" } ] }, { "title": "Mapping of the human IL10 gene and further characterization of the 5' flanking sequence.", "journal": "Immunogenetics", "date": "1997", "authors": "Eskdale J, Kube D, Tesch H, Gallagher G", "evidence": [ { "database": "Reactome", "id": "R-HSA-9664323", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9664323" } ], "reference": [ { "type": "PubMed", "id": "9162098", "url": "https://glygen.org/publication/PubMed/9162098" } ] }, { "title": "A critical role for Syk in signal transduction and phagocytosis mediated by Fcgamma receptors on macrophages.", "journal": "The Journal of experimental medicine", "date": "1997", "authors": "Crowley MT, Costello PS, Fitzer-Attas CJ, Turner M, Meng F, Lowell C, Tybulewicz VL, DeFranco AL", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029481", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029481" } ], "reference": [ { "type": "PubMed", "id": "9314552", "url": "https://glygen.org/publication/PubMed/9314552" } ] }, { "title": "The interaction of Arp2/3 complex with actin: nucleation, high affinity pointed end capping, and formation of branching networks of filaments.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1998", "authors": "Mullins RD, Heuser JA, Pollard TD", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "9600938", "url": "https://glygen.org/publication/PubMed/9600938" } ] }, { "title": "Structural requirements for PAK activation by Rac GTPases.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Knaus UG, Wang Y, Reilly AM, Warnock D, Jackson JH", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "9705280", "url": "https://glygen.org/publication/PubMed/9705280" } ] }, { "title": "Fc receptor-mediated phagocytosis requires CDC42 and Rac1.", "journal": "The EMBO journal", "date": "1998", "authors": "Massol P, Montcourrier P, Guillemot JC, Chavrier P", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "9799231", "url": "https://glygen.org/publication/PubMed/9799231" } ] }, { "title": "WAVE, a novel WASP-family protein involved in actin reorganization induced by Rac.", "journal": "The EMBO journal", "date": "1998", "authors": "Miki H, Suetsugu S, Takenawa T", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "9843499", "url": "https://glygen.org/publication/PubMed/9843499" } ] }, { "title": "Cbl-mediated negative regulation of the Syk tyrosine kinase. A critical role for Cbl phosphotyrosine-binding domain binding to Syk phosphotyrosine 323.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Lupher ML Jr, Rao N, Lill NL, Andoniou CE, Miyake S, Clark EA, Druker B, Band H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9664323", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9664323" } ], "reference": [ { "type": "PubMed", "id": "9857068", "url": "https://glygen.org/publication/PubMed/9857068" } ] }, { "title": "EVH1/WH1 domains of VASP and WASP proteins belong to a large family including Ran-binding domains of the RanBP1 family.", "journal": "FEBS letters", "date": "1998", "authors": "Callebaut I, Cossart P, Dehoux P", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "9883880", "url": "https://glygen.org/publication/PubMed/9883880" } ] }, { "title": "A contractile activity that closes phagosomes in macrophages.", "journal": "Journal of cell science", "date": "1999", "authors": "Swanson JA, Johnson MT, Beningo K, Post P, Mooseker M, Araki N", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "9885284", "url": "https://glygen.org/publication/PubMed/9885284" } ] }, { "title": "Fc gamma receptor-mediated activation of phospholipase D regulates macrophage phagocytosis of IgG-opsonized particles.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1999", "authors": "Kusner DJ, Hall CF, Jackson S", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029485", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029485" } ], "reference": [ { "type": "PubMed", "id": "9973503", "url": "https://glygen.org/publication/PubMed/9973503" } ] } ], "pathway": [ { "id": "hsa:2212", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:2212", "resource": "KEGG Pathway" }, { "id": "R-HSA-2029481", "name": "FCGR activation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029481", "resource": "Reactome", "description": "FCGR activation" }, { "id": "R-HSA-2029482", "name": "Regulation of actin dynamics for phagocytic cup formation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482", "resource": "Reactome", "description": "Regulation of actin dynamics for phagocytic cup formation" }, { "id": "R-HSA-2029485", "name": "Role of phospholipids in phagocytosis", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029485", "resource": "Reactome", "description": "Role of phospholipids in phagocytosis" }, { "id": "R-HSA-6798695", "name": "Neutrophil degranulation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6798695", "resource": "Reactome", "description": "Neutrophil degranulation" }, { "id": "R-HSA-9664323", "name": "FCGR3A-mediated IL10 synthesis", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9664323", "resource": "Reactome", "description": "FCGR3A-mediated IL10 synthesis" } ], "orthologs": [ { "uniprot_canonical_ac": "P08101-1", "protein_name": "Low affinity immunoglobulin gamma Fc region receptor II", "gene_name": "Fcgr2", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MESNWTVHVFSRTLCHMLLWTAVLNLAAGTHDLPKAVVKLEPPWIQVLKEDTVTLTCEGTHNPGNSSTQWFHNGRSIRSQVQASYTFKATVNDSGEYRCQMEQTRLSDPVDLGVISDWLLLQTPQLVFLEGETITLRCHSWRNKLLNRISFFHNEKSVRYHHYSSNFSIPKANHSHSGDYYCKGSLGRTLHQSKPVTITVQGPKSSRSLPVLTIVAAVTGIAVAAIVIILVSLVYLKKKQVPALPGNPDHREMGETLPEEVGEYRQPSGGSVPVSPGPPSGLEPTSSSPYNPPDLEEAAKTEAENTITYSLLKHPEALDEETEHDYQNHI", "length": 330 }, "evidence": [ { "id": "45933800", "url": "http://www.informatics.jax.org/homology/45933800", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "P08508-1", "protein_name": "Low affinity immunoglobulin gamma Fc region receptor III", "gene_name": "Fcgr3", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MFQNAHSGSQWLLPPLTILLLFAFADRQSAALPKAVVKLDPPWIQVLKEDMVTLMCEGTHNPGNSSTQWFHNGRSIRSQVQASYTFKATVNDSGEYRCQMEQTRLSDPVDLGVISDWLLLQTPQRVFLEGETITLRCHSWRNKLLNRISFFHNEKSVRYHHYKSNFSIPKANHSHSGDYYCKGSLGSTQHQSKPVTITVQDPATTSSISLVWYHTAFSLVMCLLFAVDTGLYFYVRRNLQTPREYWRKSLSIRKHQAPQDK", "length": 261 }, "evidence": [ { "id": "45933799", "url": "http://www.informatics.jax.org/homology/45933799", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "P27645-1", "protein_name": "Low affinity immunoglobulin gamma Fc region receptor III", "gene_name": "Fcgr3", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MTLETQMFQNAHSGSQWLLPPLTMLLLFAFADRQTANLPKAVVKRDPPWIQVLKEDTVTLTCEGTHNPGNSSTQWFHNQSSTWGQVQASYTFKATVNDSGEYRCRMAHTSLSDPVHLEVISDWLLLQTPQLVFEEGETITLRCHSWKNKQLTKVLLFQNGKPVRYYYQSSNFSIPKANHSHSGNYYCKAYLGRTMHVSKPVTITVQGSATASTSSLVWFHAAFCLVMCLLFAVDTGLYFCVRRNLQTSGEDWRKSLSVGKYKAPQDK", "length": 267 }, "evidence": [ { "id": "45933799", "url": "http://www.informatics.jax.org/homology/45933799", "database": "MGI" }, { "id": "P12318", "url": "https://omabrowser.org/oma/group/P12318/", "database": "OMA" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "P31994-1", "protein_name": "Low affinity immunoglobulin gamma Fc region receptor II-b", "gene_name": "FCGR2B", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MGILSFLPVLATESDWADCKSPQPWGHMLLWTAVLFLAPVAGTPAAPPKAVLKLEPQWINVLQEDSVTLTCRGTHSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIVLRCHSWKDKPLVKVTFFQNGKSKKFSRSDPNFSIPQANHSHSGDYHCTGNIGYTLYSSKPVTITVQAPSSSPMGIIVAVVTGIAVAAIVAAVVALIYCRKKRISALPGYPECREMGETLPEKPANPTNPDEADKVGAENTITYSLLMHPDALEEPDDQNRI", "length": 310 }, "evidence": [ { "id": "45933800", "url": "http://www.informatics.jax.org/homology/45933800", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "P31995-1", "protein_name": "Low affinity immunoglobulin gamma Fc region receptor II-c", "gene_name": "FCGR2C", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MGILSFLPVLATESDWADCKSPQPWGHMLLWTAVLFLAPVAGTPAAPPKAVLKLEPQWINVLQEDSVTLTCRGTHSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIVLRCHSWKDKPLVKVTFFQNGKSKKFSRSDPNFSIPQANHSHSGDYHCTGNIGYTLYSSKPVTITVQAPSSSPMGIIVAVVTGIAVAAIVAAVVALIYCRKKRISANSTDPVKAAQFEPPGRQMIAIRKRQPEETNNDYETADGGYMTLNPRAPTDDDKNIYLTLPPNDHVNSNN", "length": 323 }, "evidence": [ { "id": "45933800", "url": "http://www.informatics.jax.org/homology/45933800", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q63203-1", "protein_name": "Low affinity immunoglobulin gamma Fc region receptor II", "gene_name": "Fcgr2", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MDSNRTVVHVLSRTLYHMLLWTAVLNLVAESHAGLPKAVVKLEPPWIQVLKEDTVTLMCEGTHNTKNCSTQWFHNGSSIWHQAQANYTFKATVNDSGEYRCRMEETGISEPIHLGVISDWLLLQTSQLVFEEGETITLRCHSWKNKQLTKVLLFQNGKPVRYYHQSSNFSIPKANHSHSGNYYCKAYLGRTMHVSKPVTITVQEPKSSSSLPVLTIVAAVAGIAVAAIVIILVSLVYLKKKQVPDTPSGLEEAEKNEVENTITYSLLKHPEAPDEESDHDYQNHI", "length": 285 }, "evidence": [ { "id": "45933800", "url": "http://www.informatics.jax.org/homology/45933800", "database": "MGI" } ], "common_name": "Rat" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "transmembrane signaling receptor activity", "id": "GO:0004888", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004888", "evidence": [ { "database": "UniProtKB", "id": "P12318", "url": "https://www.uniprot.org/uniprot/P12318" } ], "pmid": "" }, { "name": "IgG binding", "id": "GO:0019864", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019864", "evidence": [ { "database": "UniProtKB", "id": "P12318", "url": "https://www.uniprot.org/uniprot/P12318" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 3, "go_terms": [ { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "P12318", "url": "https://www.uniprot.org/uniprot/P12318" } ], "pmid": "" }, { "name": "secretory granule membrane", "id": "GO:0030667", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030667", "evidence": [ { "database": "UniProtKB", "id": "P12318", "url": "https://www.uniprot.org/uniprot/P12318" } ], "pmid": "" }, { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "P12318", "url": "https://www.uniprot.org/uniprot/P12318" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 3, "go_terms": [ { "name": "cell surface receptor signaling pathway", "id": "GO:0007166", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007166", "evidence": [ { "database": "UniProtKB", "id": "P12318", "url": "https://www.uniprot.org/uniprot/P12318" } ], "pmid": "" }, { "name": "regulation of immune response", "id": "GO:0050776", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050776", "evidence": [ { "database": "UniProtKB", "id": "P12318", "url": "https://www.uniprot.org/uniprot/P12318" } ], "pmid": "" }, { "name": "immune system process", "id": "GO:0002376", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002376", "evidence": [ { "database": "UniProtKB", "id": "P12318", "url": "https://www.uniprot.org/uniprot/P12318" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 178, "end_pos": 180, "annotation": "n_glycosylation_sequon" }, { "start_pos": 249, "end_pos": 251, "annotation": "n_glycosylation_sequon" }, { "start_pos": 97, "end_pos": 99, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "Phosphorylated by SRC-type Tyr-kinases such as LYN, BLK, FYN, HCK and SYK.", "evidence": [ { "database": "UniProtKB", "id": "P12318", "url": "https://www.uniprot.org/uniprot/P12318" }, { "database": "PubMed", "id": "8132624", "url": "https://glygen.org/publication/PubMed/8132624" }, { "database": "PubMed", "id": "8756631", "url": "https://glygen.org/publication/PubMed/8756631" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [ 97, 178 ], "o_linked_sites": [], "snv_sites": [ 70, 97, 110, 164, 167, 171, 178, 274 ], "glycation_sites": [], "phosphorylation_sites": [ 281, 288, 304 ], "sequon_annotation_sites": [ { "start_pos": 178, "end_pos": 180 }, { "start_pos": 249, "end_pos": 251 }, { "start_pos": 97, "end_pos": 99 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 40 }, { "field": "total_sites", "count": 3 }, { "field": "n_linked_glycans", "count": 38 }, { "field": "n_linked_glycan_sites", "count": 3 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 2 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 38 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 38 }, { "field": "n_linked_glycan_sites", "count": 1 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 14 }, { "field": "total_sites", "count": 3 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 8 }, { "field": "total_sites", "count": 8 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 5 }, { "field": "total_sites", "count": 5 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 126 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }