{ "uniprot_canonical_ac": "P0DTA3-1", "uniprot_ac": "P0DTA3", "uniprot_id": "SPD11_HUMAN", "mass": { "chemical_mass": 31441.0, "monoisotopic_mass": 31441.0 }, "refseq": {}, "gene_names": [ { "name": "SPDYE11", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P0DTA3", "id": "P0DTA3" } ], "protein_names": [ { "name": "Putative speedy protein E11", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P0DTA3" } ], "function": [ { "annotation": "Acts as a modulator of the nicotinic acetylcholine receptor alpha-7 (CHRNA7) activity.", "evidence": [ { "database": "UniProtKB", "id": "P0DTA3", "url": "https://www.uniprot.org/uniprot/P0DTA3#function" }, { "database": "PubMed", "id": "27789755", "url": "https://glygen.org/publication/PubMed/27789755" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P0DTA3", "url": "https://www.uniprot.org/uniprot/P0DTA3" } ], "common_name": "Human" } ], "gene": [ { "name": "SPDYE11", "url": "https://www.uniprot.org/uniprot/P0DTA3", "locus": { "chromosome": "7", "start_pos": 73047862, "end_pos": 73057911, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000275976", "url": "https://www.ensembl.org/id/ENSG00000275976" } ] } } ], "crossref": [ { "id": "ENSG00000286228", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000286228", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "SPDYE11", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=SPDYE11", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "51507", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=51507", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "IPR020984", "url": "https://www.ebi.ac.uk/interpro/entry/IPR020984", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "NX_P0DTA3", "url": "https://www.nextprot.org/entry/NX_P0DTA3", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "KXYLAND", "url": "https://omabrowser.org/oma/group/KXYLAND/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "4655013at2759", "url": "http://www.orthodb.org/?query=4655013at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR31156", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR31156", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR31156:SF15", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR31156:SF15", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF11357", "url": "http://pfam.xfam.org/family/PF11357", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "XP_016885939", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_016885939", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "P0DTA3", "url": "https://www.uniprot.org/uniprot/P0DTA3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P0DTA3-1", "url": "https://www.uniprot.org/uniprot/P0DTA3-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MGQILGKIMMSHQPQPQEERSPQRSTSGYPLQEVVDDEVSGPSAPGVDPSPPRRSLGWKRKRECLDESDDEPEKELAPEPEETWVAETLCGLKMKAKRRRVSLVLPEYYEAFNRLLEDPVIKRLLAWDKDLRVSDKYLLAMVIAYFSRAGLPSWQYQRIHFFLALYLANDMEEDDEAPKQNIFYFLYEETRSHIPLLSELWFQLCRYMNPRARKNCSQIALFRKYRFHFFCSMRCRAWVSLEELEEIQAYDPEHWVWARDRAHLS", "length": 265, "header": "sp|P0DTA3-1|SPD11_HUMAN Isoform 1 of Putative speedy protein E11 OS=Homo sapiens OX=9606 GN=SPDYE11 PE=5 SV=1 CANONICAL=P0DTA3-1" }, "isoforms": [ { "isoform_ac": "P0DTA3-1", "url": "", "sequence": { "sequence": "MGQILGKIMMSHQPQPQEERSPQRSTSGYPLQEVVDDEVSGPSAPGVDPSPPRRSLGWKRKRECLDESDDEPEKELAPEPEETWVAETLCGLKMKAKRRRVSLVLPEYYEAFNRLLEDPVIKRLLAWDKDLRVSDKYLLAMVIAYFSRAGLPSWQYQRIHFFLALYLANDMEEDDEAPKQNIFYFLYEETRSHIPLLSELWFQLCRYMNPRARKNCSQIALFRKYRFHFFCSMRCRAWVSLEELEEIQAYDPEHWVWARDRAHLS", "length": 265, "header": "sp|P0DTA3-1|SPD11_HUMAN Isoform 1 of Putative speedy protein E11 OS=Homo sapiens OX=9606 GN=SPDYE11 PE=5 SV=1 CANONICAL=P0DTA3-1" }, "locus": { "chromosome": "7", "start_pos": 73056111, "end_pos": 73050245, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000340073.9", "url": "https://www.ensembl.org/id/ENST00000340073.9" }, { "database": "Ensembl Peptide", "id": "ENSP00000498510.1", "url": "https://www.ensembl.org/id/ENSP00000498510.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "A Genome-Wide Arrayed cDNA Screen to Identify Functional Modulators of \u03b17 Nicotinic Acetylcholine Receptors.", "journal": "SLAS discovery : advancing life sciences R & D", "date": "2017-02", "authors": "Rex Elizabeth B, Shukla Nikhil, Gu Shenyan, Bredt David, DiSepio Daniel", "evidence": [ { "database": "UniProtKB", "id": "P0DTA3", "url": "https://www.uniprot.org/uniprot/P0DTA3" } ], "reference": [ { "type": "PubMed", "id": "27789755", "url": "https://glygen.org/publication/PubMed/27789755" } ] } ], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "acetylcholine receptor regulator activity", "id": "GO:0030548", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030548", "evidence": [ { "database": "UniProtKB", "id": "P0DTA3", "url": "https://www.uniprot.org/uniprot/P0DTA3" } ], "pmid": "" }, { "name": "protein kinase binding", "id": "GO:0019901", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019901", "evidence": [ { "database": "UniProtKB", "id": "P0DTA3", "url": "https://www.uniprot.org/uniprot/P0DTA3" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 215, "end_pos": 217, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 215, "end_pos": 217 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }