{
"uniprot_canonical_ac": "P0CG29-1",
"uniprot_ac": "P0CG29",
"uniprot_id": "GST2_HUMAN",
"mass": {
"chemical_mass": 27506.0,
"monoisotopic_mass": 27506.0
},
"refseq": {
"ac": "NP_000845",
"name": "glutathione S-transferase theta-2 isoform a",
"summary": "The protein encoded by this gene, glutathione S-transferase (GST) theta 2 (GSTT2), is a member of a superfamily of proteins that catalyze the conjugation of reduced glutathione to a variety of electrophilic and hydrophobic compounds. Human GSTs can be divided into five main classes: alpha, mu, pi, theta, and zeta. The theta class includes GSTT1, GSTT2, and GSTT2B. GSTT2 and GSTT2B are nearly identical to each other, and share 55% amino acid identity with GSTT1. All three genes may play a role in human carcinogenesis. The GSTT2 gene is a pseudogene in some populations. [provided by RefSeq, Sep 2015].",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_000845"
},
"gene_names": [
{
"name": "GSTT2",
"resource": "UniProtKB",
"type": "recommended",
"url": "https://www.uniprot.org/uniprot/P0CG29",
"id": "P0CG29"
},
{
"name": "GSTT2",
"resource": "RefSeq",
"type": "synonym",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_000845",
"id": "NP_000845"
}
],
"protein_names": [
{
"name": "Glutathione S-transferase theta-2",
"resource": "UniProtKB",
"type": "recommended",
"url": "",
"id": "P0CG29"
},
{
"name": "2.5.1.18",
"resource": "UniProtKB",
"type": "synonym",
"url": "",
"id": "P0CG29"
},
{
"name": "GST class-theta-2",
"resource": "UniProtKB",
"type": "synonym",
"url": "",
"id": "P0CG29"
},
{
"name": "glutathione S-transferase theta-2 isoform a",
"resource": "RefSeq",
"type": "synonym",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_000845",
"id": "NP_000845"
},
{
"name": "glutathione S-transferase theta-2; GST class-theta-2",
"resource": "RefSeq",
"type": "synonym",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_000845",
"id": "NP_000845"
}
],
"function": [
{
"annotation": "Analysis of glutathione S-transferase copy number variation alters lung gene expression",
"evidence": [
{
"database": "RefSeq",
"id": "NP_000845",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_000845"
},
{
"database": "PubMed",
"id": "21349909",
"url": "https://glygen.org/publication/PubMed/21349909"
}
]
},
{
"annotation": "Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles (PubMed:1417752). Has a sulfatase activity (PubMed:1417752).",
"evidence": [
{
"database": "UniProtKB",
"id": "P0CG29",
"url": "https://www.uniprot.org/uniprot/P0CG29#function"
},
{
"database": "PubMed",
"id": "1417752",
"url": "https://glygen.org/publication/PubMed/1417752"
}
]
},
{
"annotation": "Increased levels of GSTT2 in esophageal tissues of African American individuals might protect them from GERD-induced damage and contribute to the low incidence of esophageal adenocarcinoma in this population.",
"evidence": [
{
"database": "RefSeq",
"id": "NP_000845",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_000845"
},
{
"database": "PubMed",
"id": "30578782",
"url": "https://glygen.org/publication/PubMed/30578782"
}
]
},
{
"annotation": "Polyphenol metabolites did not affect cell number but significantly upregulated GSTT2 expression and decreased COX-2.",
"evidence": [
{
"database": "RefSeq",
"id": "NP_000845",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_000845"
},
{
"database": "PubMed",
"id": "21598179",
"url": "https://glygen.org/publication/PubMed/21598179"
}
]
},
{
"annotation": "Proanthocyanidins mitigate bile acid-induced changes in GSTT2 levels in a panel of racially diverse patient-derived primary esophageal cell cultures.",
"evidence": [
{
"database": "RefSeq",
"id": "NP_000845",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_000845"
},
{
"database": "PubMed",
"id": "34758158",
"url": "https://glygen.org/publication/PubMed/34758158"
}
]
},
{
"annotation": "The protein encoded by this gene, glutathione S-transferase (GST) theta 2 (GSTT2), is a member of a superfamily of proteins that catalyze the conjugation of reduced glutathione to a variety of electrophilic and hydrophobic compounds. Human GSTs can be divided into five main classes: alpha, mu, pi, theta, and zeta. The theta class includes GSTT1, GSTT2, and GSTT2B. GSTT2 and GSTT2B are nearly identical to each other, and share 55% amino acid identity with GSTT1. All three genes may play a role in human carcinogenesis. The GSTT2 gene is a pseudogene in some populations. [provided by RefSeq, Sep 2015].",
"evidence": [
{
"database": "RefSeq",
"id": "NP_000845",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_000845"
}
]
}
],
"disease": [],
"snv": [],
"mutagenesis": [],
"expression_tissue": [],
"expression_disease": [
{
"significant": "No",
"trend": "up",
"name": "Prostate cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:10283",
"evidence": [
{
"database": "BioXpress",
"id": "P0CG29",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P0CG29"
}
],
"disease": [
{
"disease_id": "DOID:10283",
"recommended_name": {
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "prostate cancer",
"description": "A male reproductive organ cancer that is located_in the prostate."
},
"synonyms": [
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "NGP - new growth of prostate",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "hereditary prostate cancer",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "malignant tumor of the prostate",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "prostate cancer, familial",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "prostate neoplasm",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "prostatic cancer",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "prostatic neoplasm",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "tumor of the prostate",
"description": ""
},
{
"id": "MONDO:0012597",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012597",
"name": "prostate cancer, hereditary, 9",
"description": ""
},
{
"id": "MONDO:0012597",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012597",
"name": "prostate cancer, hereditary, 9",
"description": ""
},
{
"id": "MONDO:0012597",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012597",
"name": "prostate cancer, hereditary, type 9",
"description": ""
},
{
"id": "MONDO:0012597",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012597",
"name": "HPC9",
"description": ""
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "prostate cancer, hereditary, 12",
"description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene."
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "EHBP1 familial prostate cancer",
"description": ""
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "familial prostate cancer caused by mutation in EHBP1",
"description": ""
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "prostate cancer, hereditary, 12",
"description": ""
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "prostate cancer, hereditary, type 12",
"description": ""
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "HPC12",
"description": ""
},
{
"id": "MONDO:0012244",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012244",
"name": "prostate cancer, hereditary, 5",
"description": ""
},
{
"id": "MONDO:0012244",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012244",
"name": "prostate cancer, hereditary, 5",
"description": ""
},
{
"id": "MONDO:0012244",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012244",
"name": "prostate cancer, hereditary, type 5",
"description": ""
},
{
"id": "MONDO:0012244",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012244",
"name": "HPC5",
"description": ""
},
{
"id": "MONDO:0012093",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012093",
"name": "prostate cancer, hereditary, 3",
"description": ""
},
{
"id": "MONDO:0012093",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012093",
"name": "prostate cancer, hereditary, 3",
"description": ""
},
{
"id": "MONDO:0012093",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012093",
"name": "prostate cancer, hereditary, type 3",
"description": ""
},
{
"id": "MONDO:0012093",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012093",
"name": "prostate cancer, susceptibility to, 3",
"description": ""
},
{
"id": "MONDO:0012093",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012093",
"name": "HPC3",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "prostate cancer, hereditary, 4",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "prostate cancer, hereditary, 4",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "prostate cancer, hereditary, type 4",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "prostate cancer, susceptibility to, 4",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "HPC4",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "prostate cancer, hereditary, on chromosome 7",
"description": ""
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "prostate cancer, hereditary, 13",
"description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene."
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "MSMB familial prostate cancer",
"description": ""
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "familial prostate cancer caused by mutation in MSMB",
"description": ""
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "prostate cancer, hereditary, 13",
"description": ""
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "prostate cancer, hereditary, type 13",
"description": ""
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "HPC13",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "prostate cancer, hereditary, 8",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "prostate cancer, hereditary, 8",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "prostate cancer, hereditary, type 8",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "HPC8",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "predisposing for prostate cancer",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "prostate cancer, susceptibility to",
"description": ""
},
{
"id": "MONDO:0012300",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012300",
"name": "prostate cancer, hereditary, 6",
"description": ""
},
{
"id": "MONDO:0012300",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012300",
"name": "prostate cancer, hereditary, 6",
"description": ""
},
{
"id": "MONDO:0012300",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012300",
"name": "prostate cancer, hereditary, type 6",
"description": ""
},
{
"id": "MONDO:0012300",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012300",
"name": "HPC6",
"description": ""
},
{
"id": "MONDO:0012300",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012300",
"name": "prostate cancer, susceptibility to",
"description": ""
},
{
"id": "MONDO:0012620",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012620",
"name": "prostate cancer, hereditary, 10",
"description": ""
},
{
"id": "MONDO:0012620",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012620",
"name": "HPC10",
"description": ""
},
{
"id": "MONDO:0012620",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012620",
"name": "prostate cancer, hereditary, 10",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "familial prostate carcinoma",
"description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma."
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "familial prostate cancer",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "hereditary prostate cancer",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "hereditary prostate carcinoma",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, somatic",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, familial",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, hereditary",
"description": ""
},
{
"id": "MONDO:0012470",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012470",
"name": "prostate cancer, hereditary, 7",
"description": ""
},
{
"id": "MONDO:0012470",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012470",
"name": "HPC7",
"description": ""
},
{
"id": "MONDO:0012470",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012470",
"name": "prostate cancer, hereditary, 7",
"description": ""
},
{
"id": "MONDO:0012470",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012470",
"name": "prostate cancer aggressiveness",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "prostate cancer, hereditary, 1",
"description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene."
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "RNASEL familial prostate cancer",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "familial prostate cancer caused by mutation in RNASEL",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "prostate cancer 1",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "prostate cancer, hereditary, 1",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "prostate cancer, hereditary, type 1",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "HPC1",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "Prca1",
"description": ""
},
{
"id": "MONDO:0012768",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012768",
"name": "prostate cancer, hereditary, 11",
"description": ""
},
{
"id": "MONDO:0012768",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012768",
"name": "HPC11",
"description": ""
},
{
"id": "MONDO:0012768",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012768",
"name": "prostate cancer, hereditary, 11",
"description": ""
},
{
"id": "MONDO:0012769",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012769",
"name": "prostate cancer, hereditary, 14",
"description": ""
},
{
"id": "MONDO:0012769",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012769",
"name": "HPC14",
"description": ""
},
{
"id": "MONDO:0012769",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012769",
"name": "prostate cancer, hereditary, 14",
"description": ""
},
{
"id": "MONDO:0012770",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012770",
"name": "prostate cancer, hereditary, 15",
"description": ""
},
{
"id": "MONDO:0012770",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012770",
"name": "HPC15",
"description": ""
},
{
"id": "MONDO:0012770",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012770",
"name": "prostate cancer, hereditary, 15",
"description": ""
},
{
"id": "MONDO:0010257",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010257",
"name": "prostate cancer, hereditary, X-linked 1",
"description": ""
},
{
"id": "MONDO:0010257",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010257",
"name": "HPCX1",
"description": ""
},
{
"id": "MONDO:0010257",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010257",
"name": "prostate cancer, hereditary, X-linked 1",
"description": ""
},
{
"id": "MONDO:0010257",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010257",
"name": "prostate cancer susceptibility, X-linked",
"description": ""
},
{
"id": "MONDO:0010405",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010405",
"name": "prostate cancer, hereditary, X-linked 2",
"description": ""
},
{
"id": "MONDO:0010405",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010405",
"name": "HPCX2",
"description": ""
},
{
"id": "MONDO:0010405",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010405",
"name": "prostate cancer, hereditary, X-linked 2",
"description": ""
},
{
"id": "MIM:611868",
"resource": "MIM",
"url": "https://www.omim.org/entry/611868",
"name": "Prostate cancer, hereditary, 12",
"description": "Prostate cancer, hereditary, 12"
},
{
"id": "MIM:611928",
"resource": "MIM",
"url": "https://www.omim.org/entry/611928",
"name": "Prostate cancer, hereditary, 13",
"description": "Prostate cancer, hereditary, 13"
},
{
"id": "MIM:176807",
"resource": "MIM",
"url": "https://www.omim.org/entry/176807",
"name": "Prostate cancer",
"description": "Prostate cancer"
},
{
"id": "MIM:601518",
"resource": "MIM",
"url": "https://www.omim.org/entry/601518",
"name": "Prostate cancer, hereditary, 1",
"description": "Prostate cancer, hereditary, 1"
},
{
"id": "MIM:611955",
"resource": "MIM",
"url": "https://www.omim.org/entry/611955",
"name": "Prostate cancer, hereditary, 11",
"description": "Prostate cancer, hereditary, 11"
}
]
}
]
},
{
"significant": "No",
"trend": "down",
"name": "Stomach cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:10534",
"evidence": [
{
"database": "BioXpress",
"id": "P0CG29",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P0CG29"
}
],
"disease": [
{
"disease_id": "DOID:10534",
"recommended_name": {
"id": "DOID:10534",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10534",
"name": "stomach cancer",
"description": "A gastrointestinal system cancer that is located_in the stomach."
},
"synonyms": [
{
"id": "DOID:10534",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10534",
"name": "gastric cancer",
"description": ""
},
{
"id": "DOID:10534",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10534",
"name": "gastric neoplasm",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer",
"description": "A primary or metastatic malignant neoplasm involving the stomach."
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric neoplasm",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "Ca lesser curvature - stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "cancer of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer risk after h. pylori infection",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer, somatic",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant gastric neoplasm",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant gastric tumor",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant gastric tumour",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant neoplasm of lesser curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant neoplasm of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant neoplasm of the stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant stomach neoplasm",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of body of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of greater curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of lesser curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of the stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of body of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of greater curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of lesser curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of the stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "stomach cancer",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "Ca body - stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "ca greater curvature of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant neoplasm of body of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer, intestinal",
"description": ""
},
{
"id": "MIM:613659",
"resource": "MIM",
"url": "https://www.omim.org/entry/613659",
"name": "Gastric cancer",
"description": "Gastric cancer"
}
]
}
]
},
{
"significant": "No",
"trend": "up",
"name": "Urinary bladder cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:11054",
"evidence": [
{
"database": "BioXpress",
"id": "P0CG29",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P0CG29"
}
],
"disease": [
{
"disease_id": "DOID:11054",
"recommended_name": {
"id": "DOID:11054",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11054",
"name": "urinary bladder cancer",
"description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder."
},
"synonyms": [
{
"id": "DOID:11054",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11054",
"name": "bladder cancer",
"description": ""
},
{
"id": "DOID:11054",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11054",
"name": "tumor of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "urinary bladder cancer",
"description": "A primary or metastatic malignant neoplasm involving the bladder."
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "tumor of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "tumour of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "bladder cancer, somatic",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "cancer of urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant bladder neoplasm",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant bladder tumor",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant bladder tumour",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm of bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm of the urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm of urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm, bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm, urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumor of bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumor of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumor of the urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumor of urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumor, urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumour of bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumour of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumour of the urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumour of urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant urinary bladder neoplasm",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant urinary bladder tumor",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant urinary bladder tumour",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "urinary bladder cancer",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "urinary bladder malignant neoplasm",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "urinary bladder malignant tumor",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "urinary bladder malignant tumour",
"description": ""
},
{
"id": "MIM:109800",
"resource": "MIM",
"url": "https://www.omim.org/entry/109800",
"name": "Bladder cancer",
"description": "Bladder cancer"
}
]
}
]
},
{
"significant": "No",
"trend": "up",
"name": "Head and neck cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:11934",
"evidence": [
{
"database": "BioXpress",
"id": "P0CG29",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P0CG29"
}
],
"disease": [
{
"disease_id": "DOID:11934",
"recommended_name": {
"id": "DOID:11934",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11934",
"name": "head and neck cancer",
"description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx."
},
"synonyms": [
{
"id": "DOID:11934",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11934",
"name": "head and neck neoplasm",
"description": ""
},
{
"id": "DOID:11934",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11934",
"name": "head and neck tumours",
"description": ""
},
{
"id": "DOID:11934",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11934",
"name": "head/neck neoplasm",
"description": ""
},
{
"id": "DOID:11934",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11934",
"name": "tumor of head and neck",
"description": ""
}
]
}
]
},
{
"significant": "No",
"trend": "down",
"name": "Lung cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:1324",
"evidence": [
{
"database": "BioXpress",
"id": "P0CG29",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P0CG29"
}
],
"disease": [
{
"disease_id": "DOID:1324",
"recommended_name": {
"id": "DOID:1324",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1324",
"name": "lung cancer",
"description": "A respiratory system cancer that is located_in the lung."
},
"synonyms": [
{
"id": "MONDO:0012159",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012159",
"name": "lung cancer susceptibility 1",
"description": ""
},
{
"id": "MONDO:0012159",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012159",
"name": "LNCR1",
"description": ""
},
{
"id": "MONDO:0012159",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012159",
"name": "lung cancer susceptibility",
"description": ""
},
{
"id": "MONDO:0012159",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012159",
"name": "lung cancer susceptibility 1",
"description": ""
},
{
"id": "MONDO:0012942",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012942",
"name": "lung cancer susceptibility 3",
"description": ""
},
{
"id": "MONDO:0012942",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012942",
"name": "LNCR3",
"description": ""
},
{
"id": "MONDO:0012942",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012942",
"name": "lung cancer susceptibility 3",
"description": ""
},
{
"id": "MONDO:0012942",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012942",
"name": "adenocarcinoma of lung, susceptibility to",
"description": ""
},
{
"id": "MONDO:0012955",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012955",
"name": "lung cancer susceptibility 4",
"description": ""
},
{
"id": "MONDO:0012955",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012955",
"name": "LNCR4",
"description": ""
},
{
"id": "MONDO:0012955",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012955",
"name": "lung cancer susceptibility 4",
"description": ""
},
{
"id": "MONDO:0013631",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0013631",
"name": "lung cancer susceptibility 5",
"description": ""
},
{
"id": "MONDO:0013631",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0013631",
"name": "LNCR5",
"description": ""
},
{
"id": "MONDO:0013631",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0013631",
"name": "lung cancer susceptibility 5",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer",
"description": "A malignant neoplasm involving the lung."
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "adenocarcinoma of lung, somatic",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "cancer of lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer, protection against, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer, resistance to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer, somatic",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant lung neoplasm",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant lung tumor",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant lung tumour",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant neoplasm of lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant neoplasm of the lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant tumor of lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant tumor of the lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant tumour of lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant tumour of the lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "nonsmall cell lung cancer, somatic",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "Nonsmall cell lung cancer",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "alveolar cell carcinoma",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer, protection against",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung neoplasm",
"description": ""
},
{
"id": "MIM:211980",
"resource": "MIM",
"url": "https://www.omim.org/entry/211980",
"name": "Lung cancer",
"description": "Lung cancer"
}
]
}
]
},
{
"significant": "Yes",
"trend": "down",
"name": "Breast cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:1612",
"evidence": [
{
"database": "BioXpress",
"id": "P0CG29",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P0CG29"
}
],
"disease": [
{
"disease_id": "DOID:1612",
"recommended_name": {
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "breast cancer",
"description": "A thoracic cancer that originates in the mammary gland."
},
"synonyms": [
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "breast tumor",
"description": ""
},
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "malignant neoplasm of breast",
"description": ""
},
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "malignant tumor of the breast",
"description": ""
},
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "mammary cancer",
"description": ""
},
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "mammary tumor",
"description": ""
},
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "primary breast cancer",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "hereditary breast carcinoma",
"description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma."
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer susceptibility, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, lobular, somatic",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, protection against, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, somatic",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "familial breast cancer",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "familial breast carcinoma",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "familial cancer of breast",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "familial cancer of the breast",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "hereditary breast cancer",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "hereditary breast carcinoma",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, familial",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, familial Male",
"description": ""
},
{
"id": "MIM:114480",
"resource": "MIM",
"url": "https://www.omim.org/entry/114480",
"name": "Breast cancer",
"description": "Breast cancer"
}
]
}
]
},
{
"significant": "No",
"trend": "down",
"name": "Thyroid cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:1781",
"evidence": [
{
"database": "BioXpress",
"id": "P0CG29",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P0CG29"
}
],
"disease": [
{
"disease_id": "DOID:1781",
"recommended_name": {
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "thyroid cancer",
"description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage."
},
"synonyms": [
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "thyroid gland cancer",
"description": ""
},
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "Thyroid gland neoplasm",
"description": ""
},
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "malignant neoplasm of thyroid gland",
"description": ""
},
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "malignant tumour of thyroid gland",
"description": ""
},
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "neoplasm of thyroid gland",
"description": ""
},
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "thyroid neoplasm",
"description": ""
}
]
}
]
},
{
"significant": "Yes",
"trend": "down",
"name": "Kidney cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:263",
"evidence": [
{
"database": "BioXpress",
"id": "P0CG29",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P0CG29"
}
],
"disease": [
{
"disease_id": "DOID:263",
"recommended_name": {
"id": "DOID:263",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:263",
"name": "kidney cancer",
"description": "A urinary system cancer that is located_in the kidney."
},
"synonyms": [
{
"id": "DOID:263",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:263",
"name": "malignant neoplasm of kidney except pelvis",
"description": ""
},
{
"id": "DOID:263",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:263",
"name": "malignant tumour of kidney",
"description": ""
},
{
"id": "DOID:263",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:263",
"name": "renal cancer",
"description": ""
}
]
}
]
},
{
"significant": "No",
"trend": "up",
"name": "Liver cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:3571",
"evidence": [
{
"database": "BioXpress",
"id": "P0CG29",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P0CG29"
}
],
"disease": [
{
"disease_id": "DOID:3571",
"recommended_name": {
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "liver cancer",
"description": "A hepatobiliary system cancer that is located_in the liver."
},
"synonyms": [
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "Ca liver - primary",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "Resectable malignant neoplasm of Liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "hepatic cancer",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "hepatic neoplasm",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "malignant hepato-biliary neoplasm",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "malignant neoplasm of liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "malignant neoplasm of liver, primary",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "malignant tumor of liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "neoplasm of liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "non-resectable primary hepatic malignant neoplasm",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "primary liver cancer",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "primary malignant neoplasm of liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "resectable malignant neoplasm of the liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "malignant neoplasm of liver, not specified as primary or secondary",
"description": ""
}
]
}
]
},
{
"significant": "No",
"trend": "down",
"name": "Uterine cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:363",
"evidence": [
{
"database": "BioXpress",
"id": "P0CG29",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P0CG29"
}
],
"disease": [
{
"disease_id": "DOID:363",
"recommended_name": {
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "uterine cancer",
"description": "A female reproductive organ cancer that is located_in the uterus."
},
"synonyms": [
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "CA - cancer of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "Tumour of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "malignant neoplasm of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "malignant uterine tumor",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "neoplasm of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "uterine tumor",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "uterus neoplasm",
"description": ""
}
]
}
]
},
{
"significant": "No",
"trend": "down",
"name": "Esophageal cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:5041",
"evidence": [
{
"database": "BioXpress",
"id": "P0CG29",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P0CG29"
}
],
"disease": [
{
"disease_id": "DOID:5041",
"recommended_name": {
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "esophageal cancer",
"description": "A gastrointestinal system cancer that is located_in the esophagus."
},
"synonyms": [
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "Ca lower third oesophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "Ca middle third oesophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "esophagus cancer",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant neoplasm of distal third of esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant neoplasm of lower third of oesophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant neoplasm of middle third of oesophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant neoplasm of proximal third of esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant neoplasm of upper third esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant tumor of Distal Third of esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant tumor of Proximal Third of esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant tumor of abdominal esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant tumor of the middle Third of the esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal cancer",
"description": "A primary or metastatic malignant neoplasm involving the esophagus."
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "cancer of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "cancer of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal cancer",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal cancer, somatic",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal carcinoma, somatic",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal squamous cell carcinoma, somatic",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophagus cancer",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant esophageal neoplasm",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant esophageal tumor",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant esophageal tumour",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant esophagus neoplasm",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant esophagus tumor",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of the esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of the oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant oesophagus neoplasm",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant oesophagus tumour",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of the esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of the oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "oesophagus cancer",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Ca lower third esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Ca lower third oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Ca middle third esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Ca middle third oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of distal third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of distal third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of lower third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of lower third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of middle third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of middle third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of proximal third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of proximal third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of upper third esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of upper third oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of abdominal esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of distal third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of proximal third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of the middle third of the esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of abdominal oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of distal third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of proximal third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of the middle third of the oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Aerodigestive tract cancer, susceptibility to",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Escc, susceptibility to",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal squamous cell carcinoma, susceptibility to",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "gastric cardia adenocarcinoma, susceptibility to",
"description": ""
},
{
"id": "MIM:133239",
"resource": "MIM",
"url": "https://www.omim.org/entry/133239",
"name": "Esophageal cancer",
"description": "Esophageal cancer"
}
]
}
]
},
{
"significant": "Yes",
"trend": "down",
"name": "Colorectal cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:9256",
"evidence": [
{
"database": "BioXpress",
"id": "P0CG29",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P0CG29"
}
],
"disease": [
{
"disease_id": "DOID:9256",
"recommended_name": {
"id": "DOID:9256",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:9256",
"name": "colorectal cancer",
"description": "A large intestine cancer that is located_in the colon and/or located_in the rectum."
},
"synonyms": [
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer",
"description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma."
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "cancer of colorectum",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "cancer of large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "cancer of large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "cancer of the large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colon cancer, advanced, somatic",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colon cancer, somatic",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer with chromosomal instability, somatic",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer, somatic",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectum cancer",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant colorectal neoplasm",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant colorectal tumor",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant colorectal tumour",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant colorectum neoplasm",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large bowel neoplasm",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large bowel tumor",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large bowel tumour",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large intestine neoplasm",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large intestine tumor",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large intestine tumour",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of colorectum",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of the large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of the large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumor of large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumor of large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumor of the large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumor of the large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumour of large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumour of large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumour of the large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumour of the large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "CRC",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colon cancer",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "large intestine cancer",
"description": ""
},
{
"id": "MIM:114500",
"resource": "MIM",
"url": "https://www.omim.org/entry/114500",
"name": "Colorectal cancer",
"description": "Colorectal cancer"
}
]
}
]
}
],
"species": [
{
"name": "Homo sapiens",
"taxid": 9606,
"evidence": [
{
"database": "UniProtKB",
"id": "P0CG29",
"url": "https://www.uniprot.org/uniprot/P0CG29"
}
],
"common_name": "Human"
}
],
"gene": [
{
"name": "GSTT2",
"url": "https://www.uniprot.org/uniprot/P0CG29",
"locus": {
"chromosome": "HSCHR22_1_CTG7",
"start_pos": 220281,
"end_pos": 216424,
"strand": "-",
"evidence": [
{
"database": "Ensembl Gene",
"id": "ENSG00000277897",
"url": "https://www.ensembl.org/id/ENSG00000277897"
}
]
}
}
],
"crossref": [
{
"id": "cd03050",
"url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd03050",
"database": "CDD",
"categories": [
"Protein Classification"
]
},
{
"id": "cd03183",
"url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd03183",
"database": "CDD",
"categories": [
"Protein Classification"
]
},
{
"id": "CHEMBL2142",
"url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL2142",
"database": "ChEMBL",
"categories": [
"Other"
]
},
{
"id": "GSTT2",
"url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=GSTT2",
"database": "GeneCards",
"categories": [
"Gene Annotation",
"Organism-specific"
]
},
{
"id": "2953",
"url": "https://www.ncbi.nlm.nih.gov/gene/2953",
"database": "GeneID",
"categories": [
"Genome Annotation"
]
},
{
"id": "4642",
"url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=4642",
"database": "HGNC",
"categories": [
"Organism-specific"
]
},
{
"id": "P0CG29",
"url": "https://www.ebi.ac.uk/intact/interactors/id:P0CG29*",
"database": "IntAct",
"categories": [
"Other"
]
},
{
"id": "IPR004045",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR004045",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "IPR004046",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR004046",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "IPR010987",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR010987",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "IPR036249",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR036249",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "IPR036282",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR036282",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "IPR040075",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR040075",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "IPR040077",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR040077",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "IPR040079",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR040079",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "hsa:2953",
"url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:2953",
"database": "KEGG Pathway",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "600437",
"url": "http://www.omim.org/entry/600437",
"database": "MIM",
"categories": [
"Other"
]
},
{
"id": "NX_P0CG29",
"url": "https://www.nextprot.org/entry/NX_P0CG29",
"database": "neXtProt",
"categories": [
"Protein",
"Organism-specific"
]
},
{
"id": "1199296at2759",
"url": "http://www.orthodb.org/?query=1199296at2759",
"database": "OrthoDB",
"categories": [
"Protein Classification"
]
},
{
"id": "PTHR43917:SF4",
"url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR43917:SF4",
"database": "PANTHER",
"categories": [
"Protein Classification"
]
},
{
"id": "4MPF",
"url": "https://www.rcsb.org/structure/4MPF",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "PF00043",
"url": "http://pfam.xfam.org/family/PF00043",
"database": "Pfam",
"categories": [
"Protein Classification"
]
},
{
"id": "PF02798",
"url": "http://pfam.xfam.org/family/PF02798",
"database": "Pfam",
"categories": [
"Protein Classification"
]
},
{
"id": "P0CG29",
"url": "https://pharos.nih.gov/targets/P0CG29",
"database": "PHAROS",
"categories": [
"Organism-specific"
]
},
{
"id": "PR_P0CG29",
"url": "http://purl.obolibrary.org/obo/PR_P0CG29",
"database": "PRO",
"categories": [
"Protein"
]
},
{
"id": "R-HSA-156590",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590",
"database": "Reactome",
"categories": [
"Protein Classification"
]
},
{
"id": "NP_000845",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_000845",
"database": "RefSeq",
"categories": [
"Protein"
]
},
{
"id": "16437",
"url": "https://www.rhea-db.org/rhea/16437",
"database": "Rhea",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "P0CG29",
"url": "https://www.uniprot.org/uniprot/P0CG29",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "P0CG29-1",
"url": "https://www.uniprot.org/uniprot/P0CG29-1",
"database": "UniProtKB",
"categories": [
"Protein"
]
}
],
"sequence": {
"sequence": "MGLELFLDLVSQPSRAVYIFAKKNGIPLELRTVDLVKGQHKSKEFLQINSLGKLPTLKDGDFILTESSAILIYLSCKYQTPDHWYPSDLQARARVHEYLGWHADCIRGTFGIPLWVQVLGPLIGVQVPKEKVERNRTAMDQALQWLEDKFLGDRPFLAGQQVTLADLMALEELMQPVALGYELFEGRPRLAAWRGRVEAFLGAELCQEAHSIILSILEQAAKKTLPTPSPEAYQAMLLRIARIP",
"length": 244,
"header": "sp|P0CG29-1|GST2_HUMAN Isoform 1 of Glutathione S-transferase theta-2 OS=Homo sapiens OX=9606 GN=GSTT2 PE=1 SV=1 CANONICAL=P0CG29-1"
},
"isoforms": [
{
"isoform_ac": "P0CG29-1",
"url": "",
"sequence": {
"sequence": "MGLELFLDLVSQPSRAVYIFAKKNGIPLELRTVDLVKGQHKSKEFLQINSLGKLPTLKDGDFILTESSAILIYLSCKYQTPDHWYPSDLQARARVHEYLGWHADCIRGTFGIPLWVQVLGPLIGVQVPKEKVERNRTAMDQALQWLEDKFLGDRPFLAGQQVTLADLMALEELMQPVALGYELFEGRPRLAAWRGRVEAFLGAELCQEAHSIILSILEQAAKKTLPTPSPEAYQAMLLRIARIP",
"length": 244,
"header": "sp|P0CG29-1|GST2_HUMAN Isoform 1 of Glutathione S-transferase theta-2 OS=Homo sapiens OX=9606 GN=GSTT2 PE=1 SV=1 CANONICAL=P0CG29-1"
},
"locus": {
"chromosome": "HSCHR22_1_CTG7",
"start_pos": 219969,
"end_pos": 216564,
"strand": "-",
"evidence": [
{
"database": "Ensembl Transcript",
"id": "ENST00000618279.2",
"url": "https://www.ensembl.org/id/ENST00000618279.2"
},
{
"database": "Ensembl Peptide",
"id": "ENSP00000477540.1",
"url": "https://www.ensembl.org/id/ENSP00000477540.1"
}
]
}
}
],
"glycosylation": [],
"phosphorylation": [],
"glycation": [],
"keywords": [
"enzyme"
],
"publication": [
{
"title": "Human glutathione transferase A4-4 crystal structures and mutagenesis reveal the basis of high catalytic efficiency with toxic lipid peroxidation products.",
"journal": "Journal of molecular biology",
"date": "1999",
"authors": "Bruns CM, Hubatsch I, Ridderstrom M, Mannervik B, Tainer JA",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-156590",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590"
}
],
"reference": [
{
"type": "PubMed",
"id": "10329152",
"url": "https://glygen.org/publication/PubMed/10329152"
}
]
},
{
"title": "An asparagine-phenylalanine substitution accounts for catalytic differences between hGSTM3-3 and other human class mu glutathione S-transferases.",
"journal": "Biochemistry",
"date": "1999",
"authors": "Patskovsky YV, Patskovska LN, Listowsky I",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-156590",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590"
}
],
"reference": [
{
"type": "PubMed",
"id": "10587441",
"url": "https://glygen.org/publication/PubMed/10587441"
}
]
},
{
"title": "Identification, characterization, and crystal structure of the Omega class glutathione transferases.",
"journal": "The Journal of biological chemistry",
"date": "2000",
"authors": "Board PG, Coggan M, Chelvanayagam G, Easteal S, Jermiin LS, Schulte GK, Danley DE, Hoth LR, Griffor MC, Kamath AV, Rosner MH, Chrunyk BA, Perregaux DE, Gabel CA, Geoghegan KF, Pandit J",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-156590",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590"
}
],
"reference": [
{
"type": "PubMed",
"id": "10783391",
"url": "https://glygen.org/publication/PubMed/10783391"
}
]
},
{
"title": "Characterization of the glutathione S-transferase GSTT1 deletion: discrimination of all genotypes by polymerase chain reaction indicates a trimodular genotype-phenotype correlation.",
"journal": "Pharmacogenetics",
"date": "2000",
"authors": "Sprenger R, Schlagenhaufer R, Kerb R, Bruhn C, Brockm\u00f6ller J, Roots I, Brinkmann U",
"evidence": [
{
"database": "UniProtKB",
"id": "P0CG29",
"url": "https://www.uniprot.org/uniprot/P0CG29"
}
],
"reference": [
{
"type": "PubMed",
"id": "10975610",
"url": "https://glygen.org/publication/PubMed/10975610"
}
]
},
{
"title": "Crystal structure of maleylacetoacetate isomerase/glutathione transferase zeta reveals the molecular basis for its remarkable catalytic promiscuity.",
"journal": "Biochemistry",
"date": "2001",
"authors": "Polekhina G, Board PG, Blackburn AC, Parker MW",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-156590",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590"
}
],
"reference": [
{
"type": "PubMed",
"id": "11327815",
"url": "https://glygen.org/publication/PubMed/11327815"
}
]
},
{
"title": "The 3-D structure of microsomal glutathione transferase 1 at 6 A resolution as determined by electron crystallography of p22(1)2(1) crystals.",
"journal": "Biochimica et biophysica acta",
"date": "2002",
"authors": "Holm PJ, Morgenstern R, Hebert H",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-156590",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590"
}
],
"reference": [
{
"type": "PubMed",
"id": "11904223",
"url": "https://glygen.org/publication/PubMed/11904223"
}
]
},
{
"title": "The human glutathione transferase alpha locus: genomic organization of the gene cluster and functional characterization of the genetic polymorphism in the hGSTA1 promoter.",
"journal": "Pharmacogenetics",
"date": "2002",
"authors": "Morel F, Rauch C, Coles B, Le Ferrec E, Guillouzo A",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-156590",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590"
}
],
"reference": [
{
"type": "PubMed",
"id": "12042665",
"url": "https://glygen.org/publication/PubMed/12042665"
}
]
},
{
"title": "1.3-A resolution structure of human glutathione S-transferase with S-hexyl glutathione bound reveals possible extended ligandin binding site.",
"journal": "Proteins",
"date": "2002",
"authors": "Le Trong I, Stenkamp RE, Ibarra C, Atkins WM, Adman ET",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-156590",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590"
}
],
"reference": [
{
"type": "PubMed",
"id": "12211029",
"url": "https://glygen.org/publication/PubMed/12211029"
}
]
},
{
"title": "Mechanism of metal activation of human hematopoietic prostaglandin D synthase.",
"journal": "Nature structural biology",
"date": "2003",
"authors": "Inoue T, Irikura D, Okazaki N, Kinugasa S, Matsumura H, Uodome N, Yamamoto M, Kumasaka T, Miyano M, Kai Y, Urade Y",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-156590",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590"
}
],
"reference": [
{
"type": "PubMed",
"id": "12627223",
"url": "https://glygen.org/publication/PubMed/12627223"
}
]
},
{
"title": "Characterization of a human class-Theta glutathione S-transferase with activity towards 1-menaphthyl sulphate.",
"journal": "The Biochemical journal",
"date": "1992",
"authors": "Hussey AJ, Hayes JD",
"evidence": [
{
"database": "UniProtKB",
"id": "P0CG29",
"url": "https://www.uniprot.org/uniprot/P0CG29"
}
],
"reference": [
{
"type": "PubMed",
"id": "1417752",
"url": "https://glygen.org/publication/PubMed/1417752"
}
]
},
{
"title": "Gene and protein characterization of the human glutathione S-transferase kappa and evidence for a peroxisomal localization.",
"journal": "The Journal of biological chemistry",
"date": "2004",
"authors": "Morel F, Rauch C, Petit E, Piton A, Theret N, Coles B, Guillouzo A",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-156590",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590"
}
],
"reference": [
{
"type": "PubMed",
"id": "14742434",
"url": "https://glygen.org/publication/PubMed/14742434"
}
]
},
{
"title": "Thioredoxin-like domain of human kappa class glutathione transferase reveals sequence homology and structure similarity to the theta class enzyme.",
"journal": "Protein science : a publication of the Protein Society",
"date": "2005",
"authors": "Li J, Xia Z, Ding J",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-156590",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590"
}
],
"reference": [
{
"type": "PubMed",
"id": "16081649",
"url": "https://glygen.org/publication/PubMed/16081649"
}
]
},
{
"title": "Structural basis of the suppressed catalytic activity of wild-type human glutathione transferase T1-1 compared to its W234R mutant.",
"journal": "Journal of molecular biology",
"date": "2006",
"authors": "Tars K, Larsson AK, Shokeer A, Olin B, Mannervik B, Kleywegt GJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-156590",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590"
}
],
"reference": [
{
"type": "PubMed",
"id": "16298388",
"url": "https://glygen.org/publication/PubMed/16298388"
}
]
},
{
"title": "Transition state model and mechanism of nucleophilic aromatic substitution reactions catalyzed by human glutathione S-transferase M1a-1a.",
"journal": "Biochemistry",
"date": "2006",
"authors": "Patskovsky Y, Patskovska L, Almo SC, Listowsky I",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-156590",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590"
}
],
"reference": [
{
"type": "PubMed",
"id": "16548513",
"url": "https://glygen.org/publication/PubMed/16548513"
}
]
},
{
"title": "Structural basis for featuring of steroid isomerase activity in alpha class glutathione transferases.",
"journal": "Journal of molecular biology",
"date": "2010",
"authors": "Tars K, Olin B, Mannervik B",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-156590",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590"
}
],
"reference": [
{
"type": "PubMed",
"id": "20083122",
"url": "https://glygen.org/publication/PubMed/20083122"
}
]
},
{
"title": "Substrate specificity combined with stereopromiscuity in glutathione transferase A4-4-dependent metabolism of 4-hydroxynonenal.",
"journal": "Biochemistry",
"date": "2010",
"authors": "Balogh LM, Le Trong I, Kripps KA, Shireman LM, Stenkamp RE, Zhang W, Mannervik B, Atkins WM",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-156590",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590"
}
],
"reference": [
{
"type": "PubMed",
"id": "20085333",
"url": "https://glygen.org/publication/PubMed/20085333"
}
]
},
{
"title": "Novel folding and stability defects cause a deficiency of human glutathione transferase omega 1.",
"journal": "The Journal of biological chemistry",
"date": "2011",
"authors": "Zhou H, Brock J, Casarotto MG, Oakley AJ, Board PG",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-156590",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590"
}
],
"reference": [
{
"type": "PubMed",
"id": "21106529",
"url": "https://glygen.org/publication/PubMed/21106529"
}
]
},
{
"title": "Glutathione S-transferase copy number variation alters lung gene expression.",
"journal": "The European respiratory journal",
"date": "2011",
"authors": "Butler MW, Hackett NR, Salit J, Strulovici-Barel Y, Omberg L, Mezey J, Crystal RG",
"evidence": [
{
"database": "RefSeq",
"id": "NP_000845",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_000845"
}
],
"reference": [
{
"type": "PubMed",
"id": "21349909",
"url": "https://glygen.org/publication/PubMed/21349909"
}
]
},
{
"title": "Impact of polyphenol metabolites produced by colonic microbiota on expression of COX-2 and GSTT2 in human colon cells (LT97).",
"journal": "Nutrition and cancer",
"date": "2011",
"authors": "Miene C, Weise A, Glei M",
"evidence": [
{
"database": "RefSeq",
"id": "NP_000845",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_000845"
}
],
"reference": [
{
"type": "PubMed",
"id": "21598179",
"url": "https://glygen.org/publication/PubMed/21598179"
}
]
},
{
"title": "Glutathione-S-transferase P1 is a critical regulator of Cdk5 kinase activity.",
"journal": "Journal of neurochemistry",
"date": "2011",
"authors": "Sun KH, Chang KH, Clawson S, Ghosh S, Mirzaei H, Regnier F, Shah K",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-156590",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590"
}
],
"reference": [
{
"type": "PubMed",
"id": "21668448",
"url": "https://glygen.org/publication/PubMed/21668448"
}
]
},
{
"title": "Structural insights into the dehydroascorbate reductase activity of human omega-class glutathione transferases.",
"journal": "Journal of molecular biology",
"date": "2012",
"authors": "Zhou H, Brock J, Liu D, Board PG, Oakley AJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-156590",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590"
}
],
"reference": [
{
"type": "PubMed",
"id": "22522127",
"url": "https://glygen.org/publication/PubMed/22522127"
}
]
},
{
"title": "The Role of Human Aldo-Keto Reductases in the Metabolic Activation and Detoxication of Polycyclic Aromatic Hydrocarbons: Interconversion of PAH Catechols and PAH o-Quinones.",
"journal": "Frontiers in pharmacology",
"date": "2012",
"authors": "Zhang L, Jin Y, Huang M, Penning TM",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-156590",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590"
}
],
"reference": [
{
"type": "PubMed",
"id": "23162467",
"url": "https://glygen.org/publication/PubMed/23162467"
}
]
},
{
"title": "Constitutively Higher Level of GSTT2 in Esophageal Tissues From African Americans Protects Cells Against DNA Damage.",
"journal": "Gastroenterology",
"date": "2019",
"authors": "Ferrer-Torres D, Nancarrow DJ, Steinberg H, Wang Z, Kuick R, Weh KM, Mills RE, Ray D, Ray P, Lin J, Chang AC, Reddy RM, Orringer MB, Canto MI, Shaheen NJ, Kresty LA, Chak A, Wang TD, Rubenstein JH, Beer DG",
"evidence": [
{
"database": "RefSeq",
"id": "NP_000845",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_000845"
}
],
"reference": [
{
"type": "PubMed",
"id": "30578782",
"url": "https://glygen.org/publication/PubMed/30578782"
}
]
},
{
"title": "Gene expression of rat and human microsomal glutathione S-transferases.",
"journal": "The Journal of biological chemistry",
"date": "1988",
"authors": "DeJong JL, Morgenstern R, Jornvall H, DePierre JW, Tu CP",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-156590",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590"
}
],
"reference": [
{
"type": "PubMed",
"id": "3372534",
"url": "https://glygen.org/publication/PubMed/3372534"
}
]
},
{
"title": "Proanthocyanidins mitigate bile acid-induced changes in GSTT2 levels in a panel of racially diverse patient-derived primary esophageal cell cultures.",
"journal": "Molecular carcinogenesis",
"date": "2022",
"authors": "Weh KM, Turgeon DK, Rubenstein JH, Clarke JL, Howell AB, Chang AC, Kresty LA",
"evidence": [
{
"database": "RefSeq",
"id": "NP_000845",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_000845"
}
],
"reference": [
{
"type": "PubMed",
"id": "34758158",
"url": "https://glygen.org/publication/PubMed/34758158"
}
]
},
{
"title": "Identity of the polymorphisms for esterase D and S-formylglutathione hydrolase in red blood cells.",
"journal": "Human genetics",
"date": "1986",
"authors": "Eiberg H, Mohr J",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-156590",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590"
}
],
"reference": [
{
"type": "PubMed",
"id": "3770744",
"url": "https://glygen.org/publication/PubMed/3770744"
}
]
},
{
"title": "Esterase D: a new human polymorphism.",
"journal": "Annals of human genetics",
"date": "1973",
"authors": "Hopkinson DA, Mestriner MA, Cortner J, Harris H",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-156590",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590"
}
],
"reference": [
{
"type": "PubMed",
"id": "4768551",
"url": "https://glygen.org/publication/PubMed/4768551"
}
]
},
{
"title": "Crystal structure of human class mu glutathione transferase GSTM2-2. Effects of lattice packing on conformational heterogeneity.",
"journal": "Journal of molecular biology",
"date": "1994",
"authors": "Raghunathan S, Chandross RJ, Kretsinger RH, Allison TJ, Penington CJ, Rule GS",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-156590",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590"
}
],
"reference": [
{
"type": "PubMed",
"id": "8182750",
"url": "https://glygen.org/publication/PubMed/8182750"
}
]
},
{
"title": "A comparison of the enzymatic and physicochemical properties of human glutathione transferase M4-4 and three other human Mu class enzymes.",
"journal": "Archives of biochemistry and biophysics",
"date": "1994",
"authors": "Comstock KE, Widersten M, Hao XY, Henner WD, Mannervik B",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-156590",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590"
}
],
"reference": [
{
"type": "PubMed",
"id": "8203914",
"url": "https://glygen.org/publication/PubMed/8203914"
}
]
},
{
"title": "Structure determination and refinement of human alpha class glutathione transferase A1-1, and a comparison with the Mu and Pi class enzymes.",
"journal": "Journal of molecular biology",
"date": "1993",
"authors": "Sinning I, Kleywegt GJ, Cowan SW, Reinemer P, Dirr HW, Huber R, Gilliland GL, Armstrong RN, Ji X, Board PG, et al.",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-156590",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590"
}
],
"reference": [
{
"type": "PubMed",
"id": "8331657",
"url": "https://glygen.org/publication/PubMed/8331657"
}
]
},
{
"title": "Characterization of two novel subunits of the alpha-class glutathione S-transferases of human liver.",
"journal": "Biochimica et biophysica acta",
"date": "1993",
"authors": "Ahmad H, Singhal SS, Saxena M, Awasthi YC",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-156590",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590"
}
],
"reference": [
{
"type": "PubMed",
"id": "8431482",
"url": "https://glygen.org/publication/PubMed/8431482"
}
]
},
{
"title": "Identification and characterization of a novel human microsomal glutathione S-transferase with leukotriene C4 synthase activity and significant sequence identity to 5-lipoxygenase-activating protein and leukotriene C4 synthase.",
"journal": "The Journal of biological chemistry",
"date": "1996",
"authors": "Jakobsson PJ, Mancini JA, Ford-Hutchinson AW",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-156590",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590"
}
],
"reference": [
{
"type": "PubMed",
"id": "8703034",
"url": "https://glygen.org/publication/PubMed/8703034"
}
]
},
{
"title": "The distribution of theta-class glutathione S-transferases in the liver and lung of mouse, rat and human.",
"journal": "Biochem. J.",
"date": "1996",
"authors": "Mainwaring GW, Williams SM, Foster JR, Tugwood J, Green T",
"evidence": [
{
"database": "UniProtKB",
"id": "P0CG29",
"url": "https://www.uniprot.org/uniprot/P0CG29"
}
],
"reference": [
{
"type": "PubMed",
"id": "8761485",
"url": "https://glygen.org/publication/PubMed/8761485"
}
]
},
{
"title": "Structural organization of the human microsomal glutathione S-transferase gene (GST12).",
"journal": "Genomics",
"date": "1996",
"authors": "Kelner MJ, Stokely MN, Stovall NE, Montoya MA",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-156590",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590"
}
],
"reference": [
{
"type": "PubMed",
"id": "8812420",
"url": "https://glygen.org/publication/PubMed/8812420"
}
]
},
{
"title": "Identification and characterization of a novel microsomal enzyme with glutathione-dependent transferase and peroxidase activities.",
"journal": "The Journal of biological chemistry",
"date": "1997",
"authors": "Jakobsson PJ, Mancini JA, Riendeau D, Ford-Hutchinson AW",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-156590",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590"
}
],
"reference": [
{
"type": "PubMed",
"id": "9278457",
"url": "https://glygen.org/publication/PubMed/9278457"
}
]
},
{
"title": "Human theta class glutathione transferase: the crystal structure reveals a sulfate-binding pocket within a buried active site.",
"journal": "Structure (London, England : 1993)",
"date": "1998",
"authors": "Rossjohn J, McKinstry WJ, Oakley AJ, Verger D, Flanagan J, Chelvanayagam G, Tan KL, Board PG, Parker MW",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-156590",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590"
}
],
"reference": [
{
"type": "PubMed",
"id": "9551553",
"url": "https://glygen.org/publication/PubMed/9551553"
}
]
},
{
"title": "Purification and characterization of a novel alpha-class glutathione transferase from human liver.",
"journal": "The international journal of biochemistry & cell biology",
"date": "1998",
"authors": "Pastore A, Lo Bello M, Aureli G, Federici G, Ricci G, Di Ilio C, Petruzzelli R",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-156590",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590"
}
],
"reference": [
{
"type": "PubMed",
"id": "9839448",
"url": "https://glygen.org/publication/PubMed/9839448"
}
]
}
],
"pathway": [
{
"id": "hsa:2953",
"name": "",
"url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:2953",
"resource": "KEGG Pathway"
},
{
"id": "R-HSA-156590",
"name": "Glutathione conjugation",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590",
"resource": "Reactome",
"description": "Glutathione conjugation"
}
],
"orthologs": [
{
"uniprot_canonical_ac": "P0CG30-1",
"protein_name": "Glutathione S-transferase theta-2B",
"gene_name": "GSTT2B",
"tax_id": 9606,
"organism": "Homo sapiens",
"sequence": {
"sequence": "MGLELFLDLVSQPSRAVYIFAKKNGIPLELRTVDLVKGQHKSKEFLQINSLGKLPTLKDGDFILTESSAILIYLSCKYQTPDHWYPSDLQARARVHEYLGWHADCIRGTFGIPLWVQVLGPLIGVQVPEEKVERNRTAMDQALQWLEDKFLGDRPFLAGQQVTLADLMALEELMQPVALGYELFEGRPRLAAWRGRVEAFLGAELCQEAHSIILSILEQAAKKTLPTPSPEAYQAMLLRIARIP",
"length": 244
},
"evidence": [
{
"id": "45921115",
"url": "http://www.informatics.jax.org/homology/45921115",
"database": "MGI"
}
],
"common_name": "Human"
},
{
"uniprot_canonical_ac": "P30713-1",
"protein_name": "Glutathione S-transferase theta-2",
"gene_name": "Gstt2",
"tax_id": 10116,
"organism": "Rattus norvegicus",
"sequence": {
"sequence": "MGLELYLDLLSQPSRAVYIFAKKNGIPFQLRTVDLLKGQHLSEQFSQVNCLKKVPVLKDGSFVLTESTAILIYLSSKYQVADHWYPADLQARAQVHEYLGWHADNIRGTFGVLLWTKVLGPLIGVQVPEEKVERNRNSMVLALQRLEDKFLRDRAFIAGQQVTLADLMSLEELIQPVALGCNLFEGRPQLTAWRERVEAFLGAELCQEAHNPIMSVLGQAAKKTLPVPPPEAHASMMLRIARIP",
"length": 244
},
"evidence": [
{
"id": "45921115",
"url": "http://www.informatics.jax.org/homology/45921115",
"database": "MGI"
}
],
"common_name": "Rat"
},
{
"uniprot_canonical_ac": "Q61133-1",
"protein_name": "Glutathione S-transferase theta-2",
"gene_name": "Gstt2",
"tax_id": 10090,
"organism": "Mus musculus",
"sequence": {
"sequence": "MGLELYLDLLSQPSRAVYIFAKKNGIPFQTRTVDILKGQHMSEQFSQVNCLNKVPVLKDGSFVLTESTAILIYLSSKYQVADHWYPADLQARAQVHEYLGWHADNIRGTFGVLLWTKVLGPLIGVQVPQEKVERNRDRMVLVLQQLEDKFLRDRAFLVGQQVTLADLMSLEELMQPVALGYNLFEGRPQLTAWRERVEAFLGAELCQEAHSTILSILGQAAKKMLPVPPPEVHASMQLRIARIP",
"length": 244
},
"evidence": [
{
"id": "45921115",
"url": "http://www.informatics.jax.org/homology/45921115",
"database": "MGI"
}
],
"common_name": "Mouse"
}
],
"go_annotation": {
"categories": [
{
"name": "Molecular Function",
"total": 1,
"go_terms": [
{
"name": "glutathione transferase activity",
"id": "GO:0004364",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004364",
"evidence": [
{
"database": "UniProtKB",
"id": "P0CG29",
"url": "https://www.uniprot.org/uniprot/P0CG29"
}
],
"pmid": ""
}
]
},
{
"name": "Cellular Component",
"total": 4,
"go_terms": [
{
"name": "nucleus",
"id": "GO:0005634",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634",
"evidence": [
{
"database": "UniProtKB",
"id": "P0CG29",
"url": "https://www.uniprot.org/uniprot/P0CG29"
}
],
"pmid": ""
},
{
"name": "cytoplasm",
"id": "GO:0005737",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737",
"evidence": [
{
"database": "UniProtKB",
"id": "P0CG29",
"url": "https://www.uniprot.org/uniprot/P0CG29"
}
],
"pmid": ""
},
{
"name": "cytosol",
"id": "GO:0005829",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829",
"evidence": [
{
"database": "UniProtKB",
"id": "P0CG29",
"url": "https://www.uniprot.org/uniprot/P0CG29"
}
],
"pmid": ""
},
{
"name": "extracellular exosome",
"id": "GO:0070062",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070062",
"evidence": [
{
"database": "UniProtKB",
"id": "P0CG29",
"url": "https://www.uniprot.org/uniprot/P0CG29"
}
],
"pmid": ""
}
]
},
{
"name": "Biological Process",
"total": 1,
"go_terms": [
{
"name": "glutathione metabolic process",
"id": "GO:0006749",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006749",
"evidence": [
{
"database": "UniProtKB",
"id": "P0CG29",
"url": "https://www.uniprot.org/uniprot/P0CG29"
}
],
"pmid": ""
}
]
}
]
},
"pro_annotation": [],
"site_annotation": [
{
"start_pos": 135,
"end_pos": 137,
"annotation": "n_glycosylation_sequon"
}
],
"ptm_annotation": [],
"interactions": [],
"reactions": [
{
"id": "16437",
"name": "",
"equation": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+)",
"summary": "",
"cellular_location": "",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P04904-1",
"P46418-1",
"P24473-1",
"P30713-1",
"Q6AXY0-1",
"Q9QX69-1",
"O35543-1",
"Q9Z339-1",
"P08009-1",
"P14942-1",
"Q9Z1B2-1",
"Q6AXV9-1",
"Q5BK56-1",
"P00502-1",
"P04903-1",
"P04905-1",
"P04906-1",
"P57113-1",
"Q01579-1",
"P08010-1",
"P08011-1",
"Q4V8E6-1",
"A0A0G2K4Q5-1",
"F1LXL7-1",
"Q9Y2Q3-1",
"Q9H4Y5-1",
"P46439-1",
"Q03013-1",
"P78417-1",
"P08263-1",
"P0CG30-1",
"P09488-1",
"Q7RTV2-1",
"Q16772-1",
"P28161-1",
"P0CG29-1",
"O60760-1",
"P09211-1",
"P30711-1",
"P09210-1",
"O15217-1",
"O43813-1",
"P21266-1",
"P10620-1",
"O43708-1",
"Q99735-1",
"A0A1W2PR19-1",
"F6RWR5-1",
"Q9JHF7-1",
"E9Q6L7-1",
"Q9WVL0-1",
"O35660-1",
"P46425-1",
"P19639-1",
"P48774-1",
"Q9DCM2-1",
"Q99L20-1",
"O09131-1",
"P24472-1",
"P19157-1",
"Q61133-1",
"Q8K2Q2-1",
"Q80W21-1",
"O89112-1",
"P10648-1",
"P13745-1",
"P15626-1",
"P30115-1",
"P10649-1",
"Q64471-1",
"Q9D4P7-1",
"Q91VS7-1",
"Q6P8Q0-1",
"A2RST1-1",
"Q8R5I6-1",
"P17695-1",
"P25373-1",
"P36156-1",
"P40582-1",
"P48239-1",
"Q04806-1",
"Q12390-1",
"Q54GA9-1",
"Q54QV7-1",
"Q54VI4-1",
"Q55FF3-1",
"Q86AU1-1",
"Q556G3-1",
"Q9VG94-1",
"Q9VG96-1",
"Q7JYX0-1",
"P41043-1",
"P20432-1",
"Q9VG95-1",
"Q9VG98-1",
"Q9VG93-1",
"Q9VHD3-1",
"Q9VHD2-1"
],
"evidence": [
{
"id": "16437",
"database": "Rhea",
"url": "https://www.rhea-db.org/rhea/16437"
}
]
},
{
"id": "R-HSA-176054",
"name": "GST dimers conjugate GSH with cytosolic substrates",
"equation": "",
"summary": "The glutathione S-transferases (GSTs) catalyze the nucleophilic attack by reduced glutathione (GSH) on nonpolar compounds that contain an electrophilic carbon, nitrogen, or sulphur atom. Their substrates include halogenonitrobenzenes, arene oxides, quinones, and alpha, beta-unsaturated carbonyls. Three major families of proteins are widely distributed in nature. Two of these, the cytosolic and mitochondrial GST, comprise soluble enzymes that are only distantly related whilst the third family comprises microsomal GST, referred to as membrane-associated proteins in eicosanoid and glutathione (MAPEG) metabolism.
At least 16 cytosolic GST subunits exist in human which are all in a dimeric form. Based on amino acid sequence similarities, seven classes of cytosolic GST are recognized in mammalian species; Alpha, Mu, Pi, Sigma, Theta, Omega, and Zeta (2\u20135). As well as being homodimers, the Alpha and Mu classes are also able to form heterodimers so a large number of isozymes are possible from all cytosolic GST subunits (Sinning et al. 1993, LeTrong et al. 2002, Ahmad et al. 1993, Pastore et al. 1998, Tars et al. 2010, Bruns et al. 1999, Balogh et al. 2010, Morel et al. 2002, Li et al. 2005, Patskovsky et al. 2006, Raghunathan et al. 1994, Patskovsky et al. 1999, Comstock et al. 1994, Board et al. 2000, Zhou et al. 2011, Zhou et al. 2012, Sun et al. 2011, Tars et al. 2006, Rossjohn et al. 1998, Polekhina et al. 2001, Inoue et al. 2003). Typical electrophilic substrates are chosen as examples for which the majority of the cytosolic GST isozymes act on.",
"cellular_location": "cytosol",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P09210-1",
"Q16772-1",
"P0CG29-1",
"P78417-1",
"Q7RTV2-1",
"O60760-1",
"P46439-1",
"Q9H4Y5-1",
"P30711-1",
"P09211-1",
"O15217-1",
"P08263-1",
"P0CG30-1",
"P21266-1",
"O43708-1",
"P09488-1",
"P28161-1",
"Q03013-1"
],
"evidence": [
{
"id": "R-HSA-176054",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-176054"
}
]
}
],
"reaction_participants": [],
"reaction_enzymes": [
{
"uniprot_ac": "A0A0G2K4Q5",
"gene_name": "Gstp3",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "A0A0G2K4Q5",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/A0A0G2K4Q5"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "A0A0G2K4Q5",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/A0A0G2K4Q5"
}
]
}
]
},
{
"uniprot_ac": "A0A1W2PR19",
"gene_name": "GSTT4",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "A0A1W2PR19",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/A0A1W2PR19"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "A0A1W2PR19",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/A0A1W2PR19"
}
]
}
]
},
{
"uniprot_ac": "A2RST1",
"gene_name": "Mgst2",
"activity": [
{
"ec_number": "1.11.1.-",
"activity": "",
"evidence": [
{
"id": "A2RST1",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/A2RST1"
}
]
},
{
"ec_number": "4.4.1.20",
"activity": "leukotriene C4 = glutathione + leukotriene A4.",
"evidence": [
{
"id": "A2RST1",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/A2RST1"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "A2RST1",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/A2RST1"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "A2RST1",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/A2RST1"
}
]
}
]
},
{
"uniprot_ac": "E9Q6L7",
"gene_name": "Gsta5",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "E9Q6L7",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/E9Q6L7"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "E9Q6L7",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/E9Q6L7"
}
]
}
]
},
{
"uniprot_ac": "F1LXL7",
"gene_name": "AC097845.1",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "F1LXL7",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/F1LXL7"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "F1LXL7",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/F1LXL7"
}
]
}
]
},
{
"uniprot_ac": "F6RWR5",
"gene_name": "Gstp3",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "F6RWR5",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/F6RWR5"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "F6RWR5",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/F6RWR5"
}
]
}
]
},
{
"uniprot_ac": "O09131",
"gene_name": "Gsto1",
"activity": [
{
"ec_number": "1.20.4.2",
"activity": "2 glutathione + H(+) + methylarsonate = glutathione disulfide + H2O + methylarsonous acid.",
"evidence": [
{
"id": "O09131",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O09131"
}
]
},
{
"ec_number": "1.8.5.1",
"activity": "2 glutathione + L-dehydroascorbate = glutathione disulfide + L-ascorbate.",
"evidence": [
{
"id": "O09131",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O09131"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "O09131",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O09131"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "O09131",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O09131"
}
]
},
{
"ec_number": "1.20.4.2",
"activity": "",
"evidence": [
{
"id": "O09131",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O09131"
}
]
},
{
"ec_number": "1.8.5.1",
"activity": "",
"evidence": [
{
"id": "O09131",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O09131"
}
]
}
]
},
{
"uniprot_ac": "O15217",
"gene_name": "GSTA4",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "O15217",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O15217"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "O15217",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O15217"
}
]
}
]
},
{
"uniprot_ac": "O35543",
"gene_name": "Hpgds",
"activity": [
{
"ec_number": "5.3.99.2",
"activity": "prostaglandin H2 = prostaglandin D2.",
"evidence": [
{
"id": "O35543",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O35543"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "O35543",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O35543"
}
]
},
{
"ec_number": "5.3.99.2",
"activity": "",
"evidence": [
{
"id": "O35543",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O35543"
}
]
}
]
},
{
"uniprot_ac": "O35660",
"gene_name": "Gstm6",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "O35660",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O35660"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "O35660",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O35660"
}
]
}
]
},
{
"uniprot_ac": "O43708",
"gene_name": "GSTZ1",
"activity": [
{
"ec_number": "5.2.1.2",
"activity": "4-maleylacetoacetate = 4-fumarylacetoacetate.",
"evidence": [
{
"id": "O43708",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O43708"
}
]
},
{
"ec_number": "5.2.1.2",
"activity": "",
"evidence": [
{
"id": "O43708",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O43708"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "O43708",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O43708"
}
]
}
]
},
{
"uniprot_ac": "O43813",
"gene_name": "LANCL1",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "O43813",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O43813"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "O43813",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O43813"
}
]
}
]
},
{
"uniprot_ac": "O60760",
"gene_name": "HPGDS",
"activity": [
{
"ec_number": "5.3.99.2",
"activity": "prostaglandin H2 = prostaglandin D2.",
"evidence": [
{
"id": "O60760",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O60760"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "O60760",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O60760"
}
]
},
{
"ec_number": "5.3.99.2",
"activity": "",
"evidence": [
{
"id": "O60760",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O60760"
}
]
}
]
},
{
"uniprot_ac": "O89112",
"gene_name": "Lancl1",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "O89112",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O89112"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "O89112",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O89112"
}
]
}
]
},
{
"uniprot_ac": "P00502",
"gene_name": "Gsta1",
"activity": [
{
"ec_number": "1.11.1.-",
"activity": "",
"evidence": [
{
"id": "P00502",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P00502"
}
]
},
{
"ec_number": "5.3.3.-",
"activity": "",
"evidence": [
{
"id": "P00502",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P00502"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "P00502",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P00502"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "P00502",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P00502"
}
]
}
]
},
{
"uniprot_ac": "P04903",
"gene_name": "Gsta2",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "P04903",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P04903"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "P04903",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P04903"
}
]
}
]
},
{
"uniprot_ac": "P04904",
"gene_name": "Gsta3",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "P04904",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P04904"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "P04904",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P04904"
}
]
}
]
},
{
"uniprot_ac": "P04905",
"gene_name": "Gstm1",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "P04905",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P04905"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "P04905",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P04905"
}
]
}
]
},
{
"uniprot_ac": "P04906",
"gene_name": "Gstp1",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "P04906",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P04906"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "P04906",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P04906"
}
]
}
]
},
{
"uniprot_ac": "P08009",
"gene_name": "Gstm7",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "P08009",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P08009"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "P08009",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P08009"
}
]
}
]
},
{
"uniprot_ac": "P08010",
"gene_name": "Gstm2",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "P08010",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P08010"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "P08010",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P08010"
}
]
}
]
},
{
"uniprot_ac": "P08011",
"gene_name": "Mgst1",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "P08011",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P08011"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "P08011",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P08011"
}
]
}
]
},
{
"uniprot_ac": "P08263",
"gene_name": "GSTA1",
"activity": [
{
"ec_number": "1.11.1.-",
"activity": "",
"evidence": [
{
"id": "P08263",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P08263"
}
]
},
{
"ec_number": "5.3.3.-",
"activity": "",
"evidence": [
{
"id": "P08263",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P08263"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "P08263",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P08263"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "P08263",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P08263"
}
]
}
]
},
{
"uniprot_ac": "P09210",
"gene_name": "GSTA2",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "P09210",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P09210"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "P09210",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P09210"
}
]
}
]
},
{
"uniprot_ac": "P09211",
"gene_name": "GSTP1",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "P09211",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P09211"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "P09211",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P09211"
}
]
}
]
},
{
"uniprot_ac": "P09488",
"gene_name": "GSTM1",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "P09488",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P09488"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "P09488",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P09488"
}
]
}
]
},
{
"uniprot_ac": "P0CG29",
"gene_name": "GSTT2",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "P0CG29",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P0CG29"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "P0CG29",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P0CG29"
}
]
}
]
},
{
"uniprot_ac": "P0CG30",
"gene_name": "GSTT2B",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "P0CG30",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P0CG30"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "P0CG30",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P0CG30"
}
]
}
]
},
{
"uniprot_ac": "P10620",
"gene_name": "MGST1",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "P10620",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P10620"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "P10620",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P10620"
}
]
}
]
},
{
"uniprot_ac": "P10648",
"gene_name": "Gsta2",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "P10648",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P10648"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "P10648",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P10648"
}
]
}
]
},
{
"uniprot_ac": "P10649",
"gene_name": "Gstm1",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "P10649",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P10649"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "P10649",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P10649"
}
]
}
]
},
{
"uniprot_ac": "P13745",
"gene_name": "Gsta1",
"activity": [
{
"ec_number": "1.11.1.-",
"activity": "",
"evidence": [
{
"id": "P13745",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P13745"
}
]
},
{
"ec_number": "5.3.3.-",
"activity": "",
"evidence": [
{
"id": "P13745",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P13745"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "P13745",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P13745"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "P13745",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P13745"
}
]
}
]
},
{
"uniprot_ac": "P14942",
"gene_name": "Gsta4",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "P14942",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P14942"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "P14942",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P14942"
}
]
}
]
},
{
"uniprot_ac": "P15626",
"gene_name": "Gstm2",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "P15626",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P15626"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "P15626",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P15626"
}
]
}
]
},
{
"uniprot_ac": "P17695",
"gene_name": "GRX2",
"activity": [
{
"ec_number": "1.11.1.9",
"activity": "2 glutathione + H2O2 = glutathione disulfide + 2 H2O.",
"evidence": [
{
"id": "P17695",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P17695"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "P17695",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P17695"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "P17695",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P17695"
}
]
},
{
"ec_number": "1.11.1.9",
"activity": "",
"evidence": [
{
"id": "P17695",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P17695"
}
]
}
]
},
{
"uniprot_ac": "P19157",
"gene_name": "Gstp1",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "P19157",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P19157"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "P19157",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P19157"
}
]
}
]
},
{
"uniprot_ac": "P19639",
"gene_name": "Gstm3",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "P19639",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P19639"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "P19639",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P19639"
}
]
}
]
},
{
"uniprot_ac": "P20432",
"gene_name": "GstD1",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "P20432",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P20432"
}
]
},
{
"ec_number": "4.5.1.1",
"activity": "1,1,1-trichloro-2,2-bis(4-chlorophenyl)ethane = 1,1-dichloro-2,2-bis(4-chlorophenyl)ethylene + chloride + H(+).",
"evidence": [
{
"id": "P20432",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P20432"
}
]
},
{
"ec_number": "4.5.1.1",
"activity": "",
"evidence": [
{
"id": "P20432",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P20432"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "P20432",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P20432"
}
]
}
]
},
{
"uniprot_ac": "P21266",
"gene_name": "GSTM3",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "P21266",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P21266"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "P21266",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P21266"
}
]
}
]
},
{
"uniprot_ac": "P24472",
"gene_name": "Gsta4",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "P24472",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P24472"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "P24472",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P24472"
}
]
}
]
},
{
"uniprot_ac": "P24473",
"gene_name": "Gstk1",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "P24473",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P24473"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "P24473",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P24473"
}
]
}
]
},
{
"uniprot_ac": "P25373",
"gene_name": "GRX1",
"activity": [
{
"ec_number": "1.11.1.9",
"activity": "2 glutathione + H2O2 = glutathione disulfide + 2 H2O.",
"evidence": [
{
"id": "P25373",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P25373"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "P25373",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P25373"
}
]
},
{
"ec_number": "1.11.1.9",
"activity": "",
"evidence": [
{
"id": "P25373",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P25373"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "P25373",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P25373"
}
]
}
]
},
{
"uniprot_ac": "P28161",
"gene_name": "GSTM2",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "P28161",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P28161"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "P28161",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P28161"
}
]
}
]
},
{
"uniprot_ac": "P30115",
"gene_name": "Gsta3",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "P30115",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P30115"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "P30115",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P30115"
}
]
}
]
},
{
"uniprot_ac": "P30711",
"gene_name": "GSTT1",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "P30711",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P30711"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "P30711",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P30711"
}
]
}
]
},
{
"uniprot_ac": "P30713",
"gene_name": "Gstt2",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "P30713",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P30713"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "P30713",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P30713"
}
]
}
]
},
{
"uniprot_ac": "P36156",
"gene_name": "ECM4",
"activity": [
{
"ec_number": "1.8.5.1",
"activity": "2 glutathione + L-dehydroascorbate = glutathione disulfide + L-ascorbate.",
"evidence": [
{
"id": "P36156",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P36156"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "P36156",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P36156"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "P36156",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P36156"
}
]
}
]
},
{
"uniprot_ac": "P40582",
"gene_name": "GTT1",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "P40582",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P40582"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "P40582",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P40582"
}
]
}
]
},
{
"uniprot_ac": "P41043",
"gene_name": "GstS1",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "P41043",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P41043"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "P41043",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P41043"
}
]
}
]
},
{
"uniprot_ac": "P46418",
"gene_name": "Gsta5",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "P46418",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P46418"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "P46418",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P46418"
}
]
}
]
},
{
"uniprot_ac": "P46425",
"gene_name": "Gstp2",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "P46425",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P46425"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "P46425",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P46425"
}
]
}
]
},
{
"uniprot_ac": "P46439",
"gene_name": "GSTM5",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "P46439",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P46439"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "P46439",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P46439"
}
]
}
]
},
{
"uniprot_ac": "P48239",
"gene_name": "GTO1",
"activity": [
{
"ec_number": "1.8.5.1",
"activity": "2 glutathione + L-dehydroascorbate = glutathione disulfide + L-ascorbate.",
"evidence": [
{
"id": "P48239",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P48239"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "P48239",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P48239"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "P48239",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P48239"
}
]
}
]
},
{
"uniprot_ac": "P48774",
"gene_name": "Gstm5",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "P48774",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P48774"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "P48774",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P48774"
}
]
}
]
},
{
"uniprot_ac": "P57113",
"gene_name": "Gstz1",
"activity": [
{
"ec_number": "5.2.1.2",
"activity": "4-maleylacetoacetate = 4-fumarylacetoacetate.",
"evidence": [
{
"id": "P57113",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P57113"
}
]
},
{
"ec_number": "5.2.1.2",
"activity": "",
"evidence": [
{
"id": "P57113",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P57113"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "P57113",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P57113"
}
]
}
]
},
{
"uniprot_ac": "P78417",
"gene_name": "GSTO1",
"activity": [
{
"ec_number": "1.20.4.2",
"activity": "2 glutathione + H(+) + methylarsonate = glutathione disulfide + H2O + methylarsonous acid.",
"evidence": [
{
"id": "P78417",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P78417"
}
]
},
{
"ec_number": "1.8.5.1",
"activity": "2 glutathione + L-dehydroascorbate = glutathione disulfide + L-ascorbate.",
"evidence": [
{
"id": "P78417",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P78417"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "P78417",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P78417"
}
]
},
{
"ec_number": "1.20.4.2",
"activity": "",
"evidence": [
{
"id": "P78417",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P78417"
}
]
},
{
"ec_number": "1.8.5.1",
"activity": "",
"evidence": [
{
"id": "P78417",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P78417"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "P78417",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P78417"
}
]
}
]
},
{
"uniprot_ac": "Q01579",
"gene_name": "Gstt1",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "Q01579",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q01579"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "Q01579",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q01579"
}
]
}
]
},
{
"uniprot_ac": "Q03013",
"gene_name": "GSTM4",
"activity": [
{
"ec_number": "4.4.1.20",
"activity": "leukotriene C4 = glutathione + leukotriene A4.",
"evidence": [
{
"id": "Q03013",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q03013"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "Q03013",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q03013"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "Q03013",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q03013"
}
]
}
]
},
{
"uniprot_ac": "Q04806",
"gene_name": "GTO3",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "Q04806",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q04806"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "Q04806",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q04806"
}
]
}
]
},
{
"uniprot_ac": "Q12390",
"gene_name": "GTT2",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "Q12390",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q12390"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "Q12390",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q12390"
}
]
}
]
},
{
"uniprot_ac": "Q16772",
"gene_name": "GSTA3",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "Q16772",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q16772"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "Q16772",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q16772"
}
]
}
]
},
{
"uniprot_ac": "Q4V8E6",
"gene_name": "Gstt4",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "Q4V8E6",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q4V8E6"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "Q4V8E6",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q4V8E6"
}
]
}
]
},
{
"uniprot_ac": "Q54GA9",
"gene_name": "mgst",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "Q54GA9",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q54GA9"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "Q54GA9",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q54GA9"
}
]
}
]
},
{
"uniprot_ac": "Q54QV7",
"gene_name": "gsta5",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "Q54QV7",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q54QV7"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "Q54QV7",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q54QV7"
}
]
}
]
},
{
"uniprot_ac": "Q54VI4",
"gene_name": "gsta3",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "Q54VI4",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q54VI4"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "Q54VI4",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q54VI4"
}
]
}
]
},
{
"uniprot_ac": "Q556G3",
"gene_name": "gsta2-2",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "Q556G3",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q556G3"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "Q556G3",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q556G3"
}
]
}
]
},
{
"uniprot_ac": "Q55FF3",
"gene_name": "gsta1",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "Q55FF3",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q55FF3"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "Q55FF3",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q55FF3"
}
]
}
]
},
{
"uniprot_ac": "Q5BK56",
"gene_name": "Gstm4",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "Q5BK56",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q5BK56"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "Q5BK56",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q5BK56"
}
]
},
{
"ec_number": "4.4.1.20",
"activity": "leukotriene C4 = glutathione + leukotriene A4.",
"evidence": [
{
"id": "Q5BK56",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q5BK56"
}
]
}
]
},
{
"uniprot_ac": "Q61133",
"gene_name": "Gstt2",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "Q61133",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q61133"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "Q61133",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q61133"
}
]
}
]
},
{
"uniprot_ac": "Q64471",
"gene_name": "Gstt1",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "Q64471",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q64471"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "Q64471",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q64471"
}
]
}
]
},
{
"uniprot_ac": "Q6AXV9",
"gene_name": "Gsto2",
"activity": [
{
"ec_number": "1.20.4.2",
"activity": "2 glutathione + H(+) + methylarsonate = glutathione disulfide + H2O + methylarsonous acid.",
"evidence": [
{
"id": "Q6AXV9",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q6AXV9"
}
]
},
{
"ec_number": "1.8.5.1",
"activity": "2 glutathione + L-dehydroascorbate = glutathione disulfide + L-ascorbate.",
"evidence": [
{
"id": "Q6AXV9",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q6AXV9"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "Q6AXV9",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q6AXV9"
}
]
},
{
"ec_number": "1.20.4.2",
"activity": "",
"evidence": [
{
"id": "Q6AXV9",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q6AXV9"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "Q6AXV9",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q6AXV9"
}
]
},
{
"ec_number": "1.8.5.1",
"activity": "",
"evidence": [
{
"id": "Q6AXV9",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q6AXV9"
}
]
}
]
},
{
"uniprot_ac": "Q6AXY0",
"gene_name": "Gsta6",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "Q6AXY0",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q6AXY0"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "Q6AXY0",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q6AXY0"
}
]
}
]
},
{
"uniprot_ac": "Q6P8Q0",
"gene_name": "Gm3776",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "Q6P8Q0",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q6P8Q0"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "Q6P8Q0",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q6P8Q0"
}
]
}
]
},
{
"uniprot_ac": "Q7JYX0",
"gene_name": "GstE14",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "Q7JYX0",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q7JYX0"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "Q7JYX0",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q7JYX0"
}
]
}
]
},
{
"uniprot_ac": "Q7RTV2",
"gene_name": "GSTA5",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "Q7RTV2",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q7RTV2"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "Q7RTV2",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q7RTV2"
}
]
}
]
},
{
"uniprot_ac": "Q80W21",
"gene_name": "Gstm7",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "Q80W21",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q80W21"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "Q80W21",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q80W21"
}
]
}
]
},
{
"uniprot_ac": "Q86AU1",
"gene_name": "gsta4",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "Q86AU1",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q86AU1"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "Q86AU1",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q86AU1"
}
]
}
]
},
{
"uniprot_ac": "Q8K2Q2",
"gene_name": "Gsto2",
"activity": [
{
"ec_number": "1.20.4.2",
"activity": "2 glutathione + H(+) + methylarsonate = glutathione disulfide + H2O + methylarsonous acid.",
"evidence": [
{
"id": "Q8K2Q2",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8K2Q2"
}
]
},
{
"ec_number": "1.8.5.1",
"activity": "2 glutathione + L-dehydroascorbate = glutathione disulfide + L-ascorbate.",
"evidence": [
{
"id": "Q8K2Q2",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8K2Q2"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "Q8K2Q2",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8K2Q2"
}
]
},
{
"ec_number": "1.8.5.1",
"activity": "",
"evidence": [
{
"id": "Q8K2Q2",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8K2Q2"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "Q8K2Q2",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8K2Q2"
}
]
},
{
"ec_number": "1.20.4.2",
"activity": "",
"evidence": [
{
"id": "Q8K2Q2",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8K2Q2"
}
]
}
]
},
{
"uniprot_ac": "Q8R5I6",
"gene_name": "Gstm4",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "Q8R5I6",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8R5I6"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "Q8R5I6",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8R5I6"
}
]
},
{
"ec_number": "4.4.1.20",
"activity": "leukotriene C4 = glutathione + leukotriene A4.",
"evidence": [
{
"id": "Q8R5I6",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8R5I6"
}
]
}
]
},
{
"uniprot_ac": "Q91VS7",
"gene_name": "Mgst1",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "Q91VS7",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q91VS7"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "Q91VS7",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q91VS7"
}
]
}
]
},
{
"uniprot_ac": "Q99735",
"gene_name": "MGST2",
"activity": [
{
"ec_number": "1.11.1.-",
"activity": "",
"evidence": [
{
"id": "Q99735",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q99735"
}
]
},
{
"ec_number": "4.4.1.20",
"activity": "leukotriene C4 = glutathione + leukotriene A4.",
"evidence": [
{
"id": "Q99735",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q99735"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "Q99735",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q99735"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "Q99735",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q99735"
}
]
}
]
},
{
"uniprot_ac": "Q99L20",
"gene_name": "Gstt3",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "Q99L20",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q99L20"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "Q99L20",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q99L20"
}
]
}
]
},
{
"uniprot_ac": "Q9D4P7",
"gene_name": "Gstt4",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "Q9D4P7",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9D4P7"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "Q9D4P7",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9D4P7"
}
]
}
]
},
{
"uniprot_ac": "Q9DCM2",
"gene_name": "Gstk1",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "Q9DCM2",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9DCM2"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "Q9DCM2",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9DCM2"
}
]
}
]
},
{
"uniprot_ac": "Q9H4Y5",
"gene_name": "GSTO2",
"activity": [
{
"ec_number": "1.20.4.2",
"activity": "2 glutathione + H(+) + methylarsonate = glutathione disulfide + H2O + methylarsonous acid.",
"evidence": [
{
"id": "Q9H4Y5",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9H4Y5"
}
]
},
{
"ec_number": "1.8.5.1",
"activity": "2 glutathione + L-dehydroascorbate = glutathione disulfide + L-ascorbate.",
"evidence": [
{
"id": "Q9H4Y5",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9H4Y5"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "Q9H4Y5",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9H4Y5"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "Q9H4Y5",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9H4Y5"
}
]
}
]
},
{
"uniprot_ac": "Q9JHF7",
"gene_name": "Hpgds",
"activity": [
{
"ec_number": "5.3.99.2",
"activity": "prostaglandin H2 = prostaglandin D2.",
"evidence": [
{
"id": "Q9JHF7",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9JHF7"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "Q9JHF7",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9JHF7"
}
]
},
{
"ec_number": "5.3.99.2",
"activity": "",
"evidence": [
{
"id": "Q9JHF7",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9JHF7"
}
]
}
]
},
{
"uniprot_ac": "Q9QX69",
"gene_name": "Lancl1",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "Q9QX69",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9QX69"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "Q9QX69",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9QX69"
}
]
}
]
},
{
"uniprot_ac": "Q9VG93",
"gene_name": "GstD7",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "Q9VG93",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9VG93"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "Q9VG93",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9VG93"
}
]
}
]
},
{
"uniprot_ac": "Q9VG94",
"gene_name": "GstD6",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "Q9VG94",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9VG94"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "Q9VG94",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9VG94"
}
]
}
]
},
{
"uniprot_ac": "Q9VG95",
"gene_name": "GstD5",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "Q9VG95",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9VG95"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "Q9VG95",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9VG95"
}
]
}
]
},
{
"uniprot_ac": "Q9VG96",
"gene_name": "GstD4",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "Q9VG96",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9VG96"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "Q9VG96",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9VG96"
}
]
}
]
},
{
"uniprot_ac": "Q9VG98",
"gene_name": "GstD2",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "Q9VG98",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9VG98"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "Q9VG98",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9VG98"
}
]
}
]
},
{
"uniprot_ac": "Q9VHD2",
"gene_name": "GstZ2",
"activity": [
{
"ec_number": "5.2.1.2",
"activity": "4-maleylacetoacetate = 4-fumarylacetoacetate.",
"evidence": [
{
"id": "Q9VHD2",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9VHD2"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "Q9VHD2",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9VHD2"
}
]
},
{
"ec_number": "5.2.1.2",
"activity": "",
"evidence": [
{
"id": "Q9VHD2",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9VHD2"
}
]
}
]
},
{
"uniprot_ac": "Q9VHD3",
"gene_name": "GstZ1",
"activity": [
{
"ec_number": "5.2.1.2",
"activity": "4-maleylacetoacetate = 4-fumarylacetoacetate.",
"evidence": [
{
"id": "Q9VHD3",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9VHD3"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "Q9VHD3",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9VHD3"
}
]
},
{
"ec_number": "5.2.1.2",
"activity": "",
"evidence": [
{
"id": "Q9VHD3",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9VHD3"
}
]
}
]
},
{
"uniprot_ac": "Q9WVL0",
"gene_name": "Gstz1",
"activity": [
{
"ec_number": "5.2.1.2",
"activity": "4-maleylacetoacetate = 4-fumarylacetoacetate.",
"evidence": [
{
"id": "Q9WVL0",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9WVL0"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "Q9WVL0",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9WVL0"
}
]
},
{
"ec_number": "5.2.1.2",
"activity": "",
"evidence": [
{
"id": "Q9WVL0",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9WVL0"
}
]
}
]
},
{
"uniprot_ac": "Q9Y2Q3",
"gene_name": "GSTK1",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "Q9Y2Q3",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9Y2Q3"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "Q9Y2Q3",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9Y2Q3"
}
]
}
]
},
{
"uniprot_ac": "Q9Z1B2",
"gene_name": "Gstm5",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "Q9Z1B2",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9Z1B2"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "Q9Z1B2",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9Z1B2"
}
]
}
]
},
{
"uniprot_ac": "Q9Z339",
"gene_name": "Gsto1",
"activity": [
{
"ec_number": "1.20.4.2",
"activity": "2 glutathione + H(+) + methylarsonate = glutathione disulfide + H2O + methylarsonous acid.",
"evidence": [
{
"id": "Q9Z339",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9Z339"
}
]
},
{
"ec_number": "1.8.5.1",
"activity": "2 glutathione + L-dehydroascorbate = glutathione disulfide + L-ascorbate.",
"evidence": [
{
"id": "Q9Z339",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9Z339"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "Q9Z339",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9Z339"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "Q9Z339",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9Z339"
}
]
},
{
"ec_number": "1.20.4.2",
"activity": "",
"evidence": [
{
"id": "Q9Z339",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9Z339"
}
]
},
{
"ec_number": "1.8.5.1",
"activity": "",
"evidence": [
{
"id": "Q9Z339",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9Z339"
}
]
}
]
}
],
"biomarkers": [],
"synthesized_glycans": [],
"cluster_types": [
{
"name": "homologset.mgi",
"label": "MGI Homologs"
}
],
"sequence_features": {
"n_linked_sites": [],
"o_linked_sites": [],
"snv_sites": [],
"glycation_sites": [],
"phosphorylation_sites": [],
"sequon_annotation_sites": [
{
"start_pos": 135,
"end_pos": 137
}
]
},
"section_stats": [
{
"table_id": "glycosylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported_with_glycan",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_predicted",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_automatic_literature_mining",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "phosphorylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "snv",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "snv_disease",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "snv_non_disease",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "publication",
"table_stats": [
{
"field": "total",
"count": 37
}
],
"sort_fields": [
"title",
"journal",
"date",
"authors"
]
}
]
}