{ "uniprot_canonical_ac": "P11387-1", "uniprot_ac": "P11387", "uniprot_id": "TOP1_HUMAN", "mass": { "chemical_mass": 90726.0, "monoisotopic_mass": 90726.0 }, "refseq": { "ac": "NP_003277", "name": "DNA topoisomerase 1", "summary": "This gene encodes a DNA topoisomerase, an enzyme that controls and alters the topologic states of DNA during transcription. This enzyme catalyzes the transient breaking and rejoining of a single strand of DNA which allows the strands to pass through one another, thus altering the topology of DNA. This gene is localized to chromosome 20 and has pseudogenes which reside on chromosomes 1 and 22. [provided by RefSeq, Jul 2008].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003277" }, "gene_names": [ { "name": "TOP1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P11387", "id": "P11387" }, { "name": "TOP1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003277", "id": "NP_003277" }, { "name": "TOPI", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003277", "id": "NP_003277" } ], "protein_names": [ { "name": "DNA topoisomerase 1", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P11387" }, { "name": "5.6.2.1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P11387" }, { "name": "DNA topoisomerase 1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003277", "id": "NP_003277" }, { "name": "DNA topoisomerase I", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P11387" }, { "name": "type I DNA topoisomerase; topoisomerase (DNA) I; Scl-70 antigen", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003277", "id": "NP_003277" } ], "function": [ { "annotation": "Coinhibition of topoisomerase 1 and BRD4-mediated pause release selectively kills pancreatic cancer via readthrough transcription.", "evidence": [ { "database": "RefSeq", "id": "NP_003277", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003277" }, { "database": "PubMed", "id": "37831776", "url": "https://glygen.org/publication/PubMed/37831776" } ] }, { "annotation": "Releases the supercoiling and torsional tension of DNA introduced during the DNA replication and transcription by transiently cleaving and rejoining one strand of the DNA duplex. Introduces a single-strand break via transesterification at a target site in duplex DNA. The scissile phosphodiester is attacked by the catalytic tyrosine of the enzyme, resulting in the formation of a DNA-(3'-phosphotyrosyl)-enzyme intermediate and the expulsion of a 5'-OH DNA strand. The free DNA strand then rotates around the intact phosphodiester bond on the opposing strand, thus removing DNA supercoils. Finally, in the religation step, the DNA 5'-OH attacks the covalent intermediate to expel the active-site tyrosine and restore the DNA phosphodiester backbone (By similarity). Regulates the alternative splicing of tissue factor (F3) pre-mRNA in endothelial cells. Involved in the circadian transcription of the core circadian clock component BMAL1 by altering the chromatin structure around the ROR response elements (ROREs) on the BMAL1 promoter.", "evidence": [ { "database": "UniProtKB", "id": "P11387", "url": "https://www.uniprot.org/uniprot/P11387#function" }, { "database": "PubMed", "id": "2833744", "url": "https://glygen.org/publication/PubMed/2833744" }, { "database": "PubMed", "id": "16033260", "url": "https://glygen.org/publication/PubMed/16033260" }, { "database": "PubMed", "id": "22904072", "url": "https://glygen.org/publication/PubMed/22904072" }, { "database": "UniProtKB", "id": "Q13472", "url": "https://www.uniprot.org/uniprot/Q13472#function" }, { "database": "PubMed", "id": "14594810", "url": "https://glygen.org/publication/PubMed/14594810" }, { "database": "PubMed", "id": "19168442", "url": "https://glygen.org/publication/PubMed/19168442" }, { "database": "UniProtKB", "id": "A0A7P0T852", "url": "https://www.uniprot.org/uniprot/A0A7P0T852#function" }, { "database": "UniProtKB", "id": "RU365101", "url": "https://www.uniprot.org/uniprot/RU365101#function" } ] }, { "annotation": "Signatures of TOP1 transcription-associated mutagenesis in cancer and germline. Erratum:[Nature. 2022 May;605(7910):E7. PMID: 35504971]", "evidence": [ { "database": "RefSeq", "id": "NP_003277", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003277" }, { "database": "PubMed", "id": "35140396", "url": "https://glygen.org/publication/PubMed/35140396" } ] }, { "annotation": "TDP1 and TOP1 as targets in anticancer treatment of NSCLC: Activity and protein level in normal and tumor tissue from 150 NSCLC patients correlated to clinical data.", "evidence": [ { "database": "RefSeq", "id": "NP_003277", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003277" }, { "database": "PubMed", "id": "34974222", "url": "https://glygen.org/publication/PubMed/34974222" } ] }, { "annotation": "This gene encodes a DNA topoisomerase, an enzyme that controls and alters the topologic states of DNA during transcription. This enzyme catalyzes the transient breaking and rejoining of a single strand of DNA which allows the strands to pass through one another, thus altering the topology of DNA. This gene is localized to chromosome 20 and has pseudogenes which reside on chromosomes 1 and 22. [provided by RefSeq, Jul 2008].", "evidence": [ { "database": "RefSeq", "id": "NP_003277", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003277" } ] }, { "annotation": "Topoisomerase 1 inhibits MYC promoter activity by inducing G-quadruplex formation.", "evidence": [ { "database": "RefSeq", "id": "NP_003277", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003277" }, { "database": "PubMed", "id": "35687110", "url": "https://glygen.org/publication/PubMed/35687110" } ] }, { "annotation": "Topoisomerase I (TOP1) dynamics: conformational transition from open to closed states. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_003277", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003277" }, { "database": "PubMed", "id": "35013228", "url": "https://glygen.org/publication/PubMed/35013228" } ] } ], "disease": [], "snv": [ { "evidence": [ { "id": "P11387", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P11387" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 152, "end_pos": 152, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "I", "sequence_mut": "N", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (IKT->NKT).", "chr_id": "20", "chr_pos": "41081188", "ref_nt": "T", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "I152", "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "P11387", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P11387" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 248, "end_pos": 248, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "K", "sequence_mut": "N", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (KLS->NLS).", "chr_id": "20", "chr_pos": "41097233", "ref_nt": "G", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "K248", "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "P11387", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P11387" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 431, "end_pos": 431, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "P", "sequence_mut": "T", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (NPS->NTS).", "chr_id": "20", "chr_pos": "41101336", "ref_nt": "C", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "P431", "disease": [ { "disease_id": "DOID:4159", "recommended_name": { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "skin cancer", "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells." }, "synonyms": [ { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "CA - skin cancer", "description": "" }, { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "malignant neoplasm of skin", "description": "" }, { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "melanoma and Non-melanoma skin cancer", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] } ], "mutagenesis": [ { "start_pos": 103, "end_pos": 103, "sequence_org": "K", "sequence_mut": "R", "comment": "Localizes in both nucleoplasm and nucleoli; when associated with R-117 or R-153. Almost complete loss of sumoylation, concentrates in nucleoli and no clearing from nucleoli on CPT treatment; when associated with R-117 and R-153.", "evidence": [ { "database": "UniProtKB", "id": "P11387", "url": "https://www.uniprot.org/uniprot/P11387" }, { "database": "PubMed", "id": "12149243", "url": "https://glygen.org/publication/PubMed/12149243" } ] }, { "start_pos": 117, "end_pos": 117, "sequence_org": "K", "sequence_mut": "R", "comment": "5-fold decrease in sumoylation. Localizes in both nucleoplasm and nucleoli; when associated with or without R-103 or R-153. Almost complete loss of sumoylation, concentrates in nucleoli and no clearing from nucleoli on CPT treatment; when associated with R-103 and R-153.", "evidence": [ { "database": "UniProtKB", "id": "P11387", "url": "https://www.uniprot.org/uniprot/P11387" }, { "database": "PubMed", "id": "12149243", "url": "https://glygen.org/publication/PubMed/12149243" } ] }, { "start_pos": 153, "end_pos": 153, "sequence_org": "K", "sequence_mut": "R", "comment": "Localizes in both nucleoplasm and nucleoli; when associated with R-103 or R-117. Almost complete loss of sumoylation, concentrates in nucleoli and no clearing from nucleoli on CPT treatment; when associated with R-103 and R-117.", "evidence": [ { "database": "UniProtKB", "id": "P11387", "url": "https://www.uniprot.org/uniprot/P11387" }, { "database": "PubMed", "id": "12149243", "url": "https://glygen.org/publication/PubMed/12149243" } ] }, { "start_pos": 532, "end_pos": 532, "sequence_org": "K", "sequence_mut": "A", "comment": "Almost abolishes enzyme activity.", "evidence": [ { "database": "UniProtKB", "id": "P11387", "url": "https://www.uniprot.org/uniprot/P11387" }, { "database": "PubMed", "id": "14594810", "url": "https://glygen.org/publication/PubMed/14594810" } ] }, { "start_pos": 532, "end_pos": 532, "sequence_org": "K", "sequence_mut": "R", "comment": "Strongly reduced enzyme activity.", "evidence": [ { "database": "UniProtKB", "id": "P11387", "url": "https://www.uniprot.org/uniprot/P11387" }, { "database": "PubMed", "id": "14594810", "url": "https://glygen.org/publication/PubMed/14594810" } ] }, { "start_pos": 723, "end_pos": 723, "sequence_org": "Y", "sequence_mut": "F", "comment": "No change in CPT-induced clearing from nuclei.", "evidence": [ { "database": "UniProtKB", "id": "P11387", "url": "https://www.uniprot.org/uniprot/P11387" }, { "database": "PubMed", "id": "12149243", "url": "https://glygen.org/publication/PubMed/12149243" } ] } ], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "92.33", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000198900", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000198900" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "94.65", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000198900", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000198900" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "86.31", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000198900", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000198900" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "88.58", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000198900", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000198900" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "92.18", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000198900", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000198900" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "94.76", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000198900", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000198900" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "80.84", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000198900", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000198900" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "90.61", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000198900", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000198900" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "92.6", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000198900", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000198900" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "90.97", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000198900", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000198900" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "92.61", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000198900", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000198900" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "89.16", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000198900", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000198900" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "91.24", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000198900", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000198900" } ] } ], "expression_disease": [ { "significant": "Yes", "trend": "up", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "P11387", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P11387" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "P11387", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P11387" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "P11387", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P11387" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "No", "trend": "down", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "P11387", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P11387" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "P11387", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P11387" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "P11387", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P11387" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "P11387", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P11387" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "P11387", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P11387" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "P11387", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P11387" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "P11387", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P11387" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "P11387", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P11387" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "P11387", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P11387" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P11387", "url": "https://www.uniprot.org/uniprot/P11387" } ], "common_name": "Human" } ], "gene": [ { "name": "TOP1", "url": "https://www.uniprot.org/uniprot/P11387", "locus": { "chromosome": "20", "start_pos": 41124487, "end_pos": 41028822, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000198900", "url": "https://www.ensembl.org/id/ENSG00000198900" } ] } } ], "crossref": [ { "id": "ENSG00000198900", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000198900", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "P11387", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P11387", "database": "BioMuta", "categories": [ "Variation" ] }, { "id": "5.6.2.1", "url": "https://www.brenda-enzymes.org/enzyme.php?ecno=5.6.2.1&UniProtAcc=P11387", "database": "BRENDA", "categories": [ "Enzyme and Pathway" ] }, { "id": "5.99.1.2", "url": "https://www.brenda-enzymes.org/enzyme.php?ecno=5.99.1.2&UniProtAcc=P11387", "database": "BRENDA", "categories": [ "Enzyme and Pathway" ] }, { "id": "cd00659", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00659", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd03488", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd03488", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "CHEMBL1781", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL1781", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "TOP1", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=TOP1", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "7150", "url": "https://www.ncbi.nlm.nih.gov/gene/7150", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "11986", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=11986", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "P11387", "url": "https://www.ebi.ac.uk/intact/interactors/id:P11387*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR001631", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001631", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR008336", "url": "https://www.ebi.ac.uk/interpro/entry/IPR008336", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR011010", "url": "https://www.ebi.ac.uk/interpro/entry/IPR011010", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013030", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013030", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013034", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013034", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013499", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013499", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013500", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013500", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR014711", "url": "https://www.ebi.ac.uk/interpro/entry/IPR014711", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR014727", "url": "https://www.ebi.ac.uk/interpro/entry/IPR014727", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR018521", "url": "https://www.ebi.ac.uk/interpro/entry/IPR018521", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR025834", "url": "https://www.ebi.ac.uk/interpro/entry/IPR025834", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036202", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036202", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR048045", "url": "https://www.ebi.ac.uk/interpro/entry/IPR048045", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:7150", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:7150", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "126420", "url": "http://www.omim.org/entry/126420", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_P11387", "url": "https://www.nextprot.org/entry/NX_P11387", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "P11387", "url": "https://oglcnac.org/atlas/detail/P11387", "database": "O-GlcNAc Atlas", "categories": [ "Glycoproteomics" ] }, { "id": "P11387", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P11387", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "GLRYQKW", "url": "https://omabrowser.org/oma/group/GLRYQKW/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "10940at2759", "url": "http://www.orthodb.org/?query=10940at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR10290", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10290", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR10290:SF5", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10290:SF5", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "1A31", "url": "https://www.rcsb.org/structure/1A31", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1A35", "url": "https://www.rcsb.org/structure/1A35", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1A36", "url": "https://www.rcsb.org/structure/1A36", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1EJ9", "url": "https://www.rcsb.org/structure/1EJ9", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1K4S", "url": "https://www.rcsb.org/structure/1K4S", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1K4T", "url": "https://www.rcsb.org/structure/1K4T", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1LPQ", "url": "https://www.rcsb.org/structure/1LPQ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1NH3", "url": "https://www.rcsb.org/structure/1NH3", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1R49", "url": "https://www.rcsb.org/structure/1R49", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1RR8", "url": "https://www.rcsb.org/structure/1RR8", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1RRJ", "url": "https://www.rcsb.org/structure/1RRJ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1SC7", "url": "https://www.rcsb.org/structure/1SC7", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1SEU", "url": "https://www.rcsb.org/structure/1SEU", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1T8I", "url": "https://www.rcsb.org/structure/1T8I", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1TL8", "url": "https://www.rcsb.org/structure/1TL8", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF01028", "url": "http://pfam.xfam.org/family/PF01028", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF02919", "url": "http://pfam.xfam.org/family/PF02919", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF14370", "url": "http://pfam.xfam.org/family/PF14370", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "P11387", "url": "https://pharos.nih.gov/targets/P11387", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_P11387", "url": "http://purl.obolibrary.org/obo/PR_P11387", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-4615885", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4615885", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_003277", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003277", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A7P0T852", "url": "https://www.uniprot.org/uniprot/A0A7P0T852", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7P0T852-1", "url": "https://www.uniprot.org/uniprot/A0A7P0T852-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7P0T9R7", "url": "https://www.uniprot.org/uniprot/A0A7P0T9R7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7P0T9R7-1", "url": "https://www.uniprot.org/uniprot/A0A7P0T9R7-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P11387", "url": "https://www.uniprot.org/uniprot/P11387", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P11387-1", "url": "https://www.uniprot.org/uniprot/P11387-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MSGDHLHNDSQIEADFRLNDSHKHKDKHKDREHRHKEHKKEKDREKSKHSNSEHKDSEKKHKEKEKTKHKDGSSEKHKDKHKDRDKEKRKEEKVRASGDAKIKKEKENGFSSPPQIKDEPEDDGYFVPPKEDIKPLKRPRDEDDADYKPKKIKTEDTKKEKKRKLEEEEDGKLKKPKNKDKDKKVPEPDNKKKKPKKEEEQKWKWWEEERYPEGIKWKFLEHKGPVFAPPYEPLPENVKFYYDGKVMKLSPKAEEVATFFAKMLDHEYTTKEIFRKNFFKDWRKEMTNEEKNIITNLSKCDFTQMSQYFKAQTEARKQMSKEEKLKIKEENEKLLKEYGFCIMDNHKERIANFKIEPPGLFRGRGNHPKMGMLKRRIMPEDIIINCSKDAKVPSPPPGHKWKEVRHDNKVTWLVSWTENIQGSIKYIMLNPSSRIKGEKDWQKYETARRLKKCVDKIRNQYREDWKSKEMKVRQRAVALYFIDKLALRAGNEKEEGETADTVGCCSLRVEHINLHPELDGQEYVVEFDFLGKDSIRYYNKVPVEKRVFKNLQLFMENKQPEDDLFDRLNTGILNKHLQDLMEGLTAKVFRTYNASITLQQQLKELTAPDENIPAKILSYNRANRAVAILCNHQRAPPKTFEKSMMNLQTKIDAKKEQLADARRDLKSAKADAKVMKDAKTKKVVESKKKAVQRLEEQLMKLEVQATDREENKQIALGTSKLNYLDPRITVAWCKKWGVPIEKIYNKTQREKFAWAIDMADEDYEF", "length": 765, "header": "sp|P11387-1|TOP1_HUMAN Isoform 1 of DNA topoisomerase 1 OS=Homo sapiens OX=9606 GN=TOP1 PE=1 SV=2 CANONICAL=P11387-1" }, "isoforms": [ { "isoform_ac": "A0A7P0T852-1", "url": "", "sequence": { "sequence": "MKVRQRAVALYFIDKLALRAGNEKEEGETADTVGCCSLRVEHINLHPELDGQEYVVEFDFLGKDSIRYYNKVPVEKRVFKNLQLFMENKQPEDDLFDRLNTGILNKHLQDLMEGLTAKVFRTYNASITLQQQLKELTAPDENIPAKILSYNRANRAVAILCNHQRAPPKTFEKSMMNLQTKIDAKKEQLADARRDLKSAKADAKVMKDAKTKKVVESKKKAVQRLEEQLMKLEVQATDREENKQIALGTSKLNYLDPRITVAWCKKWGVPIEKIYNKTQREKFAWAIDMADEDYEF", "length": 296, "header": "tr|A0A7P0T852-1|TOP1_HUMAN Computationally mapped isoform of DNA topoisomerase 1 OS=Homo sapiens OX=9606 GN=TOP1 PE=1 SV=1 CANONICAL=P11387-1" }, "locus": { "chromosome": "20", "start_pos": 41123294, "end_pos": 41112881, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000680945.1", "url": "https://www.ensembl.org/id/ENST00000680945.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000504935.1", "url": "https://www.ensembl.org/id/ENSP00000504935.1" } ] } }, { "isoform_ac": "A0A7P0T9R7-1", "url": "", "sequence": { "sequence": "MSGDHLHNDSQIEADFRLNDSHKHKDKHKDREHRHKEHKKEKDREKSKHSNSEHKDSEKKHKEKEKTKHKDGSSEKHKDKHKDRDKEKRKEEKVRASGDAKIKKEKENGFSSPPQIKDEPEDDGYFVPPKEDIKPLKRPRDEDDADYKPKKIKTEDTKKEKKRKLEEEEDGKLKKPKNKDKDKKVPEPDNKKKKPKKEEEQKWK", "length": 204, "header": "tr|A0A7P0T9R7-1|A0A7P0T9R7_HUMAN Computationally mapped isoform of DNA topoisomerase I OS=Homo sapiens OX=9606 GN=TOP1 PE=1 SV=1 CANONICAL=P11387-1" }, "locus": { "chromosome": "20", "start_pos": 41084568, "end_pos": 41029068, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000681113.1", "url": "https://www.ensembl.org/id/ENST00000681113.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000505788.1", "url": "https://www.ensembl.org/id/ENSP00000505788.1" } ] } }, { "isoform_ac": "P11387-1", "url": "", "sequence": { "sequence": "MSGDHLHNDSQIEADFRLNDSHKHKDKHKDREHRHKEHKKEKDREKSKHSNSEHKDSEKKHKEKEKTKHKDGSSEKHKDKHKDRDKEKRKEEKVRASGDAKIKKEKENGFSSPPQIKDEPEDDGYFVPPKEDIKPLKRPRDEDDADYKPKKIKTEDTKKEKKRKLEEEEDGKLKKPKNKDKDKKVPEPDNKKKKPKKEEEQKWKWWEEERYPEGIKWKFLEHKGPVFAPPYEPLPENVKFYYDGKVMKLSPKAEEVATFFAKMLDHEYTTKEIFRKNFFKDWRKEMTNEEKNIITNLSKCDFTQMSQYFKAQTEARKQMSKEEKLKIKEENEKLLKEYGFCIMDNHKERIANFKIEPPGLFRGRGNHPKMGMLKRRIMPEDIIINCSKDAKVPSPPPGHKWKEVRHDNKVTWLVSWTENIQGSIKYIMLNPSSRIKGEKDWQKYETARRLKKCVDKIRNQYREDWKSKEMKVRQRAVALYFIDKLALRAGNEKEEGETADTVGCCSLRVEHINLHPELDGQEYVVEFDFLGKDSIRYYNKVPVEKRVFKNLQLFMENKQPEDDLFDRLNTGILNKHLQDLMEGLTAKVFRTYNASITLQQQLKELTAPDENIPAKILSYNRANRAVAILCNHQRAPPKTFEKSMMNLQTKIDAKKEQLADARRDLKSAKADAKVMKDAKTKKVVESKKKAVQRLEEQLMKLEVQATDREENKQIALGTSKLNYLDPRITVAWCKKWGVPIEKIYNKTQREKFAWAIDMADEDYEF", "length": 765, "header": "sp|P11387-1|TOP1_HUMAN Isoform 1 of DNA topoisomerase 1 OS=Homo sapiens OX=9606 GN=TOP1 PE=1 SV=2 CANONICAL=P11387-1" }, "locus": { "chromosome": "20", "start_pos": 41123294, "end_pos": 41029068, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000361337.3", "url": "https://www.ensembl.org/id/ENST00000361337.3" }, { "database": "Ensembl Peptide", "id": "ENSP00000354522.2", "url": "https://www.ensembl.org/id/ENSP00000354522.2" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 643, "start_aa": "Ser", "end_pos": 643, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser643", "evidence": [ { "id": "P11387", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P11387" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "34725712", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725712" }, { "id": "32522876", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32522876" }, { "id": "37217939", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37217939" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "28510447", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28510447" }, { "id": "33465208", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33465208" }, { "id": "P11387", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P11387" } ] } ], "phosphorylation": [ { "start_pos": 10, "end_pos": 10, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P11387", "url": "https://www.uniprot.org/uniprot/P11387" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "PubMed", "id": "21406692", "url": "https://glygen.org/publication/PubMed/21406692" }, { "database": "iPTMnet", "id": "P11387", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11387" }, { "database": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" }, { "database": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" }, { "database": "phospho.ELM", "id": "P11387", "url": "http://phospho.elm.eu.org/byAccession/P11387.html" } ], "site_lbl": "Ser10" }, { "start_pos": 111, "end_pos": 111, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P11387", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11387" }, { "database": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Ser111" }, { "start_pos": 112, "end_pos": 112, "kinase_uniprot_canonical_ac": "P06493-1", "kinase_gene_name": "CDK1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P11387", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11387" }, { "database": "PubMed", "id": "18408216", "url": "https://glygen.org/publication/PubMed/18408216" } ], "site_lbl": "Ser112" }, { "start_pos": 112, "end_pos": 112, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P11387", "url": "https://www.uniprot.org/uniprot/P11387" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "iPTMnet", "id": "P11387", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11387" }, { "database": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "19413330", "url": "https://glygen.org/publication/PubMed/19413330" }, { "database": "phospho.ELM", "id": "P11387", "url": "http://phospho.elm.eu.org/byAccession/P11387.html" } ], "site_lbl": "Ser112" }, { "start_pos": 125, "end_pos": 125, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P11387", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11387" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Tyr125" }, { "start_pos": 21, "end_pos": 21, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P11387", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11387" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Ser21" }, { "start_pos": 268, "end_pos": 268, "kinase_uniprot_canonical_ac": "P00519-1", "kinase_gene_name": "ABL1", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P11387", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11387" }, { "database": "PubMed", "id": "15448168", "url": "https://glygen.org/publication/PubMed/15448168" } ], "site_lbl": "Tyr268" }, { "start_pos": 268, "end_pos": 268, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "phospho.ELM", "id": "P11387", "url": "http://phospho.elm.eu.org/byAccession/P11387.html" }, { "database": "iPTMnet", "id": "P11387", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11387" }, { "database": "PubMed", "id": "15448168", "url": "https://glygen.org/publication/PubMed/15448168" } ], "site_lbl": "Tyr268" }, { "start_pos": 298, "end_pos": 298, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P11387", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11387" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Ser298" }, { "start_pos": 2, "end_pos": 2, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P11387", "url": "https://www.uniprot.org/uniprot/P11387" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "iPTMnet", "id": "P11387", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11387" }, { "database": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" }, { "database": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Ser2" }, { "start_pos": 394, "end_pos": 394, "kinase_uniprot_canonical_ac": "P06493-1", "kinase_gene_name": "CDK1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P11387", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11387" }, { "database": "PubMed", "id": "18408216", "url": "https://glygen.org/publication/PubMed/18408216" } ], "site_lbl": "Ser394" }, { "start_pos": 426, "end_pos": 426, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P11387", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11387" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Tyr426" }, { "start_pos": 432, "end_pos": 432, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P11387", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11387" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Ser432" }, { "start_pos": 506, "end_pos": 506, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by CK2", "evidence": [ { "database": "UniProtKB", "id": "P11387", "url": "https://www.uniprot.org/uniprot/P11387" }, { "database": "iPTMnet", "id": "P11387", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11387" }, { "database": "PubMed", "id": "23185622", "url": "https://glygen.org/publication/PubMed/23185622" } ], "site_lbl": "Ser506" }, { "start_pos": 57, "end_pos": 57, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P11387", "url": "https://www.uniprot.org/uniprot/P11387" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "iPTMnet", "id": "P11387", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11387" } ], "site_lbl": "Ser57" }, { "start_pos": 667, "end_pos": 667, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P11387", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11387" }, { "database": "PubMed", "id": "35494241", "url": "" } ], "site_lbl": "Ser667" }, { "start_pos": 73, "end_pos": 73, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P11387", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11387" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Ser73" } ], "glycation": [], "keywords": [ "enzyme", "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "The t(11;20)(p15;q11) chromosomal translocation associated with therapy-related myelodysplastic syndrome results in an NUP98-TOP1 fusion.", "journal": "Blood", "date": "1999", "authors": "Ahuja H G, Felix C A, Aplan P D", "evidence": [ { "database": "UniProtKB", "id": "P11387", "url": "https://www.uniprot.org/uniprot/P11387" } ], "reference": [ { "type": "PubMed", "id": "10556215", "url": "https://glygen.org/publication/PubMed/10556215" } ] }, { "title": "SUMO-1 conjugation to topoisomerase I: A possible repair response to topoisomerase-mediated DNA damage.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2000", "authors": "Mao Y, Sun M, Desai SD, Liu LF", "evidence": [ { "database": "Reactome", "id": "R-HSA-4615885", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4615885" } ], "reference": [ { "type": "PubMed", "id": "10759568", "url": "https://glygen.org/publication/PubMed/10759568" } ] }, { "title": "Novel insights into catalytic mechanism from a crystal structure of human topoisomerase I in complex with DNA.", "journal": "Biochemistry", "date": "2000", "authors": "Redinbo MR, Champoux JJ, Hol WG", "evidence": [ { "database": "UniProtKB", "id": "P11387", "url": "https://www.uniprot.org/uniprot/P11387" } ], "reference": [ { "type": "PubMed", "id": "10841763", "url": "https://glygen.org/publication/PubMed/10841763" } ] }, { "title": "SUMO-1 conjugation to human DNA topoisomerase II isozymes.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Mao Y, Desai SD, Liu LF", "evidence": [ { "database": "Reactome", "id": "R-HSA-4615885", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4615885" } ], "reference": [ { "type": "PubMed", "id": "10862613", "url": "https://glygen.org/publication/PubMed/10862613" } ] }, { "title": "Nucleolar delocalization of human topoisomerase I in response to topotecan correlates with sumoylation of the protein.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Mo YY, Yu Y, Shen Z, Beck WT", "evidence": [ { "database": "Reactome", "id": "R-HSA-4615885", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4615885" } ], "reference": [ { "type": "PubMed", "id": "11709553", "url": "https://glygen.org/publication/PubMed/11709553" } ] }, { "title": "Sumoylation of topoisomerase I is involved in its partitioning between nucleoli and nucleoplasm and its clearing from nucleoli in response to camptothecin.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Rallabhandi P, Hashimoto K, Mo YY, Beck WT, Moitra PK, D'Arpa P", "evidence": [ { "database": "UniProtKB", "id": "P11387", "url": "https://www.uniprot.org/uniprot/P11387" }, { "database": "Reactome", "id": "R-HSA-4615885", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4615885" } ], "reference": [ { "type": "PubMed", "id": "12149243", "url": "https://glygen.org/publication/PubMed/12149243" } ] }, { "title": "8-Oxoguanine rearranges the active site of human topoisomerase I.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "2002", "authors": "Lesher Diem-Thu Thieu, Pommier Yves, Stewart Lance, Redinbo Matthew R", "evidence": [ { "database": "UniProtKB", "id": "P11387", "url": "https://www.uniprot.org/uniprot/P11387" } ], "reference": [ { "type": "PubMed", "id": "12209008", "url": "https://glygen.org/publication/PubMed/12209008" } ] }, { "title": "The mechanism of topoisomerase I poisoning by a camptothecin analog.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2002", "authors": "Staker BL, Hjerrild K, Feese MD, Behnke CA, Burgin AB Jr, Stewart L", "evidence": [ { "database": "UniProtKB", "id": "P11387", "url": "https://www.uniprot.org/uniprot/P11387" } ], "reference": [ { "type": "PubMed", "id": "12426403", "url": "https://glygen.org/publication/PubMed/12426403" } ] }, { "title": "Structural impact of the leukemia drug 1-beta-D-arabinofuranosylcytosine (Ara-C) on the covalent human topoisomerase I-DNA complex.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Chrencik JE, Burgin AB, Pommier Y, Stewart L, Redinbo MR", "evidence": [ { "database": "UniProtKB", "id": "P11387", "url": "https://www.uniprot.org/uniprot/P11387" } ], "reference": [ { "type": "PubMed", "id": "12533542", "url": "https://glygen.org/publication/PubMed/12533542" } ] }, { "title": "The SUMO pathway is required for selective degradation of DNA topoisomerase IIbeta induced by a catalytic inhibitor ICRF-193(1).", "journal": "FEBS letters", "date": "2003", "authors": "Isik S, Sano K, Tsutsui K, Seki M, Enomoto T, Saitoh H, Tsutsui K", "evidence": [ { "database": "Reactome", "id": "R-HSA-4615885", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4615885" } ], "reference": [ { "type": "PubMed", "id": "12832072", "url": "https://glygen.org/publication/PubMed/12832072" } ] }, { "title": "Detection of topoisomerase I gene point mutation in CPT-11 resistant lung cancer cell line.", "journal": "Biochemical and biophysical research communications", "date": "1992", "authors": "Kubota N, Kanzawa F, Nishio K, Takeda Y, Ohmori T, Fujiwara Y, Terashima Y, Saijo N", "evidence": [ { "database": "UniProtKB", "id": "P11387", "url": "https://www.uniprot.org/uniprot/P11387" } ], "reference": [ { "type": "PubMed", "id": "1332703", "url": "https://glygen.org/publication/PubMed/1332703" } ] }, { "title": "The role of lysine 532 in the catalytic mechanism of human topoisomerase I.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Interthal H, Quigley PM, Hol WG, Champoux JJ", "evidence": [ { "database": "UniProtKB", "id": "P11387", "url": "https://www.uniprot.org/uniprot/P11387" } ], "reference": [ { "type": "PubMed", "id": "14594810", "url": "https://glygen.org/publication/PubMed/14594810" } ] }, { "title": "Mechanisms of camptothecin resistance by human topoisomerase I mutations.", "journal": "Journal of molecular biology", "date": "2004", "authors": "Chrencik JE, Staker BL, Burgin AB, Pourquier P, Pommier Y, Stewart L, Redinbo MR", "evidence": [ { "database": "UniProtKB", "id": "P11387", "url": "https://www.uniprot.org/uniprot/P11387" } ], "reference": [ { "type": "PubMed", "id": "15165849", "url": "https://glygen.org/publication/PubMed/15165849" } ] }, { "title": "Phosphorylation of DNA topoisomerase I by the c-Abl tyrosine kinase confers camptothecin sensitivity.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Yu D, Khan E, Khaleque MA, Lee J, Laco G, Kohlhagen G, Kharbanda S, Cheng YC, Pommier Y, Bharti A", "evidence": [ { "database": "iPTMnet", "id": "P11387", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11387" } ], "reference": [ { "type": "PubMed", "id": "15448168", "url": "https://glygen.org/publication/PubMed/15448168" } ] }, { "title": "Structures of three classes of anticancer agents bound to the human topoisomerase I-DNA covalent complex.", "journal": "Journal of medicinal chemistry", "date": "2005", "authors": "Staker BL, Feese MD, Cushman M, Pommier Y, Zembower D, Stewart L, Burgin AB", "evidence": [ { "database": "UniProtKB", "id": "P11387", "url": "https://www.uniprot.org/uniprot/P11387" } ], "reference": [ { "type": "PubMed", "id": "15801827", "url": "https://glygen.org/publication/PubMed/15801827" } ] }, { "title": "SUMO-modified PCNA recruits Srs2 to prevent recombination during S phase.", "journal": "Nature", "date": "2005", "authors": "Pfander B, Moldovan GL, Sacher M, Hoege C, Jentsch S", "evidence": [ { "database": "Reactome", "id": "R-HSA-4615885", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4615885" } ], "reference": [ { "type": "PubMed", "id": "15931174", "url": "https://glygen.org/publication/PubMed/15931174" } ] }, { "title": "Crosstalk between SUMO and ubiquitin on PCNA is mediated by recruitment of the helicase Srs2p.", "journal": "Molecular cell", "date": "2005", "authors": "Papouli E, Chen S, Davies AA, Huttner D, Krejci L, Sung P, Ulrich HD", "evidence": [ { "database": "Reactome", "id": "R-HSA-4615885", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4615885" } ], "reference": [ { "type": "PubMed", "id": "15989970", "url": "https://glygen.org/publication/PubMed/15989970" } ] }, { "title": "Synthesis and mechanism of action studies of a series of norindenoisoquinoline topoisomerase I poisons reveal an inhibitor with a flipped orientation in the ternary DNA-enzyme-inhibitor complex as determined by X-ray crystallographic analysis.", "journal": "Journal of medicinal chemistry", "date": "2005", "authors": "Ioanoviciu A, Antony S, Pommier Y, Staker BL, Stewart L, Cushman M", "evidence": [ { "database": "UniProtKB", "id": "P11387", "url": "https://www.uniprot.org/uniprot/P11387" } ], "reference": [ { "type": "PubMed", "id": "16033260", "url": "https://glygen.org/publication/PubMed/16033260" } ] }, { "title": "The consensus coding sequences of human breast and colorectal cancers.", "journal": "Science (New York, N.Y.)", "date": "2006", "authors": "Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE", "evidence": [ { "database": "UniProtKB", "id": "P11387", "url": "https://www.uniprot.org/uniprot/P11387" } ], "reference": [ { "type": "PubMed", "id": "16959974", "url": "https://glygen.org/publication/PubMed/16959974" } ] }, { "title": "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.", "journal": "Cell", "date": "2006", "authors": "Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M", "evidence": [ { "database": "UniProtKB", "id": "P11387", "url": "https://www.uniprot.org/uniprot/P11387" }, { "database": "iPTMnet", "id": "P11387", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11387" } ], "reference": [ { "type": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" } ] }, { "title": "PIASgamma is required for faithful chromosome segregation in human cells.", "journal": "PloS one", "date": "2006", "authors": "Diaz-Martinez LA, Gimenez-Abian JF, Azuma Y, Guacci V, Gimenez-Martin G, Lanier LM, Clarke DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-4615885", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4615885" } ], "reference": [ { "type": "PubMed", "id": "17183683", "url": "https://glygen.org/publication/PubMed/17183683" } ] }, { "title": "Simian virus 40 DNA replication is dependent on an interaction between topoisomerase I and the C-terminal end of T antigen.", "journal": "J. Virol.", "date": "2008", "authors": "Khopde Sujata, Simmons Daniel T", "evidence": [ { "database": "UniProtKB", "id": "P11387", "url": "https://www.uniprot.org/uniprot/P11387" } ], "reference": [ { "type": "PubMed", "id": "18003733", "url": "https://glygen.org/publication/PubMed/18003733" } ] }, { "title": "Conjugation of human topoisomerase 2 alpha with small ubiquitin-like modifiers 2/3 in response to topoisomerase inhibitors: cell cycle stage and chromosome domain specificity.", "journal": "Cancer research", "date": "2008", "authors": "Agostinho M, Santos V, Ferreira F, Costa R, Cardoso J, Pinheiro I, Rino J, Jaffray E, Hay RT, Ferreira J", "evidence": [ { "database": "Reactome", "id": "R-HSA-4615885", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4615885" } ], "reference": [ { "type": "PubMed", "id": "18381449", "url": "https://glygen.org/publication/PubMed/18381449" } ] }, { "title": "Resolution of sister centromeres requires RanBP2-mediated SUMOylation of topoisomerase IIalpha.", "journal": "Cell", "date": "2008", "authors": "Dawlaty MM, Malureanu L, Jeganathan KB, Kao E, Sustmann C, Tahk S, Shuai K, Grosschedl R, van Deursen JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-4615885", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4615885" } ], "reference": [ { "type": "PubMed", "id": "18394993", "url": "https://glygen.org/publication/PubMed/18394993" } ] }, { "title": "Mitotic phosphorylation stimulates DNA relaxation activity of human topoisomerase I.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Hackbarth JS, Galvez-Peralta M, Dai NT, Loegering DA, Peterson KL, Meng XW, Karnitz LM, Kaufmann SH", "evidence": [ { "database": "iPTMnet", "id": "P11387", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11387" } ], "reference": [ { "type": "PubMed", "id": "18408216", "url": "https://glygen.org/publication/PubMed/18408216" } ] }, { "title": "Motif-specific sampling of phosphoproteomes.", "journal": "Journal of proteome research", "date": "2008", "authors": "Ruse CI, McClatchy DB, Lu B, Cociorva D, Motoyama A, Park SK, Yates JR 3rd", "evidence": [ { "database": "iPTMnet", "id": "P11387", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11387" } ], "reference": [ { "type": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" } ] }, { "title": "Molecular cloning of a cDNA of a camptothecin-resistant human DNA topoisomerase I and identification of mutation sites.", "journal": "Nucleic acids research", "date": "1991", "authors": "Tamura H, Kohchi C, Yamada R, Ikeda T, Koiwai O, Patterson E, Keene JD, Okada K, Kjeldsen E, Nishikawa K, et al.", "evidence": [ { "database": "UniProtKB", "id": "P11387", "url": "https://www.uniprot.org/uniprot/P11387" } ], "reference": [ { "type": "PubMed", "id": "1849260", "url": "https://glygen.org/publication/PubMed/1849260" } ] }, { "title": "Structure of the human type I DNA topoisomerase gene.", "journal": "J. Biol. Chem.", "date": "1991", "authors": "Kunze N, Yang G C, D\u00f6lberg M, Sundarp R, Knippers R, Richter A", "evidence": [ { "database": "UniProtKB", "id": "P11387", "url": "https://www.uniprot.org/uniprot/P11387" } ], "reference": [ { "type": "PubMed", "id": "1851751", "url": "https://glygen.org/publication/PubMed/1851751" } ] }, { "title": "A quantitative atlas of mitotic phosphorylation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2008", "authors": "Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP", "evidence": [ { "database": "iPTMnet", "id": "P11387", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11387" } ], "reference": [ { "type": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" } ] }, { "title": "RanBP2 and SENP3 function in a mitotic SUMO2/3 conjugation-deconjugation cycle on Borealin.", "journal": "Molecular biology of the cell", "date": "2009", "authors": "Klein UR, Haindl M, Nigg EA, Muller S", "evidence": [ { "database": "Reactome", "id": "R-HSA-4615885", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4615885" } ], "reference": [ { "type": "PubMed", "id": "18946085", "url": "https://glygen.org/publication/PubMed/18946085" } ] }, { "title": "Cdc2-like kinases and DNA topoisomerase I regulate alternative splicing of tissue factor in human endothelial cells.", "journal": "Circulation research", "date": "2009", "authors": "Eisenreich A, Bogdanov VY, Zakrzewicz A, Pries A, Antoniak S, Poller W, Schultheiss HP, Rauch U", "evidence": [ { "database": "UniProtKB", "id": "P11387", "url": "https://www.uniprot.org/uniprot/P11387" } ], "reference": [ { "type": "PubMed", "id": "19168442", "url": "https://glygen.org/publication/PubMed/19168442" } ] }, { "title": "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.", "journal": "Analytical chemistry", "date": "2009", "authors": "Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S", "evidence": [ { "database": "iPTMnet", "id": "P11387", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11387" } ], "reference": [ { "type": "PubMed", "id": "19413330", "url": "https://glygen.org/publication/PubMed/19413330" } ] }, { "title": "Proteomics analysis of nucleolar SUMO-1 target proteins upon proteasome inhibition.", "journal": "Molecular & cellular proteomics : MCP", "date": "2009", "authors": "Matafora V, D'Amato A, Mori S, Blasi F, Bachi A", "evidence": [ { "database": "Reactome", "id": "R-HSA-4615885", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4615885" } ], "reference": [ { "type": "PubMed", "id": "19596686", "url": "https://glygen.org/publication/PubMed/19596686" } ] }, { "title": "Lysine acetylation targets protein complexes and co-regulates major cellular functions.", "journal": "Science (New York, N.Y.)", "date": "2009", "authors": "Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M", "evidence": [ { "database": "UniProtKB", "id": "P11387", "url": "https://www.uniprot.org/uniprot/P11387" } ], "reference": [ { "type": "PubMed", "id": "19608861", "url": "https://glygen.org/publication/PubMed/19608861" } ] }, { "title": "Global effects of kinase inhibitors on signaling networks revealed by quantitative phosphoproteomics.", "journal": "Molecular & cellular proteomics : MCP", "date": "2009", "authors": "Pan C, Olsen JV, Daub H, Mann M", "evidence": [ { "database": "iPTMnet", "id": "P11387", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11387" } ], "reference": [ { "type": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" } ] }, { "title": "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.", "journal": "Science signaling", "date": "2010", "authors": "Olsen JV, Vermeulen M, Santamaria A, Kumar C, Miller ML, Jensen LJ, Gnad F, Cox J, Jensen TS, Nigg EA, Brunak S, Mann M", "evidence": [ { "database": "UniProtKB", "id": "P11387", "url": "https://www.uniprot.org/uniprot/P11387" }, { "database": "iPTMnet", "id": "P11387", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11387" } ], "reference": [ { "type": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ] }, { "title": "SUMOylation modulates the function of Aurora-B kinase.", "journal": "Journal of cell science", "date": "2010", "authors": "Fernandez-Miranda G, Perez de Castro I, Carmena M, Aguirre-Portoles C, Ruchaud S, Fant X, Montoya G, Earnshaw WC, Malumbres M", "evidence": [ { "database": "Reactome", "id": "R-HSA-4615885", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4615885" } ], "reference": [ { "type": "PubMed", "id": "20663916", "url": "https://glygen.org/publication/PubMed/20663916" } ] }, { "title": "Crystal structure of SUMO-modified proliferating cell nuclear antigen.", "journal": "Journal of molecular biology", "date": "2011", "authors": "Freudenthal BD, Brogie JE, Gakhar L, Kondratick CM, Washington MT", "evidence": [ { "database": "Reactome", "id": "R-HSA-4615885", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4615885" } ], "reference": [ { "type": "PubMed", "id": "21167178", "url": "https://glygen.org/publication/PubMed/21167178" } ] }, { "title": "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.", "journal": "Science signaling", "date": "2011", "authors": "Rigbolt KT, Prokhorova TA, Akimov V, Henningsen J, Johansen PT, Kratchmarova I, Kassem M, Mann M, Olsen JV, Blagoev B", "evidence": [ { "database": "UniProtKB", "id": "P11387", "url": "https://www.uniprot.org/uniprot/P11387" }, { "database": "iPTMnet", "id": "P11387", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11387" } ], "reference": [ { "type": "PubMed", "id": "21406692", "url": "https://glygen.org/publication/PubMed/21406692" } ] }, { "title": "Mitotic kinase Aurora-B is regulated by SUMO-2/3 conjugation/deconjugation during mitosis.", "journal": "Genes to cells : devoted to molecular & cellular mechanisms", "date": "2011", "authors": "Ban R, Nishida T, Urano T", "evidence": [ { "database": "Reactome", "id": "R-HSA-4615885", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4615885" } ], "reference": [ { "type": "PubMed", "id": "21554500", "url": "https://glygen.org/publication/PubMed/21554500" } ] }, { "title": "Structural characterisation of the human DNA topoisomerase I gene promoter.", "journal": "Eur. J. Biochem.", "date": "1990", "authors": "Kunze N, Klein M, Richter A, Knippers R", "evidence": [ { "database": "UniProtKB", "id": "P11387", "url": "https://www.uniprot.org/uniprot/P11387" } ], "reference": [ { "type": "PubMed", "id": "2176592", "url": "https://glygen.org/publication/PubMed/2176592" } ] }, { "title": "Role of SUMO modification of human PCNA at stalled replication fork.", "journal": "Nucleic acids research", "date": "2012", "authors": "Gali H, Juhasz S, Morocz M, Hajdu I, Fatyol K, Szukacsov V, Burkovics P, Haracska L", "evidence": [ { "database": "Reactome", "id": "R-HSA-4615885", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4615885" } ], "reference": [ { "type": "PubMed", "id": "22457066", "url": "https://glygen.org/publication/PubMed/22457066" } ] }, { "title": "The RanBP2/RanGAP1*SUMO1/Ubc9 complex is a multisubunit SUMO E3 ligase.", "journal": "Molecular cell", "date": "2012", "authors": "Werner A, Flotho A, Melchior F", "evidence": [ { "database": "Reactome", "id": "R-HSA-4615885", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4615885" } ], "reference": [ { "type": "PubMed", "id": "22464730", "url": "https://glygen.org/publication/PubMed/22464730" } ] }, { "title": "Rhythmic binding of Topoisomerase I impacts on the transcription of Bmal1 and circadian period.", "journal": "Nucleic acids research", "date": "2012", "authors": "Onishi Y, Kawano Y", "evidence": [ { "database": "UniProtKB", "id": "P11387", "url": "https://www.uniprot.org/uniprot/P11387" } ], "reference": [ { "type": "PubMed", "id": "22904072", "url": "https://glygen.org/publication/PubMed/22904072" } ] }, { "title": "CK2-mediated hyperphosphorylation of topoisomerase I targets serine 506, enhances topoisomerase I-DNA binding, and increases cellular camptothecin sensitivity.", "journal": "PloS one", "date": "2012", "authors": "Bandyopadhyay K, Li P, Gjerset RA", "evidence": [ { "database": "UniProtKB", "id": "P11387", "url": "https://www.uniprot.org/uniprot/P11387" }, { "database": "iPTMnet", "id": "P11387", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11387" } ], "reference": [ { "type": "PubMed", "id": "23185622", "url": "https://glygen.org/publication/PubMed/23185622" } ] }, { "title": "Toward a comprehensive characterization of a human cancer cell phosphoproteome.", "journal": "Journal of proteome research", "date": "2013", "authors": "Zhou H, Di Palma S, Preisinger C, Peng M, Polat AN, Heck AJ, Mohammed S", "evidence": [ { "database": "UniProtKB", "id": "P11387", "url": "https://www.uniprot.org/uniprot/P11387" }, { "database": "iPTMnet", "id": "P11387", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11387" } ], "reference": [ { "type": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" } ] }, { "title": "Monoclonal antibodies neutralizing mammalian DNA topoisomerase I activity.", "journal": "Eur. J. Biochem.", "date": "1988", "authors": "Oddou P, Schmidt U, Knippers R, Richter A", "evidence": [ { "database": "UniProtKB", "id": "P11387", "url": "https://www.uniprot.org/uniprot/P11387" } ], "reference": [ { "type": "PubMed", "id": "2461859", "url": "https://glygen.org/publication/PubMed/2461859" } ] }, { "title": "Proteome-wide identification of SUMO2 modification sites.", "journal": "Science signaling", "date": "2014", "authors": "Tammsalu T, Matic I, Jaffray EG, Ibrahim AFM, Tatham MH, Hay RT", "evidence": [ { "database": "Reactome", "id": "R-HSA-4615885", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4615885" } ], "reference": [ { "type": "PubMed", "id": "24782567", "url": "https://glygen.org/publication/PubMed/24782567" } ] }, { "title": "Determination of an epitope of the diffuse systemic sclerosis marker antigen DNA topoisomerase I: sequence similarity with retroviral p30gag protein suggests a possible cause for autoimmunity in systemic sclerosis.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1989", "authors": "Maul G G, Jimenez S A, Riggs E, Ziemnicka-Kotula D", "evidence": [ { "database": "UniProtKB", "id": "P11387", "url": "https://www.uniprot.org/uniprot/P11387" } ], "reference": [ { "type": "PubMed", "id": "2479024", "url": "https://glygen.org/publication/PubMed/2479024" } ] }, { "title": "Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "2014", "authors": "Impens F, Radoshevich L, Cossart P, Ribet D", "evidence": [ { "database": "UniProtKB", "id": "P11387", "url": "https://www.uniprot.org/uniprot/P11387" }, { "database": "Reactome", "id": "R-HSA-4615885", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4615885" } ], "reference": [ { "type": "PubMed", "id": "25114211", "url": "https://glygen.org/publication/PubMed/25114211" } ] }, { "title": "Uncovering global SUMOylation signaling networks in a site-specific manner.", "journal": "Nat. Struct. Mol. Biol.", "date": "2014", "authors": "Hendriks IA, D'Souza RC, Yang B, Verlaan-de Vries M, Mann M, Vertegaal AC", "evidence": [ { "database": "UniProtKB", "id": "P11387", "url": "https://www.uniprot.org/uniprot/P11387" }, { "database": "Reactome", "id": "R-HSA-4615885", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4615885" } ], "reference": [ { "type": "PubMed", "id": "25218447", "url": "https://glygen.org/publication/PubMed/25218447" } ] }, { "title": "Characterization of the 3' region of the human DNA topoisomerase I gene.", "journal": "Cancer Res.", "date": "1989", "authors": "Zhou B S, Bastow K F, Cheng Y C", "evidence": [ { "database": "UniProtKB", "id": "P11387", "url": "https://www.uniprot.org/uniprot/P11387" } ], "reference": [ { "type": "PubMed", "id": "2544263", "url": "https://glygen.org/publication/PubMed/2544263" } ] }, { "title": "System-wide analysis of SUMOylation dynamics in response to replication stress reveals novel small ubiquitin-like modified target proteins and acceptor lysines relevant for genome stability.", "journal": "Mol. Cell. Proteomics", "date": "2015", "authors": "Xiao Zhenyu, Chang Jer-Gung, Hendriks Ivo A, Sigur\u00f0sson J\u00f3n Otti, Olsen Jesper V, Vertegaal Alfred C O", "evidence": [ { "database": "UniProtKB", "id": "P11387", "url": "https://www.uniprot.org/uniprot/P11387" } ], "reference": [ { "type": "PubMed", "id": "25755297", "url": "https://glygen.org/publication/PubMed/25755297" } ] }, { "title": "SUMO-2 orchestrates chromatin modifiers in response to DNA damage.", "journal": "Cell Rep.", "date": "2015", "authors": "Hendriks Ivo A, Treffers Louise W, Verlaan-de Vries Matty, Olsen Jesper V, Vertegaal Alfred C O", "evidence": [ { "database": "UniProtKB", "id": "P11387", "url": "https://www.uniprot.org/uniprot/P11387" } ], "reference": [ { "type": "PubMed", "id": "25772364", "url": "https://glygen.org/publication/PubMed/25772364" } ] }, { "title": "Identification of Novel Proteins Co-Purifying with Cockayne Syndrome Group B (CSB) Reveals Potential Roles for CSB in RNA Metabolism and Chromatin Dynamics.", "journal": "PLoS ONE", "date": "2015", "authors": "Nicolai S, Filippi S, Caputo M, Cipak L, Gregan J, Ammerer G, Frontini M, Willems D, Prantera G, Balajee AS, Proietti-De-Santis L", "evidence": [ { "database": "UniProtKB", "id": "P11387", "url": "https://www.uniprot.org/uniprot/P11387" } ], "reference": [ { "type": "PubMed", "id": "26030138", "url": "https://glygen.org/publication/PubMed/26030138" } ] }, { "title": "cDNA cloning of human DNA topoisomerase I: catalytic activity of a 67.7-kDa carboxyl-terminal fragment.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1988-04", "authors": "D'Arpa P, Machlin P S, Ratrie H, Rothfield N F, Cleveland D W, Earnshaw W C", "evidence": [ { "database": "UniProtKB", "id": "P11387", "url": "https://www.uniprot.org/uniprot/P11387" } ], "reference": [ { "type": "PubMed", "id": "2833744", "url": "https://glygen.org/publication/PubMed/2833744" } ] }, { "title": "Synthesis of a Highly Azide-Reactive and Thermosensitive Biofunctional Reagent for Efficient Enrichment and Large-Scale Identification of O-GlcNAc Proteins by Mass Spectrometry.", "journal": "Analytical chemistry", "date": "2017", "authors": "Zhang W, Liu T, Dong H, Bai H, Tian F, Shi Z, Chen M, Wang J, Qin W, Qian X", "evidence": [ { "database": "O-GlcNAc Database", "id": "P11387", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P11387" } ], "reference": [ { "type": "PubMed", "id": "28510447", "url": "https://glygen.org/publication/PubMed/28510447" } ] }, { "title": "Engineering a Proximity-Directed O-GlcNAc Transferase for Selective Protein O-GlcNAcylation in Cells.", "journal": "ACS chemical biology", "date": "2020", "authors": "Ramirez DH, Aonbangkhen C, Wu HY, Naftaly JA, Tang S, O'Meara TR, Woo CM", "evidence": [ { "database": "O-GlcNAc Database", "id": "P11387", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P11387" } ], "reference": [ { "type": "PubMed", "id": "32119511", "url": "https://glygen.org/publication/PubMed/32119511" } ] }, { "title": "Methylation-directed glycosylation of chromatin factors represses retrotransposon promoters.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2020", "authors": "Boulard M, Rucli S, Edwards JR, Bestor TH", "evidence": [ { "database": "O-GlcNAc Database", "id": "P11387", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P11387" } ], "reference": [ { "type": "PubMed", "id": "32522876", "url": "https://glygen.org/publication/PubMed/32522876" } ] }, { "title": "Proteomic profiling and genome-wide mapping of O-GlcNAc chromatin-associated proteins reveal an O-GlcNAc-regulated genotoxic stress response.", "journal": "Nature communications", "date": "2020", "authors": "Liu Y, Chen Q, Zhang N, Zhang K, Dou T, Cao Y, Liu Y, Li K, Hao X, Xie X, Li W, Ren Y, Zhang J", "evidence": [ { "database": "O-GlcNAc Database", "id": "P11387", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P11387" } ], "reference": [ { "type": "PubMed", "id": "33214551", "url": "https://glygen.org/publication/PubMed/33214551" } ] }, { "title": "A new tandem enrichment strategy for the simultaneous profiling of O-GlcNAcylation and phosphorylation in RNA-binding proteome.", "journal": "The Analyst", "date": "2021", "authors": "Fan Z, Li J, Liu T, Zhang Z, Qin W, Qian X", "evidence": [ { "database": "O-GlcNAc Database", "id": "P11387", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P11387" }, { "database": "O-GlcNAc Atlas", "id": "P11387", "url": "https://oglcnac.org/atlas/detail/P11387" } ], "reference": [ { "type": "PubMed", "id": "33465208", "url": "https://glygen.org/publication/PubMed/33465208" } ] }, { "title": "O-GlcNAc modification regulates MTA1 transcriptional activity during breast cancer cell genotoxic adaptation.", "journal": "Biochimica et biophysica acta. General subjects", "date": "2021", "authors": "Xie X, Wu Q, Zhang K, Liu Y, Zhang N, Chen Q, Wang L, Li W, Zhang J, Liu Y", "evidence": [ { "database": "O-GlcNAc Database", "id": "P11387", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P11387" } ], "reference": [ { "type": "PubMed", "id": "34019948", "url": "https://glygen.org/publication/PubMed/34019948" } ] }, { "title": "Truncation of the TPR domain of OGT alters substrate and glycosite selection.", "journal": "Analytical and bioanalytical chemistry", "date": "2021", "authors": "Ramirez DH, Yang B, D'Souza AK, Shen D, Woo CM", "evidence": [ { "database": "O-GlcNAc Database", "id": "P11387", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P11387" } ], "reference": [ { "type": "PubMed", "id": "34725712", "url": "https://glygen.org/publication/PubMed/34725712" } ] }, { "title": "TDP1 and TOP1 as targets in anticancer treatment of NSCLC: Activity and protein level in normal and tumor tissue from 150 NSCLC patients correlated to clinical data.", "journal": "Lung cancer (Amsterdam, Netherlands)", "date": "2022", "authors": "Jakobsen AK, Yuusufi S, Madsen LB, Meldgaard P, Knudsen BR, Stougaard M", "evidence": [ { "database": "RefSeq", "id": "NP_003277", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003277" } ], "reference": [ { "type": "PubMed", "id": "34974222", "url": "https://glygen.org/publication/PubMed/34974222" } ] }, { "title": "Topoisomerase I (TOP1) dynamics: conformational transition from open to closed states.", "journal": "Nature communications", "date": "2022", "authors": "Takahashi DT, Gadelle D, Agama K, Kiselev E, Zhang H, Yab E, Petrella S, Forterre P, Pommier Y, Mayer C", "evidence": [ { "database": "RefSeq", "id": "NP_003277", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003277" } ], "reference": [ { "type": "PubMed", "id": "35013228", "url": "https://glygen.org/publication/PubMed/35013228" } ] }, { "title": "Signatures of TOP1 transcription-associated mutagenesis in cancer and germline.", "journal": "Nature", "date": "2022", "authors": "Reijns MAM, Parry DA, Williams TC, Nadeu F, Hindshaw RL, Rios Szwed DO, Nicholson MD, Carroll P, Boyle S, Royo R, Cornish AJ, Xiang H, Ridout K, Schuh A, Aden K, Palles C, Campo E, Stankovic T, Taylor MS, Jackson AP", "evidence": [ { "database": "RefSeq", "id": "NP_003277", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003277" } ], "reference": [ { "type": "PubMed", "id": "35140396", "url": "https://glygen.org/publication/PubMed/35140396" } ] }, { "title": "Topoisomerase 1 inhibits MYC promoter activity by inducing G-quadruplex formation.", "journal": "Nucleic acids research", "date": "2022", "authors": "Keller JG, Hymoller KM, Thorsager ME, Hansen NY, Erlandsen JU, Tesauro C, Simonsen AKW, Andersen AB, Vandso Petersen K, Holm LL, Stougaard M, Andresen BS, Kristensen P, Frohlich R, Knudsen BR", "evidence": [ { "database": "RefSeq", "id": "NP_003277", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003277" } ], "reference": [ { "type": "PubMed", "id": "35687110", "url": "https://glygen.org/publication/PubMed/35687110" } ] }, { "title": "Extracellular arginine availability modulates eIF2\u03b1 O-GlcNAcylation and heme oxygenase 1 translation for cellular homeostasis.", "journal": "Journal of biomedical science", "date": "2023-05-22", "authors": "Hung Yu-Wen, Ouyang Ching, Ping Xiaoli, Qi Yue, Wang Yi-Chang, Kung Hsing-Jien, Ann David K", "evidence": [ { "database": "O-GlcNAc Database", "id": "P11387", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P11387" } ], "reference": [ { "type": "PubMed", "id": "37217939", "url": "https://glygen.org/publication/PubMed/37217939" } ] }, { "title": "Coinhibition of topoisomerase 1 and BRD4-mediated pause release selectively kills pancreatic cancer via readthrough transcription.", "journal": "Science advances", "date": "2023-10-13", "authors": "Cameron Donald P, Grosser Jan, Ladigan Swetlana, Kuzin Vladislav, Iliopoulou Evanthia, Wiegard Anika, Benredjem Hajar, Jackson Kathryn, Liffers Sven T, Lueong Smiths, Cheung Phyllis F, Vangala Deepak, Pohl Michael, Viebahn Richard, Teschendorf Christian, Wolters Heiner, Usta Selami, Geng Keyi, Kutter Claudia, Arsenian-Henriksson Marie, Siveke Jens T, Tannapfel Andrea, Schmiegel Wolff, Hahn Stephan A, Baranello Laura", "evidence": [ { "database": "RefSeq", "id": "NP_003277", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003277" } ], "reference": [ { "type": "PubMed", "id": "37831776", "url": "https://glygen.org/publication/PubMed/37831776" } ] }, { "title": "Mutation at the catalytic site of topoisomerase I in CEM/C2, a human leukemia cell line resistant to camptothecin.", "journal": "Cancer research", "date": "1995", "authors": "Fujimori A, Harker WG, Kohlhagen G, Hoki Y, Pommier Y", "evidence": [ { "database": "UniProtKB", "id": "P11387", "url": "https://www.uniprot.org/uniprot/P11387" } ], "reference": [ { "type": "PubMed", "id": "7882333", "url": "https://glygen.org/publication/PubMed/7882333" } ] }, { "title": "Crystal structures of human topoisomerase I in covalent and noncovalent complexes with DNA.", "journal": "Science (New York, N.Y.)", "date": "1998", "authors": "Redinbo MR, Stewart L, Kuhn P, Champoux JJ, Hol WG", "evidence": [ { "database": "UniProtKB", "id": "P11387", "url": "https://www.uniprot.org/uniprot/P11387" } ], "reference": [ { "type": "PubMed", "id": "9488644", "url": "https://glygen.org/publication/PubMed/9488644" } ] }, { "title": "A model for the mechanism of human topoisomerase I.", "journal": "Science", "date": "1998", "authors": "Stewart L, Redinbo M R, Qiu X, Hol W G, Champoux J J", "evidence": [ { "database": "UniProtKB", "id": "P11387", "url": "https://www.uniprot.org/uniprot/P11387" } ], "reference": [ { "type": "PubMed", "id": "9488652", "url": "https://glygen.org/publication/PubMed/9488652" } ] } ], "pathway": [ { "id": "hsa:7150", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:7150", "resource": "KEGG Pathway" }, { "id": "R-HSA-4615885", "name": "SUMOylation of DNA replication proteins", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4615885", "resource": "Reactome", "description": "SUMOylation of DNA replication proteins" } ], "orthologs": [ { "uniprot_canonical_ac": "I3LHM3-1", "protein_name": "DNA topoisomerase I", "gene_name": "TOP1", "tax_id": 9823, "organism": "Sus scrofa", "sequence": { "sequence": "MSGDHLHTDSQIEADFRLNDSHKHKDKHKDREHRHKEHKKDKEKDREKSKHSNSEHKDSEKKHKEKEKTKHKDGSSEKHKDKHKDRDKEKRKEEKIRASGDAKIKKEKENGFSSPPRIKDEPEDDGYFAPPKEDIKPLKRPRDEDDADYKPKKIKTEDIKKEKKRKLEEEEDGKLKKTKNKDKDKDKKVPEPDSKKKKPKKEEEQKWKWWEEERYPEGIKWKFLEHKGPVFAPPYEPLPESVKFYYDGKVMKLSPKAEEVATFFAKMLDHEYTTKEIFRKNFFKDWRKEMTNEEKNIITNLSKCDFTQMSQYFKAQSEARKQMSKEEKLKIKEENEKLLKEYGFCIMDNHRERIANFKIEPPGLFRGRGNHPKMGMLKRRIMPEDIIINCSKDAKVPSPPPGHKWKEVRHDNKVTWLVSWTENIQGSIKYIMLNPSSRIKGEKDWQKYETARRLKKCVDKIRNQYREDWKSKEMKVRQRAVALYFIDKLALRAGNEKEEGETADTVGCCSLRVEHINLHPELDGQEYVVEFDFLGKDSIRYYNKVPVEKRVFKNLQLFMENKQPEDDLFDRLNTGILNKHLQDLMEGLTAKVFRTYNASITLQQQLKELTAPDENIPAKILSYNRANRAVAILCNHQRAPPKTFEKSMMNLQTKIDAKKEQLADARRDLKSAKADAKVLKDAKTKKVVESKKKAVQRLEEQLMKLEVQATDREENKQIALGTSKLNYLDPRITVAWCKKWGVPIEKIYNKTQREKFAWAIDMADEDYEF", "length": 769 }, "evidence": [ { "id": "P11387", "url": "https://omabrowser.org/oma/group/P11387/", "database": "OMA" } ], "common_name": "Pig" }, { "uniprot_canonical_ac": "P04786-1", "protein_name": "DNA topoisomerase 1", "gene_name": "TOP1", "tax_id": 559292, "organism": "Saccharomyces cerevisiae S288C", "sequence": { "sequence": "MTIADASKVNHELSSDDDDDVPLSQTLKKRKVASMNSASLQDEAEPYDSDEAISKISKKKTKKIKTEPVQSSSLPSPPAKKSATSKPKKIKKEDGDVKVKTTKKEEQENEKKKREEEEEEDKKAKEEEEEYKWWEKENEDDTIKWVTLKHNGVIFPPPYQPLPSHIKLYYDGKPVDLPPQAEEVAGFFAALLESDHAKNPVFQKNFFNDFLQVLKESGGPLNGIEIKEFSRCDFTKMFDYFQLQKEQKKQLTSQEKKQIRLEREKFEEDYKFCELDGRREQVGNFKVEPPDLFRGRGAHPKTGKLKRRVNPEDIVLNLSKDAPVPPAPEGHKWGEIRHDNTVQWLAMWRENIFNSFKYVRLAANSSLKGQSDYKKFEKARQLKSYIDAIRRDYTRNLKSKVMLERQKAVAIYLIDVFALRAGGEKSEDEADTVGCCSLRYEHVTLKPPNTVIFDFLGKDSIRFYQEVEVDKQVFKNLTIFKRPPKQPGHQLFDRLDPSILNKYLQNYMPGLTAKVFRTYNASKTMQDQLDLIPNKGSVAEKILKYNAANRTVAILCNHQRTVTKGHAQTVEKANNRIQELEWQKIRCKRAILQLDKDLLKKEPKYFEEIDDLTKEDEATIHKRIIDREIEKYQRKFVRENDKRKFEKEELLPESQLKEWLEKVDEKKQEFEKELKTGEVELKSSWNSVEKIKAQVEKLEQRIQTSSIQLKDKEENSQVSLGTSKINYIDPRLSVVFCKKYDVPIEKIFTKTLREKFKWAIESVDENWRF", "length": 769 }, "evidence": [ { "id": "P11387", "url": "https://omabrowser.org/oma/group/P11387/", "database": "OMA" } ], "common_name": "Yeast" }, { "uniprot_canonical_ac": "Q04750-1", "protein_name": "DNA topoisomerase 1", "gene_name": "Top1", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MSGDHLHNDSQIEADFRLNDSHKHKDKHKDREHRHKEHKKDKDKDREKSKHSNSEHKDSEKKHKEKEKTKHKDGSSEKHKDKHKDRDKERRKEEKIRAAGDAKIKKEKENGFSSPPRIKDEPEDDGYFAPPKEDIKPLKRLRDEDDADYKPKKIKTEDIKKEKKRKSEEEEDGKLKKPKNKDKDKKVAEPDNKKKKPKKEEEQKWKWWEEERYPEGIKWKFLEHKGPVFAPPYEPLPESVKFYYDGKVMKLSPKAEEVATFFAKMLDHEYTTKEIFRKNFFKDWRKEMTNDEKNTITNLSKCDFTQMSQYFKAQSEARKQMSKEEKLKIKEENEKLLKEYGFCVMDNHRERIANFKIEPPGLFRGRGNHPKMGMLKRRIMPEDIIINCSKDAKVPSPPPGHKWKEVRHDNKVTWLVSWTENIQGSIKYIMLNPSSRIKGEKDWQKYETARRLKKCVDKIRNQYREDWKSKEMKVRQRAVALYFIDKLALRAGNEKEEGETADTVGCCSLRVEHINLHPELDGQEYVVEFDFPGKDSIRYYNKVPVEKRVFKNLQLFMENKQPEDDLFDRLNTGILNKHLQDLMEGLTAKVFRTYNASITLQQQLKELTAPDENVPAKILSYNRANRAVAILCNHQRAPPKTFEKSMMNLQSKIDAKKDQLADARRDLKSAKADAKVMKDAKTKKVVESKKKAVQRLEEQLMKLEVQATDREENKQIALGTSKLNYLDPRITVAWCKKWGVPIEKIYNKTQREKFAWAIDMTDEDYEF", "length": 767 }, "evidence": [ { "id": "45926632", "url": "http://www.informatics.jax.org/homology/45926632", "database": "MGI" }, { "id": "P11387", "url": "https://omabrowser.org/oma/group/P11387/", "database": "OMA" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q9WUL0-1", "protein_name": "DNA topoisomerase 1", "gene_name": "Top1", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MSGDHLHNDSQIEADFRLNDSHKHKDKHKDREHRHKEHKKDKDKDREKSKHSNSEHKDSEKKHKEKEKTKHKDGSSDKHKDKHKDRDKEKRKEEKIRAAGDAKIKKEKENGFSSPPRIKDEPEDDGYFAPPKEDIKPLKRPRDEDDADYKPKKIKTEDIKKEKKRKLEEEEDGKLKKPKNKDKDKKVAEPDNKKKKAKKEEEQKWKWWEEERYPEGIKWKFLEHKGPVFAPPYEPLPEGVKFYYDGKVMKLSPKAEEVATFFAKMLDHEYTTKEIFRKNFFKDWRKEMTNDEKNTITNLSKCDFTQMSQYFKAQSEARKQMSKEEKLKIKEENEKLLKEYGFCVMDNHRERIANFKIEPPGLFRGRGNHPKMGMLKRRIMPEDIIINCSKDAKVPSPPPGHKWKEVRHDNKVTWLVSWTENIQGSIKYIMLNPSSRIKGEKDWQKYETARRLKKCVDKIRNQYREDWKSKEMKVRQRAVALYFIDKLALRAGNEKEEGETADTVGCCSLRVEHINLHPELDGQEYVVEFDFPGKDSIRYYNKVPVEKRVFKNLQLFMENKQPEDDLFDRLNTGILNKHLQDLMEGLTAKVFRTYNASITLQQQLKELTAPDENVPAKILSYNRANRAVAILCNHQRAPPKTFEKSMMNLQSKIDAKKDQLADARKDLKSAKADAKVMKDAKTKKVVESKKKAVQRLEEQLMKLEVQATDREENKQIALGTSKLNYLDPRITVAWCKKWGVPIEKIYNKTQREKFAWAIDMTDEDYEF", "length": 767 }, "evidence": [ { "id": "45926632", "url": "http://www.informatics.jax.org/homology/45926632", "database": "MGI" } ], "common_name": "Rat" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 12, "go_terms": [ { "name": "DNA binding", "id": "GO:0003677", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003677", "evidence": [ { "database": "UniProtKB", "id": "P11387", "url": "https://www.uniprot.org/uniprot/P11387" } ], "pmid": "" }, { "name": "DNA topoisomerase type I (single strand cut, ATP-independent) activity", "id": "GO:0003917", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003917", "evidence": [ { "database": "UniProtKB", "id": "P11387", "url": "https://www.uniprot.org/uniprot/P11387" } ], "pmid": "" }, { "name": "DNA binding, bending", "id": "GO:0008301", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008301", "evidence": [ { "database": "UniProtKB", "id": "P11387", "url": "https://www.uniprot.org/uniprot/P11387" } ], "pmid": "" }, { "name": "chromatin binding", "id": "GO:0003682", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003682", "evidence": [ { "database": "UniProtKB", "id": "P11387", "url": "https://www.uniprot.org/uniprot/P11387" } ], "pmid": "" }, { "name": "RNA binding", "id": "GO:0003723", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003723", "evidence": [ { "database": "UniProtKB", "id": "P11387", "url": "https://www.uniprot.org/uniprot/P11387" } ], "pmid": "" }, { "name": "protein serine/threonine kinase activity", "id": "GO:0004674", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004674", "evidence": [ { "database": "UniProtKB", "id": "P11387", "url": "https://www.uniprot.org/uniprot/P11387" } ], "pmid": "" }, { "name": "ATP binding", "id": "GO:0005524", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005524", "evidence": [ { "database": "UniProtKB", "id": "P11387", "url": "https://www.uniprot.org/uniprot/P11387" } ], "pmid": "" }, { "name": "protein domain specific binding", "id": "GO:0019904", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019904", "evidence": [ { "database": "UniProtKB", "id": "P11387", "url": "https://www.uniprot.org/uniprot/P11387" } ], "pmid": "" }, { "name": "double-stranded DNA binding", "id": "GO:0003690", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003690", "evidence": [ { "database": "UniProtKB", "id": "P11387", "url": "https://www.uniprot.org/uniprot/P11387" } ], "pmid": "" }, { "name": "RNA polymerase II cis-regulatory region sequence-specific DNA binding", "id": "GO:0000978", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000978", "evidence": [ { "database": "UniProtKB", "id": "P11387", "url": "https://www.uniprot.org/uniprot/P11387" } ], "pmid": "" }, { "name": "single-stranded DNA binding", "id": "GO:0003697", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003697", "evidence": [ { "database": "UniProtKB", "id": "P11387", "url": "https://www.uniprot.org/uniprot/P11387" } ], "pmid": "" }, { "name": "supercoiled DNA binding", "id": "GO:0097100", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0097100", "evidence": [ { "database": "UniProtKB", "id": "P11387", "url": "https://www.uniprot.org/uniprot/P11387" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 9, "go_terms": [ { "name": "chromosome", "id": "GO:0005694", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005694", "evidence": [ { "database": "UniProtKB", "id": "P11387", "url": "https://www.uniprot.org/uniprot/P11387" } ], "pmid": "" }, { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "P11387", "url": "https://www.uniprot.org/uniprot/P11387" } ], "pmid": "" }, { "name": "nucleoplasm", "id": "GO:0005654", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654", "evidence": [ { "database": "UniProtKB", "id": "P11387", "url": "https://www.uniprot.org/uniprot/P11387" } ], "pmid": "" }, { "name": "nucleolus", "id": "GO:0005730", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005730", "evidence": [ { "database": "UniProtKB", "id": "P11387", "url": "https://www.uniprot.org/uniprot/P11387" } ], "pmid": "" }, { "name": "perikaryon", "id": "GO:0043204", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043204", "evidence": [ { "database": "UniProtKB", "id": "P11387", "url": "https://www.uniprot.org/uniprot/P11387" } ], "pmid": "" }, { "name": "fibrillar center", "id": "GO:0001650", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001650", "evidence": [ { "database": "UniProtKB", "id": "P11387", "url": "https://www.uniprot.org/uniprot/P11387" } ], "pmid": "" }, { "name": "P-body", "id": "GO:0000932", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000932", "evidence": [ { "database": "UniProtKB", "id": "P11387", "url": "https://www.uniprot.org/uniprot/P11387" } ], "pmid": "" }, { "name": "male germ cell nucleus", "id": "GO:0001673", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001673", "evidence": [ { "database": "UniProtKB", "id": "P11387", "url": "https://www.uniprot.org/uniprot/P11387" } ], "pmid": "" }, { "name": "protein-DNA complex", "id": "GO:0032993", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032993", "evidence": [ { "database": "UniProtKB", "id": "P11387", "url": "https://www.uniprot.org/uniprot/P11387" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 11, "go_terms": [ { "name": "DNA topological change", "id": "GO:0006265", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006265", "evidence": [ { "database": "UniProtKB", "id": "P11387", "url": "https://www.uniprot.org/uniprot/P11387" } ], "pmid": "" }, { "name": "chromatin remodeling", "id": "GO:0006338", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006338", "evidence": [ { "database": "UniProtKB", "id": "P11387", "url": "https://www.uniprot.org/uniprot/P11387" } ], "pmid": "" }, { "name": "chromosome segregation", "id": "GO:0007059", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007059", "evidence": [ { "database": "UniProtKB", "id": "P11387", "url": "https://www.uniprot.org/uniprot/P11387" } ], "pmid": "" }, { "name": "DNA replication", "id": "GO:0006260", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006260", "evidence": [ { "database": "UniProtKB", "id": "P11387", "url": "https://www.uniprot.org/uniprot/P11387" } ], "pmid": "" }, { "name": "embryonic cleavage", "id": "GO:0040016", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0040016", "evidence": [ { "database": "UniProtKB", "id": "P11387", "url": "https://www.uniprot.org/uniprot/P11387" } ], "pmid": "" }, { "name": "circadian rhythm", "id": "GO:0007623", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007623", "evidence": [ { "database": "UniProtKB", "id": "P11387", "url": "https://www.uniprot.org/uniprot/P11387" } ], "pmid": "" }, { "name": "phosphorylation", "id": "GO:0016310", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016310", "evidence": [ { "database": "UniProtKB", "id": "P11387", "url": "https://www.uniprot.org/uniprot/P11387" } ], "pmid": "" }, { "name": "peptidyl-serine phosphorylation", "id": "GO:0018105", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0018105", "evidence": [ { "database": "UniProtKB", "id": "P11387", "url": "https://www.uniprot.org/uniprot/P11387" } ], "pmid": "" }, { "name": "response to xenobiotic stimulus", "id": "GO:0009410", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009410", "evidence": [ { "database": "UniProtKB", "id": "P11387", "url": "https://www.uniprot.org/uniprot/P11387" } ], "pmid": "" }, { "name": "circadian regulation of gene expression", "id": "GO:0032922", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032922", "evidence": [ { "database": "UniProtKB", "id": "P11387", "url": "https://www.uniprot.org/uniprot/P11387" } ], "pmid": "" }, { "name": "programmed cell death", "id": "GO:0012501", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0012501", "evidence": [ { "database": "UniProtKB", "id": "P11387", "url": "https://www.uniprot.org/uniprot/P11387" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 19, "end_pos": 21, "annotation": "n_glycosylation_sequon" }, { "start_pos": 296, "end_pos": 298, "annotation": "n_glycosylation_sequon" }, { "start_pos": 385, "end_pos": 387, "annotation": "n_glycosylation_sequon" }, { "start_pos": 593, "end_pos": 595, "annotation": "n_glycosylation_sequon" }, { "start_pos": 745, "end_pos": 747, "annotation": "n_glycosylation_sequon" }, { "start_pos": 8, "end_pos": 10, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "Phosphorylation at Ser-506 by CK2 increases binding to supercoiled DNA and sensitivity to camptothecin.", "evidence": [ { "database": "UniProtKB", "id": "P11387", "url": "https://www.uniprot.org/uniprot/P11387" }, { "database": "PubMed", "id": "23185622", "url": "https://glygen.org/publication/PubMed/23185622" } ] }, { "annotation": "Sumoylated. Lys-117 is the main site of sumoylation. Sumoylation plays a role in partitioning TOP1 between nucleoli and nucleoplasm. Levels are dramatically increased on camptothecin (CPT) treatment.", "evidence": [ { "database": "UniProtKB", "id": "P11387", "url": "https://www.uniprot.org/uniprot/P11387" }, { "database": "PubMed", "id": "12149243", "url": "https://glygen.org/publication/PubMed/12149243" } ] } ], "interactions": [], "reactions": [ { "id": "R-HSA-4641362", "name": "SUMOylation of TOP1 with SUMO1", "equation": "", "summary": "TOP1 is SUMOylated at lysine-117 with SUMO1 (Mao et al. 2000, Mo et al. 2002, Rallabhandi et al. 2002, Impens et al. 2014). SUMOylation is observed in response to the topoisomerase inhibitor camptothecin and causes nucleolar delocalization of TOP1.", "cellular_location": "nucleoplasm", "input_participant_list": [ "R-HSA-4641363" ], "output_participant_list": [ "R-HSA-4641364" ], "enzyme_list": [ "P11387-1", "P63279-1" ], "evidence": [ { "id": "R-HSA-4641362", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4641362" } ] } ], "reaction_participants": [ { "participant_id": "R-HSA-4641363", "participant_name": "TOP1 [nucleoplasm]", "crossref": [ { "id": "P11387", "database": "UniProt", "url": "" }, { "id": "ENST00000361337", "database": "Ensembl", "url": "" }, { "id": "ENSG00000198900", "database": "Ensembl", "url": "" }, { "id": "2636", "database": "Guide to Pharmacology - Targets", "url": "" }, { "id": "1K4T", "database": "PDB", "url": "" }, { "id": "TOP1_HUMAN", "database": "ZINC - Substances", "url": "" }, { "id": "TOP1_HUMAN", "database": "ZINC - Investigational", "url": "" }, { "id": "1LPQ", "database": "PDB", "url": "" }, { "id": "ENSP00000354522", "database": "Ensembl", "url": "" }, { "id": "1SEU", "database": "PDB", "url": "" }, { "id": "P11387", "database": "PRO", "url": "" }, { "id": "ENSG00000198900-TOP1", "database": "HPA", "url": "" }, { "id": "1EJ9", "database": "PDB", "url": "" }, { "id": "1K4S", "database": "PDB", "url": "" }, { "id": "1T8I", "database": "PDB", "url": "" }, { "id": "NP_003277.1", "database": "RefSeq", "url": "" }, { "id": "1TL8", "database": "PDB", "url": "" }, { "id": "1RR8", "database": "PDB", "url": "" }, { "id": "TOP1_HUMAN", "database": "ZINC - FDA approved", "url": "" }, { "id": "P11387", "database": "GeneCards", "url": "" }, { "id": "1RRJ", "database": "PDB", "url": "" }, { "id": "1A36", "database": "PDB", "url": "" }, { "id": "1A35", "database": "PDB", "url": "" }, { "id": "1A31", "database": "PDB", "url": "" }, { "id": "ENSG00000198900", "database": "OpenTargets", "url": "" }, { "id": "1SC7", "database": "PDB", "url": "" }, { "id": "TOP1_HUMAN", "database": "ZINC - World Drugs", "url": "" }, { "id": "P11387", "database": "ZINC target", "url": "" }, { "id": "1NH3", "database": "PDB", "url": "" }, { "id": "TOP1_HUMAN", "database": "ZINC - Biogenic", "url": "" }, { "id": "TOP1_HUMAN", "database": "ZINC - Predictions - Purchasable", "url": "" }, { "id": "P11387", "database": "Pharos - Targets", "url": "" }, { "id": "1R49", "database": "PDB", "url": "" } ] }, { "participant_id": "R-HSA-4641364", "participant_name": "monoSUMO1-K117-TOP1 [nucleoplasm]", "crossref": [ { "id": "P11387", "database": "PRO", "url": "" }, { "id": "TOP1_HUMAN", "database": "ZINC - FDA approved", "url": "" }, { "id": "1A35", "database": "PDB", "url": "" }, { "id": "TOP1_HUMAN", "database": "ZINC - Investigational", "url": "" }, { "id": "1T8I", "database": "PDB", "url": "" }, { "id": "ENSG00000198900", "database": "Ensembl", "url": "" }, { "id": "1EJ9", "database": "PDB", "url": "" }, { "id": "1RRJ", "database": "PDB", "url": "" }, { "id": "1K4T", "database": "PDB", "url": "" }, { "id": "ENSG00000198900", "database": "OpenTargets", "url": "" }, { "id": "ENSP00000354522", "database": "Ensembl", "url": "" }, { "id": "1TL8", "database": "PDB", "url": "" }, { "id": "P11387", "database": "UniProt", "url": "" }, { "id": "ENSG00000198900-TOP1", "database": "HPA", "url": "" }, { "id": "P11387", "database": "GeneCards", "url": "" }, { "id": "2636", "database": "Guide to Pharmacology - Targets", "url": "" }, { "id": "1A31", "database": "PDB", "url": "" }, { "id": "1LPQ", "database": "PDB", "url": "" }, { "id": "NP_003277.1", "database": "RefSeq", "url": "" }, { "id": "1SC7", "database": "PDB", "url": "" }, { "id": "1K4S", "database": "PDB", "url": "" }, { "id": "TOP1_HUMAN", "database": "ZINC - Substances", "url": "" }, { "id": "1A36", "database": "PDB", "url": "" }, { "id": "ENST00000361337", "database": "Ensembl", "url": "" }, { "id": "1SEU", "database": "PDB", "url": "" }, { "id": "1RR8", "database": "PDB", "url": "" }, { "id": "TOP1_HUMAN", "database": "ZINC - Biogenic", "url": "" }, { "id": "P11387", "database": "Pharos - Targets", "url": "" }, { "id": "P11387", "database": "ZINC target", "url": "" }, { "id": "TOP1_HUMAN", "database": "ZINC - World Drugs", "url": "" }, { "id": "TOP1_HUMAN", "database": "ZINC - Predictions - Purchasable", "url": "" }, { "id": "1R49", "database": "PDB", "url": "" }, { "id": "1NH3", "database": "PDB", "url": "" } ] } ], "reaction_enzymes": [ { "uniprot_ac": "P11387", "gene_name": "TOP1", "activity": [ { "ec_number": "5.6.2.1", "activity": "ATP-independent breakage of single-stranded DNA, followed by passage and rejoining.", "evidence": [ { "id": "P11387", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11387" } ] }, { "ec_number": "5.6.2.1", "activity": "", "evidence": [ { "id": "P11387", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11387" } ] } ] }, { "uniprot_ac": "P63279", "gene_name": "UBE2I", "activity": [ { "ec_number": "2.3.2.-", "activity": "", "evidence": [ { "id": "P63279", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P63279" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.oma", "label": "OMA Homologs" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [ 643 ], "snv_sites": [ 152, 248, 431 ], "glycation_sites": [], "phosphorylation_sites": [ 2, 10, 21, 57, 73, 111, 112, 125, 268, 298, 394, 426, 432, 506, 667 ], "sequon_annotation_sites": [ { "start_pos": 19, "end_pos": 21 }, { "start_pos": 296, "end_pos": 298 }, { "start_pos": 385, "end_pos": 387 }, { "start_pos": 593, "end_pos": 595 }, { "start_pos": 745, "end_pos": 747 }, { "start_pos": 8, "end_pos": 10 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 17 }, { "field": "total_sites", "count": 15 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 } ], "sort_fields": [ "start_pos", "end_pos", "subjects_tested", "subjects_positive", "frequency", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 } ], "sort_fields": [ "start_pos", "end_pos", "subjects_tested", "subjects_positive", "frequency", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 72 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }