{ "uniprot_canonical_ac": "P0DMN0-1", "uniprot_ac": "P0DMN0", "uniprot_id": "ST1A4_HUMAN", "mass": { "chemical_mass": 34196.0, "monoisotopic_mass": 34196.0 }, "refseq": { "ac": "NP_001017390", "name": "sulfotransferase 1A4", "summary": "Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. This gene encodes a phenol sulfotransferase with thermolabile enzyme activity. Four sulfotransferase genes are located on the p arm of chromosome 16, this gene and SULT1A3 arose from a segmental duplication. Read-through transcription exists between this gene and the upstream SLX1B (SLX1 structure-specific endonuclease subunit homolog B) gene that encodes a protein containing GIY-YIG domains. [provided by RefSeq, Nov 2010].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001017390" }, "gene_names": [ { "name": "SULT1A4", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P0DMN0", "id": "P0DMN0" }, { "name": "HAST3; M-PST; ST1A3; ST1A3/ST1A4; ST1A4; STM; TL-PST", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001017390", "id": "NP_001017390" }, { "name": "SULT1A4", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001017390", "id": "NP_001017390" } ], "protein_names": [ { "name": "Sulfotransferase 1A4", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P0DMN0" }, { "name": "2.8.2.1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P0DMN0" }, { "name": "Aryl sulfotransferase 1A3/1A4", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P0DMN0" }, { "name": "ST1A4", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P0DMN0" }, { "name": "Sulfotransferase 1A3/1A4", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P0DMN0" }, { "name": "sulfokinase; aryl sulfotransferase 1A3/1A4; placental estrogen sulfotransferase; thermolabile phenol sulfotransferase; sulfotransferase, monoamine-preferring; monoamine-sulfating phenol sulfotransferase; catecholamine-sulfating phenol sulfotransferase; SLX1B-SULT1A4; sulfotransferase family, cytosolic, 1A, phenol-preferring, member 4; Sulfotransferase 1A3", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001017390", "id": "NP_001017390" }, { "name": "sulfotransferase 1A4", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001017390", "id": "NP_001017390" } ], "function": [ { "annotation": "Effects of human SULT1A3/SULT1A4 genetic polymorphisms on the sulfation of acetaminophen and opioid drugs by the cytosolic sulfotransferase SULT1A3", "evidence": [ { "database": "RefSeq", "id": "NP_001017390", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001017390" }, { "database": "PubMed", "id": "29705271", "url": "https://glygen.org/publication/PubMed/29705271" } ] }, { "annotation": "Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. This gene encodes a phenol sulfotransferase with thermolabile enzyme activity. Four sulfotransferase genes are located on the p arm of chromosome 16, this gene and SULT1A3 arose from a segmental duplication. Read-through transcription exists between this gene and the upstream SLX1B (SLX1 structure-specific endonuclease subunit homolog B) gene that encodes a protein containing GIY-YIG domains. [provided by RefSeq, Nov 2010].", "evidence": [ { "database": "RefSeq", "id": "NP_001017390", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001017390" } ] }, { "annotation": "Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfate conjugation of phenolic monoamines (neurotransmitters such as dopamine, norepinephrine and serotonin) and phenolic and catechol drugs.", "evidence": [ { "database": "UniProtKB", "id": "P0DMN0", "url": "https://www.uniprot.org/uniprot/P0DMN0#function" } ] }, { "annotation": "The results obtained showed clearly the differential enzymatic characteristics of SULT1A3 allozymes in mediating the sulfation of phenylephrine and salbutamol. This information may contribute toward a better understanding of the pharmacokinetics of these two drugs in individuals with distinct SULT1A3 and/or SULT1A4 genotypes.", "evidence": [ { "database": "RefSeq", "id": "NP_001017390", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001017390" }, { "database": "PubMed", "id": "31145702", "url": "https://glygen.org/publication/PubMed/31145702" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "87.22", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000213648", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000213648" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "75.29", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000213648", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000213648" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "92.16", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000213648", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000213648" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "93.63", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000213648", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000213648" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "84.92", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000213648", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000213648" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "86.79", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000213648", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000213648" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "73.58", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000213648", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000213648" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "82.24", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000213648", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000213648" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "86.33", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000213648", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000213648" } ] } ], "expression_disease": [ { "significant": "No", "trend": "down", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "P0DMN0", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P0DMN0" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "No", "trend": "down", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "P0DMN0", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P0DMN0" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "P0DMN0", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P0DMN0" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "P0DMN0", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P0DMN0" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "P0DMN0", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P0DMN0" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "P0DMN0", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P0DMN0" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "P0DMN0", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P0DMN0" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "No", "trend": "down", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "P0DMN0", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P0DMN0" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P0DMN0", "url": "https://www.uniprot.org/uniprot/P0DMN0" } ], "common_name": "Human" } ], "gene": [ { "name": "SULT1A4", "url": "https://www.uniprot.org/uniprot/P0DMN0", "locus": { "chromosome": "16", "start_pos": 29464966, "end_pos": 29459913, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000213648", "url": "https://www.ensembl.org/id/ENSG00000213648" } ] } } ], "crossref": [ { "id": "ENSG00000213648", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000213648", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "2.8.2.1", "url": "https://www.brenda-enzymes.org/enzyme.php?ecno=2.8.2.1&UniProtAcc=P0DMN0", "database": "BRENDA", "categories": [ "Enzyme and Pathway" ] }, { "id": "SULT1A4", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=SULT1A4", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "445329", "url": "https://www.ncbi.nlm.nih.gov/gene/445329", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "6818", "url": "https://www.ncbi.nlm.nih.gov/gene/6818", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "30004", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=30004", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "IPR000863", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000863", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR027417", "url": "https://www.ebi.ac.uk/interpro/entry/IPR027417", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:445329", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:445329", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "hsa:6818", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:6818", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "615819", "url": "http://www.omim.org/entry/615819", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_P0DMN0", "url": "https://www.nextprot.org/entry/NX_P0DMN0", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "P0DMN0", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P0DMN0", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "QMANYTS", "url": "https://omabrowser.org/oma/group/QMANYTS/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "3083090at2759", "url": "http://www.orthodb.org/?query=3083090at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR11783", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11783", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11783:SF308", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11783:SF308", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00685", "url": "http://pfam.xfam.org/family/PF00685", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "P0DMN0", "url": "https://pharos.nih.gov/targets/P0DMN0", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_P0DMN0", "url": "http://purl.obolibrary.org/obo/PR_P0DMN0", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-156584", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156584", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001017390", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001017390", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "12164", "url": "https://www.rhea-db.org/rhea/12164", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "P0DMN0", "url": "https://www.uniprot.org/uniprot/P0DMN0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P0DMN0-1", "url": "https://www.uniprot.org/uniprot/P0DMN0-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLINTYPKSGTTWVSQILDMIYQGGDLEKCNRAPIYVRVPFLEVNDPGEPSGLETLKDTPPPRLIKSHLPLALLPQTLLDQKVKVVYVARNPKDVAVSYYHFHRMEKAHPEPGTWDSFLEKFMAGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGRSLPEETMDFMVQHTSFKEMKKNPMTNYTTVPQELMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL", "length": 295, "header": "sp|P0DMN0-1|ST1A4_HUMAN Isoform 1 of Sulfotransferase 1A4 OS=Homo sapiens OX=9606 GN=SULT1A4 PE=1 SV=1 CANONICAL=P0DMN0-1" }, "isoforms": [ { "isoform_ac": "P0DMN0-1", "url": "", "sequence": { "sequence": "MELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLINTYPKSGTTWVSQILDMIYQGGDLEKCNRAPIYVRVPFLEVNDPGEPSGLETLKDTPPPRLIKSHLPLALLPQTLLDQKVKVVYVARNPKDVAVSYYHFHRMEKAHPEPGTWDSFLEKFMAGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGRSLPEETMDFMVQHTSFKEMKKNPMTNYTTVPQELMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL", "length": 295, "header": "sp|P0DMN0-1|ST1A4_HUMAN Isoform 1 of Sulfotransferase 1A4 OS=Homo sapiens OX=9606 GN=SULT1A4 PE=1 SV=1 CANONICAL=P0DMN0-1" }, "locus": { "chromosome": "16", "start_pos": 29464572, "end_pos": 29461386, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000360423.12", "url": "https://www.ensembl.org/id/ENST00000360423.12" }, { "database": "Ensembl Peptide", "id": "ENSP00000353600.8", "url": "https://www.ensembl.org/id/ENSP00000353600.8" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "evidence": [ { "id": "P0DMN0", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P0DMN0" }, { "id": "37217939", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37217939" } ] } ], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme", "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "Characterization of human iodothyronine sulfotransferases.", "journal": "The Journal of clinical endocrinology and metabolism", "date": "1999", "authors": "Kester MH, Kaptein E, Roest TJ, van Dijk CH, Tibboel D, Meinl W, Glatt H, Coughtrie MW, Visser TJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-156584", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156584" } ], "reference": [ { "type": "PubMed", "id": "10199779", "url": "https://glygen.org/publication/PubMed/10199779" } ] }, { "title": "Cloning and characterization of a mammalian lithium-sensitive bisphosphate 3'-nucleotidase inhibited by inositol 1,4-bisphosphate.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Spiegelberg BD, Xiong JP, Smith JJ, Gu RF, York JD", "evidence": [ { "database": "Reactome", "id": "R-HSA-156584", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156584" } ], "reference": [ { "type": "PubMed", "id": "10224133", "url": "https://glygen.org/publication/PubMed/10224133" } ] }, { "title": "Sulfotransferase catalyzing sulfation of heterocyclic amines.", "journal": "Cancer letters", "date": "1999", "authors": "Yamazoe Y, Nagata K, Yoshinari K, Fujita K, Shiraga T, Iwasaki K", "evidence": [ { "database": "Reactome", "id": "R-HSA-156584", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156584" } ], "reference": [ { "type": "PubMed", "id": "10503886", "url": "https://glygen.org/publication/PubMed/10503886" } ] }, { "title": "Sulfation of iodothyronines by recombinant human liver steroid sulfotransferases.", "journal": "Biochemical and biophysical research communications", "date": "1999", "authors": "Li X, Anderson RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-156584", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156584" } ], "reference": [ { "type": "PubMed", "id": "10512730", "url": "https://glygen.org/publication/PubMed/10512730" } ] }, { "title": "Contribution of CYP2E1 and CYP3A to acetaminophen reactive metabolite formation.", "journal": "Clinical pharmacology and therapeutics", "date": "2000", "authors": "Manyike PT, Kharasch ED, Kalhorn TF, Slattery JT", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "10741631", "url": "https://glygen.org/publication/PubMed/10741631" } ] }, { "title": "Sulfation of iodothyronines by human sulfotransferase 1C1 (SULT1C1)*.", "journal": "Biochemical pharmacology", "date": "2000", "authors": "Li X, Clemens DL, Anderson RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-156584", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156584" } ], "reference": [ { "type": "PubMed", "id": "11077054", "url": "https://glygen.org/publication/PubMed/11077054" } ] }, { "title": "Sulfotransferases in the bioactivation of xenobiotics.", "journal": "Chemico-biological interactions", "date": "2000", "authors": "Glatt H", "evidence": [ { "database": "Reactome", "id": "R-HSA-156584", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156584" } ], "reference": [ { "type": "PubMed", "id": "11154739", "url": "https://glygen.org/publication/PubMed/11154739" } ] }, { "title": "Expression and characterization of the human 3 beta-hydroxysteroid sulfotransferases (SULT2B1a and SULT2B1b).", "journal": "The Journal of steroid biochemistry and molecular biology", "date": "2001", "authors": "Meloche CA, Falany CN", "evidence": [ { "database": "Reactome", "id": "R-HSA-156584", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156584" } ], "reference": [ { "type": "PubMed", "id": "11457664", "url": "https://glygen.org/publication/PubMed/11457664" } ] }, { "title": "Interindividual variability in acetaminophen glucuronidation by human liver microsomes: identification of relevant acetaminophen UDP-glucuronosyltransferase isoforms.", "journal": "The Journal of pharmacology and experimental therapeutics", "date": "2001", "authors": "Court MH, Duan SX, von Moltke LL, Greenblatt DJ, Patten CJ, Miners JO, Mackenzie PI", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "11714888", "url": "https://glygen.org/publication/PubMed/11714888" } ] }, { "title": "Characterization of human liver thermostable phenol sulfotransferase (SULT1A1) allozymes with 3,3',5-triiodothyronine as the substrate.", "journal": "The Journal of endocrinology", "date": "2001", "authors": "Li X, Clemens DL, Cole JR, Anderson RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-156584", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156584" } ], "reference": [ { "type": "PubMed", "id": "11739018", "url": "https://glygen.org/publication/PubMed/11739018" } ] }, { "title": "Highly conserved mouse and human brain sulfotransferases: molecular cloning, expression, and functional characterization.", "journal": "Gene", "date": "2002", "authors": "Sakakibara Y, Suiko M, Pai TG, Nakayama T, Takami Y, Katafuchi J, Liu MC", "evidence": [ { "database": "Reactome", "id": "R-HSA-156584", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156584" } ], "reference": [ { "type": "PubMed", "id": "12039030", "url": "https://glygen.org/publication/PubMed/12039030" } ] }, { "title": "Mutational analysis of human hydroxysteroid sulfotransferase SULT2B1 isoforms reveals that exon 1B of the SULT2B1 gene produces cholesterol sulfotransferase, whereas exon 1A yields pregnenolone sulfotransferase.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Fuda H, Lee YC, Shimizu C, Javitt NB, Strott CA", "evidence": [ { "database": "Reactome", "id": "R-HSA-156584", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156584" } ], "reference": [ { "type": "PubMed", "id": "12145317", "url": "https://glygen.org/publication/PubMed/12145317" } ] }, { "title": "Sulfonation and molecular action.", "journal": "Endocrine reviews", "date": "2002", "authors": "Strott CA", "evidence": [ { "database": "Reactome", "id": "R-HSA-156584", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156584" } ], "reference": [ { "type": "PubMed", "id": "12372849", "url": "https://glygen.org/publication/PubMed/12372849" } ] }, { "title": "Sequence identification and characterization of human carnosinase and a closely related non-specific dipeptidase.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Teufel M, Saudek V, Ledig JP, Bernhardt A, Boularand S, Carreau A, Cairns NJ, Carter C, Cowley DJ, Duverger D, Ganzhorn AJ, Guenet C, Heintzelmann B, Laucher V, Sauvage C, Smirnova T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "12473676", "url": "https://glygen.org/publication/PubMed/12473676" } ] }, { "title": "Endoglycan, a member of the CD34 family, functions as an L-selectin ligand through modification with tyrosine sulfation and sialyl Lewis x.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Fieger CB, Sassetti CM, Rosen SD", "evidence": [ { "database": "Reactome", "id": "R-HSA-156584", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156584" } ], "reference": [ { "type": "PubMed", "id": "12889478", "url": "https://glygen.org/publication/PubMed/12889478" } ] }, { "title": "Human catecholamine sulfotransferase (SULT1A3) pharmacogenetics: functional genetic polymorphism.", "journal": "Journal of neurochemistry", "date": "2003", "authors": "Thomae BA, Rifki OF, Theobald MA, Eckloff BW, Wieben ED, Weinshilboum RM", "evidence": [ { "database": "UniProtKB", "id": "P0DMN0", "url": "https://www.uniprot.org/uniprot/P0DMN0" }, { "database": "Reactome", "id": "R-HSA-156584", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156584" } ], "reference": [ { "type": "PubMed", "id": "14622112", "url": "https://glygen.org/publication/PubMed/14622112" } ] }, { "title": "The crystal structure of CCG1/TAF(II)250-interacting factor B (CIB).", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Padmanabhan B, Kuzuhara T, Adachi N, Horikoshi M", "evidence": [ { "database": "Reactome", "id": "R-HSA-156584", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156584" } ], "reference": [ { "type": "PubMed", "id": "14672934", "url": "https://glygen.org/publication/PubMed/14672934" } ] }, { "title": "Human SULT1A3 pharmacogenetics: gene duplication and functional genomic studies.", "journal": "Biochemical and biophysical research communications", "date": "2004", "authors": "Hildebrandt MA, Salavaggione OE, Martin YN, Flynn HC, Jalal S, Wieben ED, Weinshilboum RM", "evidence": [ { "database": "UniProtKB", "id": "P0DMN0", "url": "https://www.uniprot.org/uniprot/P0DMN0" }, { "database": "Reactome", "id": "R-HSA-156584", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156584" } ], "reference": [ { "type": "PubMed", "id": "15358107", "url": "https://glygen.org/publication/PubMed/15358107" } ] }, { "title": "Kinetics of acetaminophen glucuronidation by UDP-glucuronosyltransferases 1A1, 1A6, 1A9 and 2B15. Potential implications in acetaminophen-induced hepatotoxicity.", "journal": "Chemical research in toxicology", "date": "2006", "authors": "Mutlib AE, Goosen TC, Bauman JN, Williams JA, Kulkarni S, Kostrubsky S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "16696573", "url": "https://glygen.org/publication/PubMed/16696573" } ] }, { "title": "Induction of hepatobiliary efflux transporters in acetaminophen-induced acute liver failure cases.", "journal": "Drug metabolism and disposition: the biological fate of chemicals", "date": "2007", "authors": "Barnes SN, Aleksunes LM, Augustine L, Scheffer GL, Goedken MJ, Jakowski AB, Pruimboom-Brees IM, Cherrington NJ, Manautou JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "17627974", "url": "https://glygen.org/publication/PubMed/17627974" } ] }, { "title": "Kinetic characterization and identification of the acylation and glycosylation sites of recombinant human gamma-glutamyltranspeptidase.", "journal": "Biochemistry", "date": "2007", "authors": "Castonguay R, Halim D, Morin M, Furtos A, Lherbet C, Bonneil E, Thibault P, Keillor JW", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "17924658", "url": "https://glygen.org/publication/PubMed/17924658" } ] }, { "title": "Interindividual variability in acetaminophen sulfation by human fetal liver: implications for pharmacogenetic investigations of drug-induced birth defects.", "journal": "Birth defects research. Part A, Clinical and molecular teratology", "date": "2008", "authors": "Adjei AA, Gaedigk A, Simon SD, Weinshilboum RM, Leeder JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "18232020", "url": "https://glygen.org/publication/PubMed/18232020" } ] }, { "title": "The human gamma-glutamyltransferase gene family.", "journal": "Human genetics", "date": "2008", "authors": "Heisterkamp N, Groffen J, Warburton D, Sneddon TP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "18357469", "url": "https://glygen.org/publication/PubMed/18357469" } ] }, { "title": "Endoglycan, a member of the CD34 family of sialomucins, is a ligand for the vascular selectins.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2008", "authors": "Kerr SC, Fieger CB, Snapp KR, Rosen SD", "evidence": [ { "database": "Reactome", "id": "R-HSA-156584", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156584" } ], "reference": [ { "type": "PubMed", "id": "18606703", "url": "https://glygen.org/publication/PubMed/18606703" } ] }, { "title": "Mass spectrometric kinetic analysis of human tyrosylprotein sulfotransferase-1 and -2.", "journal": "Journal of the American Society for Mass Spectrometry", "date": "2008", "authors": "Danan LM, Yu Z, Hoffhines AJ, Moore KL, Leary JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-156584", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156584" } ], "reference": [ { "type": "PubMed", "id": "18672380", "url": "https://glygen.org/publication/PubMed/18672380" } ] }, { "title": "Human kidney gamma-glutamyl transpeptidase. Catalytic properties, subunit structure, and localization of the gamma-glutamyl binding site on the light subunit.", "journal": "The Journal of biological chemistry", "date": "1977", "authors": "Tate SS, Ross ME", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "19463", "url": "https://glygen.org/publication/PubMed/19463" } ] }, { "title": "Isoform-selective inactivation of human arylamine N-acetyltransferases by reactive metabolites of carcinogenic arylamines.", "journal": "Chemical research in toxicology", "date": "2009", "authors": "Liu L, Wagner CR, Hanna PE", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "19842618", "url": "https://glygen.org/publication/PubMed/19842618" } ] }, { "title": "Membrane transporters in drug development.", "journal": "Nature reviews. Drug discovery", "date": "2010", "authors": "Giacomini KM, Huang SM, Tweedie DJ, Benet LZ, Brouwer KL, Chu X, Dahlin A, Evers R, Fischer V, Hillgren KM, Hoffmaster KA, Ishikawa T, Keppler D, Kim RB, Lee CA, Niemi M, Polli JW, Sugiyama Y, Swaan PW, Ware JA, Wright SH, Yee SW, Zamek-Gliszczynski MJ, Zhang L", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "20190787", "url": "https://glygen.org/publication/PubMed/20190787" } ] }, { "title": "UGT1A6 and UGT2B15 polymorphisms and acetaminophen conjugation in response to a randomized, controlled diet of select fruits and vegetables.", "journal": "Drug metabolism and disposition: the biological fate of chemicals", "date": "2011", "authors": "Navarro SL, Chen Y, Li L, Li SS, Chang JL, Schwarz Y, King IB, Potter JD, Bigler J, Lampe JW", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "21666065", "url": "https://glygen.org/publication/PubMed/21666065" } ] }, { "title": "Autocatalytic cleavage of human gamma-glutamyl transpeptidase is highly dependent on N-glycosylation at asparagine 95.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "West MB, Wickham S, Quinalty LM, Pavlovicz RE, Li C, Hanigan MH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "21712391", "url": "https://glygen.org/publication/PubMed/21712391" } ] }, { "title": "Aminoacylase 1-catalysed deacetylation of bioactives epoxides mycotoxin-derived mercapturates; 3,4-epoxyprecocenes as models of cytotoxic epoxides.", "journal": "Biochimie", "date": "2012", "authors": "Stocker P, Brunel JM, de Rezende L, do Amaral AT, Morelli X, Roche P, Vidal N, Giardina T, Perrier J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "22349737", "url": "https://glygen.org/publication/PubMed/22349737" } ] }, { "title": "Impact of probe compound in MRP2 vesicular transport assays.", "journal": "European journal of pharmaceutical sciences : official journal of the European Federation for Pharmaceutical Sciences", "date": "2012", "authors": "Kidron H, Wissel G, Manevski N, Hakli M, Ketola RA, Finel M, Yliperttula M, Xhaard H, Urtti A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "22406294", "url": "https://glygen.org/publication/PubMed/22406294" } ] }, { "title": "Human liver steroid sulphotransferase sulphates bile acids.", "journal": "The Biochemical journal", "date": "1990", "authors": "Radominska A, Comer KA, Zimniak P, Falany J, Iscan M, Falany CN", "evidence": [ { "database": "Reactome", "id": "R-HSA-156584", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156584" } ], "reference": [ { "type": "PubMed", "id": "2268288", "url": "https://glygen.org/publication/PubMed/2268288" } ] }, { "title": "Role for cytoplasmic nucleotide hydrolysis in hepatic function and protein synthesis.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2013", "authors": "Hudson BH, Frederick JP, Drake LY, Megosh LC, Irving RP, York JD", "evidence": [ { "database": "Reactome", "id": "R-HSA-156584", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156584" } ], "reference": [ { "type": "PubMed", "id": "23479625", "url": "https://glygen.org/publication/PubMed/23479625" } ] }, { "title": "Crystal structure of human tyrosylprotein sulfotransferase-2 reveals the mechanism of protein tyrosine sulfation reaction.", "journal": "Nature communications", "date": "2013", "authors": "Teramoto T, Fujikawa Y, Kawaguchi Y, Kurogi K, Soejima M, Adachi R, Nakanishi Y, Mishiro-Sato E, Liu MC, Sakakibara Y, Suiko M, Kimura M, Kakuta Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-156584", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156584" } ], "reference": [ { "type": "PubMed", "id": "23481380", "url": "https://glygen.org/publication/PubMed/23481380" } ] }, { "title": "Human GGT2 does not autocleave into a functional enzyme: A cautionary tale for interpretation of microarray data on redox signaling.", "journal": "Antioxidants & redox signaling", "date": "2013", "authors": "West MB, Wickham S, Parks EE, Sherry DM, Hanigan MH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "23682772", "url": "https://glygen.org/publication/PubMed/23682772" } ] }, { "title": "Different gamma-glutamyl transpeptidase mRNAs are expressed in human liver and kidney.", "journal": "Biochemical and biophysical research communications", "date": "1989", "authors": "Pawlak A, Wu SJ, Bulle F, Suzuki A, Chikhi N, Ferry N, Baik JH, Siegrist S, Guellaen G", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "2573352", "url": "https://glygen.org/publication/PubMed/2573352" } ] }, { "title": "PharmGKB summary: pathways of acetaminophen metabolism at the therapeutic versus toxic doses.", "journal": "Pharmacogenetics and genomics", "date": "2015", "authors": "Mazaleuskaya LL, Sangkuhl K, Thorn CF, FitzGerald GA, Altman RB, Klein TE", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "26049587", "url": "https://glygen.org/publication/PubMed/26049587" } ] }, { "title": "Sulphation of acetaminophen by the human cytosolic sulfotransferases: a systematic analysis.", "journal": "Journal of biochemistry", "date": "2015", "authors": "Yamamoto A, Liu MY, Kurogi K, Sakakibara Y, Saeki Y, Suiko M, Liu MC", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "26067475", "url": "https://glygen.org/publication/PubMed/26067475" } ] }, { "title": "Effects of human SULT1A3/SULT1A4 genetic polymorphisms on the sulfation of acetaminophen and opioid drugs by the cytosolic sulfotransferase SULT1A3.", "journal": "Archives of biochemistry and biophysics", "date": "2018", "authors": "Bairam AF, Rasool MI, Alherz FA, Abunnaja MS, El Daibani AA, Kurogi K, Liu MC", "evidence": [ { "database": "RefSeq", "id": "NP_001017390", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001017390" } ], "reference": [ { "type": "PubMed", "id": "29705271", "url": "https://glygen.org/publication/PubMed/29705271" } ] }, { "title": "Impact of SULT1A3/SULT1A4 genetic polymorphisms on the sulfation of phenylephrine and salbutamol by human SULT1A3 allozymes.", "journal": "Pharmacogenetics and genomics", "date": "2019", "authors": "Bairam AF, Rasool MI, Alherz FA, Abunnaja MS, El Daibani AA, Gohal SA, Alatwi ES, Kurogi K, Liu MC", "evidence": [ { "database": "RefSeq", "id": "NP_001017390", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001017390" } ], "reference": [ { "type": "PubMed", "id": "31145702", "url": "https://glygen.org/publication/PubMed/31145702" } ] }, { "title": "Human multidrug resistance protein 4 (MRP4) is a cellular efflux transporter for paracetamol glutathione and cysteine conjugates.", "journal": "Archives of toxicology", "date": "2020", "authors": "Koenderink JB, van den Heuvel JJMW, Bilos A, Vredenburg G, Vermeulen NPE, Russel FGM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "32472168", "url": "https://glygen.org/publication/PubMed/32472168" } ] }, { "title": "The spontaneous and enzymatic reaction of N-acetyl-p-benzoquinonimine with glutathione: a stopped-flow kinetic study.", "journal": "Archives of biochemistry and biophysics", "date": "1988", "authors": "Coles B, Wilson I, Wardman P, Hinson JA, Nelson SD, Ketterer B", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "3395122", "url": "https://glygen.org/publication/PubMed/3395122" } ] }, { "title": "Extracellular arginine availability modulates eIF2\u03b1 O-GlcNAcylation and heme oxygenase 1 translation for cellular homeostasis.", "journal": "Journal of biomedical science", "date": "2023-05-22", "authors": "Hung Yu-Wen, Ouyang Ching, Ping Xiaoli, Qi Yue, Wang Yi-Chang, Kung Hsing-Jien, Ann David K", "evidence": [ { "database": "O-GlcNAc Database", "id": "P0DMN0", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P0DMN0" } ], "reference": [ { "type": "PubMed", "id": "37217939", "url": "https://glygen.org/publication/PubMed/37217939" } ] }, { "title": "Thermolabile and thermostable human platelet phenol sulfotransferase. Substrate specificity and physical separation.", "journal": "Naunyn-Schmiedeberg's archives of pharmacology", "date": "1983", "authors": "Reiter C, Mwaluko G, Dunnette J, Van Loon J, Weinshilboum R", "evidence": [ { "database": "Reactome", "id": "R-HSA-156584", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156584" } ], "reference": [ { "type": "PubMed", "id": "6139755", "url": "https://glygen.org/publication/PubMed/6139755" } ] }, { "title": "Radioenzymatic assay of sulfate conjugates of catecholamines and DOPA in plasma.", "journal": "Life sciences", "date": "1980", "authors": "Johnson GA, Baker CA, Smith RT", "evidence": [ { "database": "Reactome", "id": "R-HSA-156584", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156584" } ], "reference": [ { "type": "PubMed", "id": "6770210", "url": "https://glygen.org/publication/PubMed/6770210" } ] }, { "title": "Acetaminophen and phenol: substrates for both a thermostable and a thermolabile form of human platelet phenol sulfotransferase.", "journal": "The Journal of pharmacology and experimental therapeutics", "date": "1982", "authors": "Reiter C, Weinshilboum RM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "6950087", "url": "https://glygen.org/publication/PubMed/6950087" } ] }, { "title": "Treatment of paracetamol (acetaminophen) poisoning with N-acetylcysteine.", "journal": "Lancet (London, England)", "date": "1977", "authors": "Prescott LF, Park J, Ballantyne A, Adriaenssens P, Proudfoot AT", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "70646", "url": "https://glygen.org/publication/PubMed/70646" } ] }, { "title": "Treatment of severe acetaminophen poisoning with intravenous acetylcysteine.", "journal": "Archives of internal medicine", "date": "1981", "authors": "Prescott LF", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "7469630", "url": "https://glygen.org/publication/PubMed/7469630" } ] }, { "title": "Cloning and expression of human liver dehydroepiandrosterone sulphotransferase.", "journal": "The Biochemical journal", "date": "1993", "authors": "Comer KA, Falany JL, Falany CN", "evidence": [ { "database": "Reactome", "id": "R-HSA-156584", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156584" } ], "reference": [ { "type": "PubMed", "id": "7678732", "url": "https://glygen.org/publication/PubMed/7678732" } ] }, { "title": "Bacterial expression and characterization of a cDNA for human liver estrogen sulfotransferase.", "journal": "The Journal of steroid biochemistry and molecular biology", "date": "1995", "authors": "Falany CN, Krasnykh V, Falany JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-156584", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156584" } ], "reference": [ { "type": "PubMed", "id": "7779757", "url": "https://glygen.org/publication/PubMed/7779757" } ] }, { "title": "Human liver estrogen sulfotransferase: identification by cDNA cloning and expression.", "journal": "Biochemical and biophysical research communications", "date": "1994", "authors": "Aksoy IA, Wood TC, Weinshilboum R", "evidence": [ { "database": "Reactome", "id": "R-HSA-156584", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156584" } ], "reference": [ { "type": "PubMed", "id": "8185618", "url": "https://glygen.org/publication/PubMed/8185618" } ] }, { "title": "cDNA cloning and expression of a new form of human aryl sulfotransferase.", "journal": "The international journal of biochemistry & cell biology", "date": "1996", "authors": "Zhu X, Veronese ME, Iocco P, McManus ME", "evidence": [ { "database": "Reactome", "id": "R-HSA-156584", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156584" } ], "reference": [ { "type": "PubMed", "id": "8697101", "url": "https://glygen.org/publication/PubMed/8697101" } ] }, { "title": "Immunohistochemical detection of gamma-glutamyl transpeptidase in normal human tissue.", "journal": "The journal of histochemistry and cytochemistry : official journal of the Histochemistry Society", "date": "1996", "authors": "Hanigan MH, Frierson HF Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "8813074", "url": "https://glygen.org/publication/PubMed/8813074" } ] }, { "title": "Influence of polymorphic N-acetyltransferase phenotype on the inhibition and induction of acetaminophen bioactivation with long-term isoniazid.", "journal": "Clinical pharmacology and therapeutics", "date": "1997", "authors": "Chien JY, Peter RM, Nolan CM, Wartell C, Slattery JT, Nelson SD, Carithers RL Jr, Thummel KE", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "9024171", "url": "https://glygen.org/publication/PubMed/9024171" } ] }, { "title": "Sulfation and sulfotransferases 1: Sulfotransferase molecular biology: cDNAs and genes.", "journal": "FASEB journal : official publication of the Federation of American Societies for Experimental Biology", "date": "1997", "authors": "Weinshilboum RM, Otterness DM, Aksoy IA, Wood TC, Her C, Raftogianis RB", "evidence": [ { "database": "Reactome", "id": "R-HSA-156584", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156584" } ], "reference": [ { "type": "PubMed", "id": "9034160", "url": "https://glygen.org/publication/PubMed/9034160" } ] }, { "title": "Hydrolysis and transfer reactions catalyzed by gamma-glutamyl transpeptidase; evidence for separate substrate sites and for high affinity of L-cystine.", "journal": "Biochemical and biophysical research communications", "date": "1976", "authors": "Thompson GA, Meister A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "9080", "url": "https://glygen.org/publication/PubMed/9080" } ] }, { "title": "Expression and characterization of a novel thyroid hormone-sulfating form of cytosolic sulfotransferase from human liver.", "journal": "Molecular pharmacology", "date": "1998", "authors": "Wang J, Falany JL, Falany CN", "evidence": [ { "database": "Reactome", "id": "R-HSA-156584", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156584" } ], "reference": [ { "type": "PubMed", "id": "9463486", "url": "https://glygen.org/publication/PubMed/9463486" } ] }, { "title": "Tyrosylprotein sulfotransferase: purification and molecular cloning of an enzyme that catalyzes tyrosine O-sulfation, a common posttranslational modification of eukaryotic proteins.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1998", "authors": "Ouyang Yb, Lane WS, Moore KL", "evidence": [ { "database": "Reactome", "id": "R-HSA-156584", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156584" } ], "reference": [ { "type": "PubMed", "id": "9501187", "url": "https://glygen.org/publication/PubMed/9501187" } ] }, { "title": "Structural and functional characterisation of human sulfotransferases.", "journal": "Chemico-biological interactions", "date": "1998", "authors": "Brix LA, Nicoll R, Zhu X, McManus ME", "evidence": [ { "database": "Reactome", "id": "R-HSA-156584", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156584" } ], "reference": [ { "type": "PubMed", "id": "9566739", "url": "https://glygen.org/publication/PubMed/9566739" } ] }, { "title": "Molecular cloning, expression, and characterization of novel human SULT1C sulfotransferases that catalyze the sulfonation of N-hydroxy-2-acetylaminofluorene.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Sakakibara Y, Yanagisawa K, Katafuchi J, Ringer DP, Takami Y, Nakayama T, Suiko M, Liu MC", "evidence": [ { "database": "Reactome", "id": "R-HSA-156584", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156584" } ], "reference": [ { "type": "PubMed", "id": "9852044", "url": "https://glygen.org/publication/PubMed/9852044" } ] } ], "pathway": [ { "id": "hsa:445329", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:445329", "resource": "KEGG Pathway" }, { "id": "hsa:6818", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:6818", "resource": "KEGG Pathway" }, { "id": "R-HSA-156584", "name": "Cytosolic sulfonation of small molecules", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156584", "resource": "Reactome", "description": "Cytosolic sulfonation of small molecules" }, { "id": "R-HSA-9753281", "name": "Paracetamol ADME", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281", "resource": "Reactome", "description": "Paracetamol ADME" } ], "orthologs": [ { "uniprot_canonical_ac": "P17988-1", "protein_name": "Sulfotransferase 1A1", "gene_name": "Sult1a1", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MEFSRPPLVHVKGIPLIKYFAETIGPLQNFTAWPDDLLISTYPKSGTTWMSEILDMIYQGGKLEKCGRAPIYARVPFLEFKCPGVPSGLETLEETPAPRLLKTHLPLSLLPQSLLDQKVKVIYIARNAKDVVVSYYNFYNMAKLHPDPGTWDSFLENFMDGEVSYGSWYQHVKEWWELRHTHPVLYLFYEDIKENPKREIKKILEFLGRSLPEETVDSIVHHTSFKKMKENCMTNYTTIPTEIMDHNVSPFMRKGTTGDWKNTFTVAQNERFDAHYAKTMTDCDFKFRCEL", "length": 291 }, "evidence": [ { "id": "45917917", "url": "http://www.informatics.jax.org/homology/45917917", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "P50225-1", "protein_name": "Sulfotransferase 1A1", "gene_name": "SULT1A1", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLISTYPKSGTTWVSQILDMIYQGGDLEKCHRAPIFMRVPFLEFKAPGIPSGMETLKDTPAPRLLKTHLPLALLPQTLLDQKVKVVYVARNAKDVAVSYYHFYHMAKVHPEPGTWDSFLEKFMVGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGRSLPEETVDFVVQHTSFKEMKKNPMTNYTTVPQEFMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL", "length": 295 }, "evidence": [ { "id": "45917917", "url": "http://www.informatics.jax.org/homology/45917917", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "P50226-1", "protein_name": "Sulfotransferase 1A2", "gene_name": "SULT1A2", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MELIQDISRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLISTYPKSGTTWVSQILDMIYQGGDLEKCHRAPIFMRVPFLEFKVPGIPSGMETLKNTPAPRLLKTHLPLALLPQTLLDQKVKVVYVARNAKDVAVSYYHFYHMAKVYPHPGTWESFLEKFMAGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGRSLPEETVDLMVEHTSFKEMKKNPMTNYTTVRREFMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAKKMAGCSLSFRSEL", "length": 295 }, "evidence": [ { "id": "45917917", "url": "http://www.informatics.jax.org/homology/45917917", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "P52840-1", "protein_name": "Sulfotransferase 1A1", "gene_name": "Sult1a1", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MEPLRKPLVPVKGIPLIKYFAETMEQLQNFTAWPDDVLISTYPKSGTNWMSEIMDMIYQGGKLDKCGRAPVYARIPFLEFSCPGVPPGLETLKETPAPRIIKTHLPLSLLPQSLLDQKIKVIYVARNAKDVVVSYYNFYKMAKLHPDPGTWESFLENFMDGKVSYGSWYQHVKEWWELRRTHPVLYLFYEDMKENPKREIKKILEFLGRSLPEETVDLIVHHTSFKKMKENPMANYTTIPTEVMDHTIYPFMRKGTIGDWKNTFTVAQSEHFDAHYAKLMTGCDFTFRCQI", "length": 291 }, "evidence": [ { "id": "45917917", "url": "http://www.informatics.jax.org/homology/45917917", "database": "MGI" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 3, "go_terms": [ { "name": "sulfation", "id": "GO:0051923", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051923", "evidence": [ { "database": "UniProtKB", "id": "P0DMN0", "url": "https://www.uniprot.org/uniprot/P0DMN0" } ], "pmid": "" }, { "name": "catecholamine metabolic process", "id": "GO:0006584", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006584", "evidence": [ { "database": "UniProtKB", "id": "P0DMN0", "url": "https://www.uniprot.org/uniprot/P0DMN0" } ], "pmid": "" }, { "name": "steroid metabolic process", "id": "GO:0008202", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008202", "evidence": [ { "database": "UniProtKB", "id": "P0DMN0", "url": "https://www.uniprot.org/uniprot/P0DMN0" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "aryl sulfotransferase activity", "id": "GO:0004062", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004062", "evidence": [ { "database": "UniProtKB", "id": "P0DMN0", "url": "https://www.uniprot.org/uniprot/P0DMN0" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "P0DMN0", "url": "https://www.uniprot.org/uniprot/P0DMN0" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "P0DMN0", "url": "https://www.uniprot.org/uniprot/P0DMN0" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 239, "end_pos": 241, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "12164", "name": "", "equation": "3'-phosphoadenylyl sulfate + a phenol = adenosine 3',5'-bisphosphate + an aryl sulfate + H(+)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P17988-1", "Q9WUW8-1", "Q9WUW9-1", "P52847-1", "A0A0G2JZU5-1", "A0A8I5ZKG4-1", "P0DMN0-1", "P50225-1", "P50226-1", "P0DMM9-1", "Q6IMI6-1", "O43704-1", "O75897-1", "O00338-1", "P52840-1", "Q9D939-1", "Q9QWG7-1" ], "evidence": [ { "id": "12164", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/12164" } ] }, { "id": "R-HSA-159358", "name": "SULT1A3,4 dimers sulfate DA to DAOS", "equation": "", "summary": "The catecholamine neurotransmitter dopamine (DA) is predominantly (>95%) conjugated with sulfate (dopamine 3-O-sulfate, DAOS) in human blood circulation. Human SULT1A3 and SULT1A4 are the major sulfotransferases that sulfonate DA (as well as other catecholamines and phenols) (Reiter et al. 1983, Johnson et al. 1980, Thomae et al. 2003, Hildebrandt et al. 2004).", "cellular_location": "cytosol", "input_participant_list": [ "R-ALL-159362" ], "output_participant_list": [ "R-ALL-159352" ], "enzyme_list": [ "P0DMN0-1", "P0DMM9-1" ], "evidence": [ { "id": "R-HSA-159358", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-159358" } ] }, { "id": "R-HSA-9753277", "name": "SULT dimers sulfate APAP to APAP-SO3", "equation": "", "summary": "After a therapeutic dose, a large fraction (30-44%) of acetaminophen (APAP) can be converted to inactive sulfate conjugates. Cytosolic sulfotransferases (SULTs) carry out the sulfation conjugation of APAP. SULTs transfer a sulfo group from PAPS to APAP, making it more polar and therefore easier to eliminate. SULTs 1A1, 1A3, 1A4, 1C4, 1E1 and 2A1 are known to have sulfotransferase activity towards APAP (Reiter & Weinshilboum 1992, Adjei et al. 2008, Mazaleuskaya et al. 2015). SULTs are expressed in many tissues but Yamamoto et al. found higher sulfating activity in the liver and intestine than that found in the lung and kidney (Yamamoto et al. 2015).", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [ "R-ALL-9753448" ], "enzyme_list": [ "O75897-1", "P0DMN0-1", "P50225-1", "Q06520-1", "P0DMM9-1", "P49888-1" ], "evidence": [ { "id": "R-HSA-9753277", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753277" } ] } ], "reaction_participants": [ { "participant_id": "R-ALL-159352", "participant_name": "DAOS [cytosol]", "crossref": [ { "id": "37946", "database": "ChEBI", "url": "" }, { "id": "8147532", "database": "PubChem Substance", "url": "" }, { "id": "HMDB0006275", "database": "HMDB Metabolite", "url": "" }, { "id": "000004654886", "database": "ZINC", "url": "" }, { "id": "000004654886", "database": "ZINC", "url": "" }, { "id": "8147532", "database": "PubChem Substance", "url": "" }, { "id": "37946", "database": "ChEBI", "url": "" }, { "id": "HMDB0006275", "database": "HMDB Metabolite", "url": "" }, { "id": "HMDB0006275", "database": "HMDB Metabolite", "url": "" }, { "id": "37946", "database": "ChEBI", "url": "" }, { "id": "000004654886", "database": "ZINC", "url": "" }, { "id": "8147532", "database": "PubChem Substance", "url": "" }, { "id": "37946", "database": "ChEBI", "url": "" }, { "id": "8147532", "database": "PubChem Substance", "url": "" }, { "id": "HMDB0006275", "database": "HMDB Metabolite", "url": "" }, { "id": "000004654886", "database": "ZINC", "url": "" }, { "id": "37946", "database": "ChEBI", "url": "" }, { "id": "8147532", "database": "PubChem Substance", "url": "" }, { "id": "HMDB0006275", "database": "HMDB Metabolite", "url": "" }, { "id": "000004654886", "database": "ZINC", "url": "" } ] }, { "participant_id": "R-ALL-159362", "participant_name": "DA [cytosol]", "crossref": [ { "id": "C03758", "database": "COMPOUND", "url": "" }, { "id": "59905", "database": "ChEBI", "url": "" }, { "id": "000000033882", "database": "ZINC", "url": "" }, { "id": "C03758", "database": "COMPOUND", "url": "" }, { "id": "59905", "database": "ChEBI", "url": "" }, { "id": "000000033882", "database": "ZINC", "url": "" }, { "id": "59905", "database": "ChEBI", "url": "" }, { "id": "000000033882", "database": "ZINC", "url": "" }, { "id": "C03758", "database": "COMPOUND", "url": "" }, { "id": "59905", "database": "ChEBI", "url": "" }, { "id": "000000033882", "database": "ZINC", "url": "" }, { "id": "C03758", "database": "COMPOUND", "url": "" }, { "id": "C03758", "database": "COMPOUND", "url": "" }, { "id": "59905", "database": "ChEBI", "url": "" }, { "id": "000000033882", "database": "ZINC", "url": "" }, { "id": "C03758", "database": "COMPOUND", "url": "" }, { "id": "59905", "database": "ChEBI", "url": "" }, { "id": "000000033882", "database": "ZINC", "url": "" } ] }, { "participant_id": "R-ALL-9753448", "participant_name": "APAP-SO3 [cytosol]", "crossref": [ { "id": "32635", "database": "ChEBI", "url": "" }, { "id": "8147600", "database": "PubChem Substance", "url": "" }, { "id": "000002382375", "database": "ZINC", "url": "" }, { "id": "HMDB0059911", "database": "HMDB Metabolite", "url": "" }, { "id": "000002382375", "database": "ZINC", "url": "" }, { "id": "32635", "database": "ChEBI", "url": "" }, { "id": "HMDB0059911", "database": "HMDB Metabolite", "url": "" }, { "id": "8147600", "database": "PubChem Substance", "url": "" }, { "id": "8147600", "database": "PubChem Substance", "url": "" }, { "id": "HMDB0059911", "database": "HMDB Metabolite", "url": "" }, { "id": "32635", "database": "ChEBI", "url": "" }, { "id": "000002382375", "database": "ZINC", "url": "" }, { "id": "32635", "database": "ChEBI", "url": "" }, { "id": "8147600", "database": "PubChem Substance", "url": "" }, { "id": "000002382375", "database": "ZINC", "url": "" }, { "id": "HMDB0059911", "database": "HMDB Metabolite", "url": "" }, { "id": "32635", "database": "ChEBI", "url": "" }, { "id": "8147600", "database": "PubChem Substance", "url": "" }, { "id": "000002382375", "database": "ZINC", "url": "" }, { "id": "HMDB0059911", "database": "HMDB Metabolite", "url": "" } ] } ], "reaction_enzymes": [ { "uniprot_ac": "A0A0G2JZU5", "gene_name": "RGD1559960", "activity": [ { "ec_number": "2.8.2.-", "activity": "", "evidence": [ { "id": "A0A0G2JZU5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2JZU5" } ] } ] }, { "uniprot_ac": "A0A8I5ZKG4", "gene_name": "LOC102551938", "activity": [ { "ec_number": "2.8.2.-", "activity": "", "evidence": [ { "id": "A0A8I5ZKG4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I5ZKG4" } ] } ] }, { "uniprot_ac": "O00338", "gene_name": "SULT1C2", "activity": [ { "ec_number": "2.8.2.-", "activity": "", "evidence": [ { "id": "O00338", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O00338" } ] }, { "ec_number": "2.8.2.1", "activity": "3'-phosphoadenylyl sulfate + a phenol = adenosine 3',5'-bisphosphate + an aryl sulfate + H(+).", "evidence": [ { "id": "O00338", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O00338" } ] }, { "ec_number": "2.8.2.1", "activity": "", "evidence": [ { "id": "O00338", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O00338" } ] } ] }, { "uniprot_ac": "O43704", "gene_name": "SULT1B1", "activity": [ { "ec_number": "2.8.2.-", "activity": "", "evidence": [ { "id": "O43704", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O43704" } ] }, { "ec_number": "2.8.2.1", "activity": "3'-phosphoadenylyl sulfate + a phenol = adenosine 3',5'-bisphosphate + an aryl sulfate + H(+).", "evidence": [ { "id": "O43704", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O43704" } ] }, { "ec_number": "2.8.2.1", "activity": "", "evidence": [ { "id": "O43704", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O43704" } ] } ] }, { "uniprot_ac": "O75897", "gene_name": "SULT1C4", "activity": [ { "ec_number": "2.8.2.1", "activity": "3'-phosphoadenylyl sulfate + a phenol = adenosine 3',5'-bisphosphate + an aryl sulfate + H(+).", "evidence": [ { "id": "O75897", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O75897" } ] }, { "ec_number": "2.8.2.1", "activity": "", "evidence": [ { "id": "O75897", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O75897" } ] } ] }, { "uniprot_ac": "P0DMM9", "gene_name": "SULT1A3", "activity": [ { "ec_number": "2.8.2.-", "activity": "", "evidence": [ { "id": "P0DMM9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0DMM9" } ] }, { "ec_number": "2.8.2.1", "activity": "3'-phosphoadenylyl sulfate + a phenol = adenosine 3',5'-bisphosphate + an aryl sulfate + H(+).", "evidence": [ { "id": "P0DMM9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0DMM9" } ] }, { "ec_number": "2.8.2.1", "activity": "", "evidence": [ { "id": "P0DMM9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0DMM9" } ] } ] }, { "uniprot_ac": "P0DMN0", "gene_name": "SULT1A4", "activity": [ { "ec_number": "2.8.2.1", "activity": "3'-phosphoadenylyl sulfate + a phenol = adenosine 3',5'-bisphosphate + an aryl sulfate + H(+).", "evidence": [ { "id": "P0DMN0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0DMN0" } ] }, { "ec_number": "2.8.2.1", "activity": "", "evidence": [ { "id": "P0DMN0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0DMN0" } ] } ] }, { "uniprot_ac": "P17988", "gene_name": "Sult1a1", "activity": [ { "ec_number": "2.8.2.1", "activity": "3'-phosphoadenylyl sulfate + a phenol = adenosine 3',5'-bisphosphate + an aryl sulfate + H(+).", "evidence": [ { "id": "P17988", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P17988" } ] }, { "ec_number": "2.8.2.1", "activity": "", "evidence": [ { "id": "P17988", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P17988" } ] } ] }, { "uniprot_ac": "P49888", "gene_name": "SULT1E1", "activity": [ { "ec_number": "2.8.2.4", "activity": "3'-phosphoadenylyl sulfate + estrone = adenosine 3',5'-bisphosphate + estrone 3-sulfate + H(+).", "evidence": [ { "id": "P49888", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P49888" } ] }, { "ec_number": "2.8.2.4", "activity": "", "evidence": [ { "id": "P49888", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P49888" } ] } ] }, { "uniprot_ac": "P50225", "gene_name": "SULT1A1", "activity": [ { "ec_number": "2.8.2.-", "activity": "", "evidence": [ { "id": "P50225", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P50225" } ] }, { "ec_number": "2.8.2.1", "activity": "3'-phosphoadenylyl sulfate + a phenol = adenosine 3',5'-bisphosphate + an aryl sulfate + H(+).", "evidence": [ { "id": "P50225", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P50225" } ] }, { "ec_number": "2.8.2.1", "activity": "", "evidence": [ { "id": "P50225", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P50225" } ] } ] }, { "uniprot_ac": "P50226", "gene_name": "SULT1A2", "activity": [ { "ec_number": "2.8.2.-", "activity": "", "evidence": [ { "id": "P50226", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P50226" } ] }, { "ec_number": "2.8.2.1", "activity": "3'-phosphoadenylyl sulfate + a phenol = adenosine 3',5'-bisphosphate + an aryl sulfate + H(+).", "evidence": [ { "id": "P50226", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P50226" } ] }, { "ec_number": "2.8.2.1", "activity": "", "evidence": [ { "id": "P50226", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P50226" } ] } ] }, { "uniprot_ac": "P52840", "gene_name": "Sult1a1", "activity": [ { "ec_number": "2.8.2.-", "activity": "", "evidence": [ { "id": "P52840", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P52840" } ] }, { "ec_number": "2.8.2.1", "activity": "3'-phosphoadenylyl sulfate + a phenol = adenosine 3',5'-bisphosphate + an aryl sulfate + H(+).", "evidence": [ { "id": "P52840", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P52840" } ] }, { "ec_number": "2.8.2.1", "activity": "", "evidence": [ { "id": "P52840", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P52840" } ] } ] }, { "uniprot_ac": "P52847", "gene_name": "Sult1b1", "activity": [ { "ec_number": "2.8.2.1", "activity": "3'-phosphoadenylyl sulfate + a phenol = adenosine 3',5'-bisphosphate + an aryl sulfate + H(+).", "evidence": [ { "id": "P52847", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P52847" } ] }, { "ec_number": "2.8.2.1", "activity": "", "evidence": [ { "id": "P52847", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P52847" } ] } ] }, { "uniprot_ac": "Q06520", "gene_name": "SULT2A1", "activity": [ { "ec_number": "2.8.2.14", "activity": "3'-phosphoadenylyl sulfate + taurolithocholate = adenosine 3',5'-bisphosphate + H(+) + taurolithocholate 3-sulfate.", "evidence": [ { "id": "Q06520", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q06520" } ] }, { "ec_number": "2.8.2.2", "activity": "3'-phosphoadenylyl sulfate + an alcohol = adenosine 3',5'-bisphosphate + an alkyl sulfate + H(+).", "evidence": [ { "id": "Q06520", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q06520" } ] }, { "ec_number": "2.8.2.2", "activity": "", "evidence": [ { "id": "Q06520", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q06520" } ] } ] }, { "uniprot_ac": "Q6IMI6", "gene_name": "SULT1C3", "activity": [ { "ec_number": "2.8.2.1", "activity": "3'-phosphoadenylyl sulfate + a phenol = adenosine 3',5'-bisphosphate + an aryl sulfate + H(+).", "evidence": [ { "id": "Q6IMI6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6IMI6" } ] }, { "ec_number": "2.8.2.2", "activity": "3'-phosphoadenylyl sulfate + an alcohol = adenosine 3',5'-bisphosphate + an alkyl sulfate + H(+).", "evidence": [ { "id": "Q6IMI6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6IMI6" } ] }, { "ec_number": "2.8.2.2", "activity": "", "evidence": [ { "id": "Q6IMI6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6IMI6" } ] }, { "ec_number": "2.8.2.1", "activity": "", "evidence": [ { "id": "Q6IMI6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6IMI6" } ] } ] }, { "uniprot_ac": "Q9D939", "gene_name": "Sult1c2", "activity": [ { "ec_number": "2.8.2.1", "activity": "3'-phosphoadenylyl sulfate + a phenol = adenosine 3',5'-bisphosphate + an aryl sulfate + H(+).", "evidence": [ { "id": "Q9D939", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9D939" } ] }, { "ec_number": "2.8.2.1", "activity": "", "evidence": [ { "id": "Q9D939", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9D939" } ] } ] }, { "uniprot_ac": "Q9QWG7", "gene_name": "Sult1b1", "activity": [ { "ec_number": "2.8.2.1", "activity": "3'-phosphoadenylyl sulfate + a phenol = adenosine 3',5'-bisphosphate + an aryl sulfate + H(+).", "evidence": [ { "id": "Q9QWG7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QWG7" } ] }, { "ec_number": "2.8.2.1", "activity": "", "evidence": [ { "id": "Q9QWG7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QWG7" } ] } ] }, { "uniprot_ac": "Q9WUW8", "gene_name": "Sult1c2", "activity": [ { "ec_number": "2.8.2.-", "activity": "", "evidence": [ { "id": "Q9WUW8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WUW8" } ] }, { "ec_number": "2.8.2.1", "activity": "3'-phosphoadenylyl sulfate + a phenol = adenosine 3',5'-bisphosphate + an aryl sulfate + H(+).", "evidence": [ { "id": "Q9WUW8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WUW8" } ] }, { "ec_number": "2.8.2.1", "activity": "", "evidence": [ { "id": "Q9WUW8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WUW8" } ] } ] }, { "uniprot_ac": "Q9WUW9", "gene_name": "Sult1c2a", "activity": [ { "ec_number": "2.8.2.-", "activity": "", "evidence": [ { "id": "Q9WUW9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WUW9" } ] }, { "ec_number": "2.8.2.1", "activity": "3'-phosphoadenylyl sulfate + a phenol = adenosine 3',5'-bisphosphate + an aryl sulfate + H(+).", "evidence": [ { "id": "Q9WUW9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WUW9" } ] }, { "ec_number": "2.8.2.1", "activity": "", "evidence": [ { "id": "Q9WUW9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WUW9" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.mgi", "label": "MGI Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 239, "end_pos": 241 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 61 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }