{ "uniprot_canonical_ac": "P0DPD7-4", "uniprot_ac": "P0DPD7", "uniprot_id": "EFMT4_HUMAN", "mass": { "chemical_mass": 28306.0, "monoisotopic_mass": 28306.0 }, "refseq": { "ac": "NP_115707", "name": "EEF1A lysine methyltransferase 4", "summary": "This gene encodes a member of the lysine-specific methyltransferase (KMT) family. The encoded enzyme catalyzes the methylation of lysine-36 of the eukaryotic translation elongation factor 1 alpha. Methylation by this enzyme may affect endoplasmic reticulum-related processes. [provided by RefSeq, Jul 2017].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_115707" }, "gene_names": [ { "name": "EEF1AKMT4", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P0DPD7", "id": "P0DPD7" }, { "name": "EEF1AKMT4", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_115707", "id": "NP_115707" } ], "protein_names": [ { "name": "EEF1A lysine methyltransferase 4", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P0DPD7" }, { "name": "2.1.1.-", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P0DPD7" }, { "name": "EEF1A lysine methyltransferase 4", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_115707", "id": "NP_115707" }, { "name": "eukaryotic translation elongation factor 1 alpha lysine specific methyltransferase 4", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_115707", "id": "NP_115707" } ], "function": [ { "annotation": "Methylation of lysine (K36) in eukaryotic elongation factor alpha (eEF1A) proteins is dependent on EEF1A lysine methyltransferase 4 (eEF1A-KMT4) in vivo.", "evidence": [ { "database": "RefSeq", "id": "NP_115707", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_115707" }, { "database": "PubMed", "id": "28520920", "url": "https://glygen.org/publication/PubMed/28520920" } ] }, { "annotation": "Protein-lysine methyltransferase that efficiently catalyzes three successive methylations on 'Lys-36' in eukaryotic translation elongation factor 1 alpha (EEF1A1 or EEF1A2).", "evidence": [ { "database": "UniProtKB", "id": "P0DPD7", "url": "https://www.uniprot.org/uniprot/P0DPD7#function" }, { "database": "PubMed", "id": "28520920", "url": "https://glygen.org/publication/PubMed/28520920" } ] }, { "annotation": "This gene encodes a member of the lysine-specific methyltransferase (KMT) family. The encoded enzyme catalyzes the methylation of lysine-36 of the eukaryotic translation elongation factor 1 alpha. Methylation by this enzyme may affect endoplasmic reticulum-related processes. [provided by RefSeq, Jul 2017].", "evidence": [ { "database": "RefSeq", "id": "NP_115707", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_115707" } ] } ], "disease": [], "snv": [], "mutagenesis": [ { "start_pos": 129, "end_pos": 129, "sequence_org": "E", "sequence_mut": "A", "comment": "Abolishes protein-lysine N-methyltransferase activity.", "evidence": [ { "database": "UniProtKB", "id": "P0DPD7", "url": "https://www.uniprot.org/uniprot/P0DPD7" }, { "database": "PubMed", "id": "28520920", "url": "https://glygen.org/publication/PubMed/28520920" } ] }, { "start_pos": 130, "end_pos": 130, "sequence_org": "K", "sequence_mut": "A", "comment": "Abolishes protein-lysine N-methyltransferase activity.", "evidence": [ { "database": "UniProtKB", "id": "P0DPD7", "url": "https://www.uniprot.org/uniprot/P0DPD7" }, { "database": "PubMed", "id": "28520920", "url": "https://glygen.org/publication/PubMed/28520920" } ] }, { "start_pos": 132, "end_pos": 132, "sequence_org": "T", "sequence_mut": "A", "comment": "Reduces protein-lysine N-methyltransferase activity.", "evidence": [ { "database": "UniProtKB", "id": "P0DPD7", "url": "https://www.uniprot.org/uniprot/P0DPD7" }, { "database": "PubMed", "id": "28520920", "url": "https://glygen.org/publication/PubMed/28520920" } ] }, { "start_pos": 133, "end_pos": 133, "sequence_org": "L", "sequence_mut": "A", "comment": "Reduces protein-lysine N-methyltransferase activity.", "evidence": [ { "database": "UniProtKB", "id": "P0DPD7", "url": "https://www.uniprot.org/uniprot/P0DPD7" }, { "database": "PubMed", "id": "28520920", "url": "https://glygen.org/publication/PubMed/28520920" } ] }, { "start_pos": 134, "end_pos": 134, "sequence_org": "D", "sequence_mut": "A", "comment": "Abolishes protein-lysine N-methyltransferase activity.", "evidence": [ { "database": "UniProtKB", "id": "P0DPD7", "url": "https://www.uniprot.org/uniprot/P0DPD7" }, { "database": "PubMed", "id": "28520920", "url": "https://glygen.org/publication/PubMed/28520920" } ] }, { "start_pos": 88, "end_pos": 88, "sequence_org": "D", "sequence_mut": "A", "comment": "Abolishes methyltransferase activity.", "evidence": [ { "database": "UniProtKB", "id": "P0DPD7", "url": "https://www.uniprot.org/uniprot/P0DPD7" }, { "database": "PubMed", "id": "28520920", "url": "https://glygen.org/publication/PubMed/28520920" } ] } ], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P0DPD7", "url": "https://www.uniprot.org/uniprot/P0DPD7" } ], "common_name": "Human" } ], "gene": [ { "name": "EEF1AKMT4", "url": "https://www.uniprot.org/uniprot/P0DPD7", "locus": { "chromosome": "3", "start_pos": 184258759, "end_pos": 184249672, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000284753", "url": "https://www.ensembl.org/id/ENSG00000284753" } ] } } ], "crossref": [ { "id": "ENSG00000284753", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000284753", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd02440", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd02440", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "EEF1AKMT4", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=EEF1AKMT4", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "110599564", "url": "https://www.ncbi.nlm.nih.gov/gene/110599564", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "53611", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=53611", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "IPR013216", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013216", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR029063", "url": "https://www.ebi.ac.uk/interpro/entry/IPR029063", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:110599564", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:110599564", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "610145", "url": "http://www.omim.org/entry/610145", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_P0DPD7", "url": "https://www.nextprot.org/entry/NX_P0DPD7", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "P0DPD7", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P0DPD7", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "HYFLYVM", "url": "https://omabrowser.org/oma/group/HYFLYVM/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "202716at2759", "url": "http://www.orthodb.org/?query=202716at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR12176", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12176", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR12176:SF80", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12176:SF80", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "2PXX", "url": "https://www.rcsb.org/structure/2PXX", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF08241", "url": "http://pfam.xfam.org/family/PF08241", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_P0DPD7", "url": "http://purl.obolibrary.org/obo/PR_P0DPD7", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_115707", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_115707", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "51736", "url": "https://www.rhea-db.org/rhea/51736", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "54196", "url": "https://www.rhea-db.org/rhea/54196", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "54200", "url": "https://www.rhea-db.org/rhea/54200", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "P0DPD7", "url": "https://www.uniprot.org/uniprot/P0DPD7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P0DPD7-4", "url": "https://www.uniprot.org/uniprot/P0DPD7-4", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MASPGAGRAPPELPERNCGYREVEYWDQRYQGAADSAPYDWFGDFSSFRALLEPELRPEDRILVLGCGNSALSYELFLGGFPNVTSVDYSSVVVAAMQARHAHVPQLRWETMDVRKLDFPSASFDVVLEKGTLDALLAGERDPWTVSSEGVHTVDQVLSEVSRVLVPGGRFISMTSAAPHFRTRHYAQAYYGWSLRHATYGSGFHFHLYLMHKGGKLSVAQLALGAQILSPPRPPTSPCFLQDSDHEDFLSAIQL", "length": 255, "header": "sp|P0DPD7-4|EFMT4_HUMAN Isoform 4 of EEF1A lysine methyltransferase 4 OS=Homo sapiens OX=9606 GN=EEF1AKMT4 PE=1 SV=1 CANONICAL=P0DPD7-4" }, "isoforms": [ { "isoform_ac": "P0DPD7-4", "url": "", "sequence": { "sequence": "MASPGAGRAPPELPERNCGYREVEYWDQRYQGAADSAPYDWFGDFSSFRALLEPELRPEDRILVLGCGNSALSYELFLGGFPNVTSVDYSSVVVAAMQARHAHVPQLRWETMDVRKLDFPSASFDVVLEKGTLDALLAGERDPWTVSSEGVHTVDQVLSEVSRVLVPGGRFISMTSAAPHFRTRHYAQAYYGWSLRHATYGSGFHFHLYLMHKGGKLSVAQLALGAQILSPPRPPTSPCFLQDSDHEDFLSAIQL", "length": 255, "header": "sp|P0DPD7-4|EFMT4_HUMAN Isoform 4 of EEF1A lysine methyltransferase 4 OS=Homo sapiens OX=9606 GN=EEF1AKMT4 PE=1 SV=1 CANONICAL=P0DPD7-4" }, "locus": { "chromosome": "3", "start_pos": 184258572, "end_pos": 184249695, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000324557.9", "url": "https://www.ensembl.org/id/ENST00000324557.9" }, { "database": "Ensembl Peptide", "id": "ENSP00000314295.5", "url": "https://www.ensembl.org/id/ENSP00000314295.5" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "evidence": [ { "id": "P0DPD7", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P0DPD7" }, { "id": "28510447", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28510447" } ] } ], "phosphorylation": [ { "start_pos": 39, "end_pos": 39, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine", "evidence": [ { "database": "UniProtKB", "id": "P0DPD7", "url": "https://www.uniprot.org/uniprot/P0DPD7" }, { "database": "PubMed", "id": "15592455", "url": "https://glygen.org/publication/PubMed/15592455" }, { "database": "iPTMnet", "id": "P0DPD7", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P0DPD7" } ], "site_lbl": "Tyr39" } ], "glycation": [], "keywords": [ "enzyme", "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.", "journal": "Nature biotechnology", "date": "2005", "authors": "Rush J, Moritz A, Lee KA, Guo A, Goss VL, Spek EJ, Zhang H, Zha XM, Polakiewicz RD, Comb MJ", "evidence": [ { "database": "UniProtKB", "id": "P0DPD7", "url": "https://www.uniprot.org/uniprot/P0DPD7" }, { "database": "iPTMnet", "id": "P0DPD7-4", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P0DPD7-4" } ], "reference": [ { "type": "PubMed", "id": "15592455", "url": "https://glygen.org/publication/PubMed/15592455" } ] }, { "title": "An intact SAM-dependent methyltransferase fold is encoded by the human endothelin-converting enzyme-2 gene.", "journal": "Proteins", "date": "2009", "authors": "Tempel W, Wu H, Dombrovsky L, Zeng H, Loppnau P, Zhu H, Plotnikov AN, Bochkarev A", "evidence": [ { "database": "UniProtKB", "id": "P0DPD7", "url": "https://www.uniprot.org/uniprot/P0DPD7" } ], "reference": [ { "type": "PubMed", "id": "19089949", "url": "https://glygen.org/publication/PubMed/19089949" } ] }, { "title": "Synthesis of a Highly Azide-Reactive and Thermosensitive Biofunctional Reagent for Efficient Enrichment and Large-Scale Identification of O-GlcNAc Proteins by Mass Spectrometry.", "journal": "Analytical chemistry", "date": "2017", "authors": "Zhang W, Liu T, Dong H, Bai H, Tian F, Shi Z, Chen M, Wang J, Qin W, Qian X", "evidence": [ { "database": "O-GlcNAc Database", "id": "P0DPD7", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P0DPD7" } ], "reference": [ { "type": "PubMed", "id": "28510447", "url": "https://glygen.org/publication/PubMed/28510447" } ] }, { "title": "Methylation of human eukaryotic elongation factor alpha (eEF1A) by a member of a novel protein lysine methyltransferase family modulates mRNA translation.", "journal": "Nucleic acids research", "date": "2017", "authors": "Jakobsson ME, Malecki J, Nilges BS, Moen A, Leidel SA, Falnes PO", "evidence": [ { "database": "UniProtKB", "id": "P0DPD7", "url": "https://www.uniprot.org/uniprot/P0DPD7" }, { "database": "RefSeq", "id": "NP_115707", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_115707" } ], "reference": [ { "type": "PubMed", "id": "28520920", "url": "https://glygen.org/publication/PubMed/28520920" } ] } ], "pathway": [ { "id": "hsa:110599564", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:110599564", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "D4ADU7-1", "protein_name": "EEF1A lysine methyltransferase 4", "gene_name": "Eef1akmt4", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MASPRTPVSPPELPERNLQYRQVQYWDQRYKDAADSGPYEWFGDFASFRALLEPELCPEDRILVLGCGNSALSYELFLGGFPNVTSVDYSPVVVAAMQVRYAHVPSLRWETMDIRALDFPSGSFDVVLEKGTLDALLAGEPDPWNVSSEGVHTVDQVLSEVSRVLVPGGRFISMTPAGPHFRIRHYAQPCYDWSLRHTTYSSGFHFHFYVMHKGRELTVSQLALGAQILSPPSPPAPPCFLQDSDNEDFLSAIQL", "length": 255 }, "evidence": [ { "id": "P0DPD7", "url": "https://omabrowser.org/oma/group/P0DPD7/", "database": "OMA" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "P0DPE0-1", "protein_name": "EEF1A lysine methyltransferase 4", "gene_name": "Eef1akmt4", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MASPRTPVSPPELPEKNFQYRQVQYWDQRYKDAADSGPYEWFGDFASFRALLEPELCPEDRILVLGCGNSALSYELFLGGFPNVTSVDYSPVVVAAMQVRYAHVPSLRWETMDVRALDFPSGSFDVVLEKGTLDAMLAGEPDPWNVSSEGVHTVDQVLSEVSRLLVPGGRFISMTSAGPHFRIRHYAQSRYDWSLRHTTYSSGFHFHFYIMHKGRALSVSQLALGAQILSSPSPPASPCFLQDSDNEDFLSAIQL", "length": 255 }, "evidence": [ { "id": "45927043", "url": "http://www.informatics.jax.org/homology/45927043", "database": "MGI" }, { "id": "P0DPD7", "url": "https://omabrowser.org/oma/group/P0DPD7/", "database": "OMA" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "methyltransferase activity", "id": "GO:0008168", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008168", "evidence": [ { "database": "UniProtKB", "id": "P0DPD7", "url": "https://www.uniprot.org/uniprot/P0DPD7" } ], "pmid": "" }, { "name": "protein-lysine N-methyltransferase activity", "id": "GO:0016279", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016279", "evidence": [ { "database": "UniProtKB", "id": "P0DPD7", "url": "https://www.uniprot.org/uniprot/P0DPD7" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "methylation", "id": "GO:0032259", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032259", "evidence": [ { "database": "UniProtKB", "id": "P0DPD7", "url": "https://www.uniprot.org/uniprot/P0DPD7" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 83, "end_pos": 85, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "51736", "name": "", "equation": "L-lysyl-[protein] + S-adenosyl-L-methionine = H(+) + N(6)-methyl-L-lysyl-[protein] + S-adenosyl-L-homocysteine", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P0C6Y7-1", "D3ZSK5-1", "Q7M6Z3-1", "A0A0G2JTW4-1", "A0A0G2JW37-1", "D3ZEB9-1", "M0R767-1", "D4ADE5-1", "A0A8I6AL52-1", "Q8N6R0-5", "Q9NQV7-1", "Q9BYW2-1", "P0DPD7-4", "Q9NQR1-1", "Q9NRG4-1", "Q96AZ1-1", "Q8TBK2-1", "Q8WTS6-1", "Q5VZV1-1", "Q91YR5-3", "Q96EQ9-1", "E9Q5F9-1", "P0DPE0-1", "D3YWP0-1", "Q9CWY3-1", "Q2YDW7-1", "Q8R5A0-1", "Q8VHL1-1", "Q8BLU2-1", "Q54J80-1", "Q9VIK9-1" ], "evidence": [ { "id": "51736", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/51736" } ] }, { "id": "54196", "name": "", "equation": "N(6)-methyl-L-lysyl-[protein] + S-adenosyl-L-methionine = H(+) + N(6),N(6)-dimethyl-L-lysyl-[protein] + S-adenosyl-L-homocysteine", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P0C6Y7-1", "Q8N6R0-5", "Q9NQV7-1", "P0DPD7-4", "Q96AZ1-1", "Q5VZV1-1", "Q91YR5-3", "P0DPE0-1", "D3YWP0-1", "Q8BLU2-1", "Q9VIK9-1" ], "evidence": [ { "id": "54196", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/54196" } ] }, { "id": "54200", "name": "", "equation": "N(6),N(6)-dimethyl-L-lysyl-[protein] + S-adenosyl-L-methionine = H(+) + N(6),N(6),N(6)-trimethyl-L-lysyl-[protein] + S-adenosyl-L-homocysteine", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P0DPD7-4", "Q96AZ1-1", "Q5VZV1-1", "Q96EQ9-1", "P0DPE0-1", "D3YWP0-1", "Q8BLU2-1" ], "evidence": [ { "id": "54200", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/54200" } ] } ], "reaction_participants": [], "reaction_enzymes": [ { "uniprot_ac": "A0A0G2JTW4", "gene_name": "AABR07010705.1", "activity": [ { "ec_number": "2.1.1.361", "activity": "L-lysyl(20)-[histone H4] + S-adenosyl-L-methionine = H(+) + N(6)-methyl-L-lysyl(20)-[histone H4] + S-adenosyl-L-homocysteine.", "evidence": [ { "id": "A0A0G2JTW4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2JTW4" } ] }, { "ec_number": "2.1.1.361", "activity": "", "evidence": [ { "id": "A0A0G2JTW4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2JTW4" } ] } ] }, { "uniprot_ac": "A0A0G2JW37", "gene_name": "RGD1561318", "activity": [ { "ec_number": "2.1.1.361", "activity": "L-lysyl(20)-[histone H4] + S-adenosyl-L-methionine = H(+) + N(6)-methyl-L-lysyl(20)-[histone H4] + S-adenosyl-L-homocysteine.", "evidence": [ { "id": "A0A0G2JW37", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2JW37" } ] }, { "ec_number": "2.1.1.361", "activity": "", "evidence": [ { "id": "A0A0G2JW37", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2JW37" } ] } ] }, { "uniprot_ac": "A0A8I6AL52", "gene_name": "ENSRNOG00000067141", "activity": [ { "ec_number": "2.1.1.361", "activity": "L-lysyl(20)-[histone H4] + S-adenosyl-L-methionine = H(+) + N(6)-methyl-L-lysyl(20)-[histone H4] + S-adenosyl-L-homocysteine.", "evidence": [ { "id": "A0A8I6AL52", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I6AL52" } ] }, { "ec_number": "2.1.1.361", "activity": "", "evidence": [ { "id": "A0A8I6AL52", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I6AL52" } ] } ] }, { "uniprot_ac": "D3YWP0", "gene_name": "Eef1akmt3", "activity": [ { "ec_number": "2.1.1.-", "activity": "", "evidence": [ { "id": "D3YWP0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3YWP0" } ] } ] }, { "uniprot_ac": "D3ZEB9", "gene_name": "Kmt5a", "activity": [ { "ec_number": "2.1.1.361", "activity": "L-lysyl(20)-[histone H4] + S-adenosyl-L-methionine = H(+) + N(6)-methyl-L-lysyl(20)-[histone H4] + S-adenosyl-L-homocysteine.", "evidence": [ { "id": "D3ZEB9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZEB9" } ] }, { "ec_number": "2.1.1.361", "activity": "", "evidence": [ { "id": "D3ZEB9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZEB9" } ] } ] }, { "uniprot_ac": "D3ZSK5", "gene_name": "Setd6", "activity": [ { "ec_number": "2.1.1.-", "activity": "", "evidence": [ { "id": "D3ZSK5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZSK5" } ] } ] }, { "uniprot_ac": "D4ADE5", "gene_name": "Setd7", "activity": [ { "ec_number": "2.1.1.364", "activity": "L-lysyl(4)-[histone H3] + S-adenosyl-L-methionine = H(+) + N(6)-methyl-L-lysyl(4)-[histone H3] + S-adenosyl-L-homocysteine.", "evidence": [ { "id": "D4ADE5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D4ADE5" } ] }, { "ec_number": "2.1.1.364", "activity": "", "evidence": [ { "id": "D4ADE5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D4ADE5" } ] }, { "ec_number": "2.1.1.-", "activity": "", "evidence": [ { "id": "D4ADE5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D4ADE5" } ] } ] }, { "uniprot_ac": "E9Q5F9", "gene_name": "Setd2", "activity": [ { "ec_number": "2.1.1.359", "activity": "L-lysyl(36)-[histone H3] + 3 S-adenosyl-L-methionine = 3 H(+) + N(6),N(6),N(6)-trimethyl-L-lysyl(36)-[histone H3] + 3 S-adenosyl-L-homocysteine.", "evidence": [ { "id": "E9Q5F9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/E9Q5F9" } ] }, { "ec_number": "2.1.1.-", "activity": "", "evidence": [ { "id": "E9Q5F9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/E9Q5F9" } ] }, { "ec_number": "2.1.1.359", "activity": "", "evidence": [ { "id": "E9Q5F9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/E9Q5F9" } ] } ] }, { "uniprot_ac": "M0R767", "gene_name": "AABR07033047.1", "activity": [ { "ec_number": "2.1.1.361", "activity": "L-lysyl(20)-[histone H4] + S-adenosyl-L-methionine = H(+) + N(6)-methyl-L-lysyl(20)-[histone H4] + S-adenosyl-L-homocysteine.", "evidence": [ { "id": "M0R767", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/M0R767" } ] }, { "ec_number": "2.1.1.361", "activity": "", "evidence": [ { "id": "M0R767", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/M0R767" } ] } ] }, { "uniprot_ac": "P0C6Y7", "gene_name": "Prdm9", "activity": [ { "ec_number": "2.1.1.359", "activity": "L-lysyl(36)-[histone H3] + 3 S-adenosyl-L-methionine = 3 H(+) + N(6),N(6),N(6)-trimethyl-L-lysyl(36)-[histone H3] + 3 S-adenosyl-L-homocysteine.", "evidence": [ { "id": "P0C6Y7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C6Y7" } ] }, { "ec_number": "2.1.1.-", "activity": "", "evidence": [ { "id": "P0C6Y7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C6Y7" } ] }, { "ec_number": "2.1.1.355", "activity": "L-lysyl(9)-[histone H3] + 3 S-adenosyl-L-methionine = 3 H(+) + N(6),N(6),N(6)-trimethyl-L-lysyl(9)-[histone H3] + 3 S-adenosyl-L-homocysteine.", "evidence": [ { "id": "P0C6Y7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C6Y7" } ] }, { "ec_number": "2.1.1.354", "activity": "L-lysyl(4)-[histone H3] + 3 S-adenosyl-L-methionine = 3 H(+) + N(6),N(6),N(6)-trimethyl-L-lysyl(4)-[histone H3] + 3 S-adenosyl-L-homocysteine.", "evidence": [ { "id": "P0C6Y7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C6Y7" } ] }, { "ec_number": "2.1.1.362", "activity": "N(6)-methyl-L-lysyl(20)-[histone H4] + S-adenosyl-L-methionine = H(+) + N(6),N(6)-dimethyl-L-lysyl(20)-[histone H4] + S-adenosyl-L-homocysteine.", "evidence": [ { "id": "P0C6Y7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C6Y7" } ] }, { "ec_number": "2.1.1.361", "activity": "L-lysyl(20)-[histone H4] + S-adenosyl-L-methionine = H(+) + N(6)-methyl-L-lysyl(20)-[histone H4] + S-adenosyl-L-homocysteine.", "evidence": [ { "id": "P0C6Y7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C6Y7" } ] } ] }, { "uniprot_ac": "P0DPD7", "gene_name": "EEF1AKMT4", "activity": [ { "ec_number": "2.1.1.-", "activity": "", "evidence": [ { "id": "P0DPD7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0DPD7" } ] } ] }, { "uniprot_ac": "P0DPE0", "gene_name": "Eef1akmt4", "activity": [ { "ec_number": "2.1.1.-", "activity": "", "evidence": [ { "id": "P0DPE0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0DPE0" } ] } ] }, { "uniprot_ac": "Q2YDW7", "gene_name": "Kmt5a", "activity": [ { "ec_number": "2.1.1.361", "activity": "L-lysyl(20)-[histone H4] + S-adenosyl-L-methionine = H(+) + N(6)-methyl-L-lysyl(20)-[histone H4] + S-adenosyl-L-homocysteine.", "evidence": [ { "id": "Q2YDW7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q2YDW7" } ] }, { "ec_number": "2.1.1.361", "activity": "", "evidence": [ { "id": "Q2YDW7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q2YDW7" } ] }, { "ec_number": "2.1.1.-", "activity": "", "evidence": [ { "id": "Q2YDW7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q2YDW7" } ] } ] }, { "uniprot_ac": "Q54J80", "gene_name": "", "activity": [ { "ec_number": "2.1.1.364", "activity": "L-lysyl(4)-[histone H3] + S-adenosyl-L-methionine = H(+) + N(6)-methyl-L-lysyl(4)-[histone H3] + S-adenosyl-L-homocysteine.", "evidence": [ { "id": "Q54J80", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54J80" } ] }, { "ec_number": "2.1.1.364", "activity": "", "evidence": [ { "id": "Q54J80", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54J80" } ] } ] }, { "uniprot_ac": "Q5VZV1", "gene_name": "METTL21C", "activity": [ { "ec_number": "2.1.1.-", "activity": "", "evidence": [ { "id": "Q5VZV1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5VZV1" } ] } ] }, { "uniprot_ac": "Q7M6Z3", "gene_name": "Smyd2", "activity": [ { "ec_number": "2.1.1.-", "activity": "", "evidence": [ { "id": "Q7M6Z3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7M6Z3" } ] }, { "ec_number": "2.1.1.354", "activity": "L-lysyl(4)-[histone H3] + 3 S-adenosyl-L-methionine = 3 H(+) + N(6),N(6),N(6)-trimethyl-L-lysyl(4)-[histone H3] + 3 S-adenosyl-L-homocysteine.", "evidence": [ { "id": "Q7M6Z3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7M6Z3" } ] } ] }, { "uniprot_ac": "Q8BLU2", "gene_name": "Mettl21c", "activity": [ { "ec_number": "2.1.1.-", "activity": "", "evidence": [ { "id": "Q8BLU2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BLU2" } ] } ] }, { "uniprot_ac": "Q8N6R0", "gene_name": "METTL13", "activity": [ { "ec_number": "2.1.1.-", "activity": "", "evidence": [ { "id": "Q8N6R0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8N6R0" } ] } ] }, { "uniprot_ac": "Q8R5A0", "gene_name": "Smyd2", "activity": [ { "ec_number": "2.1.1.-", "activity": "", "evidence": [ { "id": "Q8R5A0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8R5A0" } ] }, { "ec_number": "2.1.1.354", "activity": "L-lysyl(4)-[histone H3] + 3 S-adenosyl-L-methionine = 3 H(+) + N(6),N(6),N(6)-trimethyl-L-lysyl(4)-[histone H3] + 3 S-adenosyl-L-homocysteine.", "evidence": [ { "id": "Q8R5A0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8R5A0" } ] } ] }, { "uniprot_ac": "Q8TBK2", "gene_name": "SETD6", "activity": [ { "ec_number": "2.1.1.-", "activity": "", "evidence": [ { "id": "Q8TBK2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8TBK2" } ] } ] }, { "uniprot_ac": "Q8VHL1", "gene_name": "Setd7", "activity": [ { "ec_number": "2.1.1.364", "activity": "L-lysyl(4)-[histone H3] + S-adenosyl-L-methionine = H(+) + N(6)-methyl-L-lysyl(4)-[histone H3] + S-adenosyl-L-homocysteine.", "evidence": [ { "id": "Q8VHL1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VHL1" } ] }, { "ec_number": "2.1.1.364", "activity": "", "evidence": [ { "id": "Q8VHL1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VHL1" } ] } ] }, { "uniprot_ac": "Q8WTS6", "gene_name": "SETD7", "activity": [ { "ec_number": "2.1.1.364", "activity": "L-lysyl(4)-[histone H3] + S-adenosyl-L-methionine = H(+) + N(6)-methyl-L-lysyl(4)-[histone H3] + S-adenosyl-L-homocysteine.", "evidence": [ { "id": "Q8WTS6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8WTS6" } ] }, { "ec_number": "2.1.1.364", "activity": "", "evidence": [ { "id": "Q8WTS6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8WTS6" } ] } ] }, { "uniprot_ac": "Q91YR5", "gene_name": "Mettl13", "activity": [ { "ec_number": "2.1.1.-", "activity": "", "evidence": [ { "id": "Q91YR5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91YR5" } ] } ] }, { "uniprot_ac": "Q96AZ1", "gene_name": "EEF1AKMT3", "activity": [ { "ec_number": "2.1.1.-", "activity": "", "evidence": [ { "id": "Q96AZ1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96AZ1" } ] } ] }, { "uniprot_ac": "Q96EQ9", "gene_name": "Prdm9", "activity": [ { "ec_number": "2.1.1.43", "activity": "", "evidence": [ { "id": "Q96EQ9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96EQ9" } ] }, { "ec_number": "2.1.1.359", "activity": "L-lysyl(36)-[histone H3] + 3 S-adenosyl-L-methionine = 3 H(+) + N(6),N(6),N(6)-trimethyl-L-lysyl(36)-[histone H3] + 3 S-adenosyl-L-homocysteine.", "evidence": [ { "id": "Q96EQ9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96EQ9" } ] }, { "ec_number": "2.1.1.-", "activity": "", "evidence": [ { "id": "Q96EQ9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96EQ9" } ] }, { "ec_number": "2.1.1.355", "activity": "L-lysyl(9)-[histone H3] + 3 S-adenosyl-L-methionine = 3 H(+) + N(6),N(6),N(6)-trimethyl-L-lysyl(9)-[histone H3] + 3 S-adenosyl-L-homocysteine.", "evidence": [ { "id": "Q96EQ9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96EQ9" } ] }, { "ec_number": "2.1.1.354", "activity": "L-lysyl(4)-[histone H3] + 3 S-adenosyl-L-methionine = 3 H(+) + N(6),N(6),N(6)-trimethyl-L-lysyl(4)-[histone H3] + 3 S-adenosyl-L-homocysteine.", "evidence": [ { "id": "Q96EQ9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96EQ9" } ] }, { "ec_number": "2.1.1.362", "activity": "N(6)-methyl-L-lysyl(20)-[histone H4] + S-adenosyl-L-methionine = H(+) + N(6),N(6)-dimethyl-L-lysyl(20)-[histone H4] + S-adenosyl-L-homocysteine.", "evidence": [ { "id": "Q96EQ9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96EQ9" } ] }, { "ec_number": "2.1.1.361", "activity": "L-lysyl(20)-[histone H4] + S-adenosyl-L-methionine = H(+) + N(6)-methyl-L-lysyl(20)-[histone H4] + S-adenosyl-L-homocysteine.", "evidence": [ { "id": "Q96EQ9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96EQ9" } ] } ] }, { "uniprot_ac": "Q9BYW2", "gene_name": "SETD2", "activity": [ { "ec_number": "2.1.1.359", "activity": "L-lysyl(36)-[histone H3] + 3 S-adenosyl-L-methionine = 3 H(+) + N(6),N(6),N(6)-trimethyl-L-lysyl(36)-[histone H3] + 3 S-adenosyl-L-homocysteine.", "evidence": [ { "id": "Q9BYW2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BYW2" } ] }, { "ec_number": "2.1.1.359", "activity": "", "evidence": [ { "id": "Q9BYW2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BYW2" } ] }, { "ec_number": "2.1.1.-", "activity": "", "evidence": [ { "id": "Q9BYW2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BYW2" } ] } ] }, { "uniprot_ac": "Q9CWY3", "gene_name": "Setd6", "activity": [ { "ec_number": "2.1.1.-", "activity": "", "evidence": [ { "id": "Q9CWY3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9CWY3" } ] } ] }, { "uniprot_ac": "Q9NQR1", "gene_name": "KMT5A", "activity": [ { "ec_number": "2.1.1.-", "activity": "", "evidence": [ { "id": "Q9NQR1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NQR1" } ] }, { "ec_number": "2.1.1.361", "activity": "L-lysyl(20)-[histone H4] + S-adenosyl-L-methionine = H(+) + N(6)-methyl-L-lysyl(20)-[histone H4] + S-adenosyl-L-homocysteine.", "evidence": [ { "id": "Q9NQR1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NQR1" } ] }, { "ec_number": "2.1.1.361", "activity": "", "evidence": [ { "id": "Q9NQR1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NQR1" } ] } ] }, { "uniprot_ac": "Q9NQV7", "gene_name": "PRDM9", "activity": [ { "ec_number": "2.1.1.359", "activity": "L-lysyl(36)-[histone H3] + 3 S-adenosyl-L-methionine = 3 H(+) + N(6),N(6),N(6)-trimethyl-L-lysyl(36)-[histone H3] + 3 S-adenosyl-L-homocysteine.", "evidence": [ { "id": "Q9NQV7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NQV7" } ] }, { "ec_number": "2.1.1.-", "activity": "", "evidence": [ { "id": "Q9NQV7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NQV7" } ] }, { "ec_number": "2.1.1.355", "activity": "L-lysyl(9)-[histone H3] + 3 S-adenosyl-L-methionine = 3 H(+) + N(6),N(6),N(6)-trimethyl-L-lysyl(9)-[histone H3] + 3 S-adenosyl-L-homocysteine.", "evidence": [ { "id": "Q9NQV7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NQV7" } ] }, { "ec_number": "2.1.1.354", "activity": "L-lysyl(4)-[histone H3] + 3 S-adenosyl-L-methionine = 3 H(+) + N(6),N(6),N(6)-trimethyl-L-lysyl(4)-[histone H3] + 3 S-adenosyl-L-homocysteine.", "evidence": [ { "id": "Q9NQV7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NQV7" } ] }, { "ec_number": "2.1.1.362", "activity": "N(6)-methyl-L-lysyl(20)-[histone H4] + S-adenosyl-L-methionine = H(+) + N(6),N(6)-dimethyl-L-lysyl(20)-[histone H4] + S-adenosyl-L-homocysteine.", "evidence": [ { "id": "Q9NQV7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NQV7" } ] }, { "ec_number": "2.1.1.361", "activity": "L-lysyl(20)-[histone H4] + S-adenosyl-L-methionine = H(+) + N(6)-methyl-L-lysyl(20)-[histone H4] + S-adenosyl-L-homocysteine.", "evidence": [ { "id": "Q9NQV7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NQV7" } ] } ] }, { "uniprot_ac": "Q9NRG4", "gene_name": "SMYD2", "activity": [ { "ec_number": "2.1.1.-", "activity": "", "evidence": [ { "id": "Q9NRG4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NRG4" } ] }, { "ec_number": "2.1.1.354", "activity": "L-lysyl(4)-[histone H3] + 3 S-adenosyl-L-methionine = 3 H(+) + N(6),N(6),N(6)-trimethyl-L-lysyl(4)-[histone H3] + 3 S-adenosyl-L-homocysteine.", "evidence": [ { "id": "Q9NRG4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NRG4" } ] } ] }, { "uniprot_ac": "Q9VIK9", "gene_name": "", "activity": [ { "ec_number": "2.1.1.-", "activity": "", "evidence": [ { "id": "Q9VIK9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VIK9" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.oma", "label": "OMA Homologs" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [ 39 ], "sequon_annotation_sites": [ { "start_pos": 83, "end_pos": 85 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }