{ "uniprot_canonical_ac": "P09923-1", "uniprot_ac": "P09923", "uniprot_id": "PPBI_HUMAN", "mass": { "chemical_mass": 56812.0, "monoisotopic_mass": 56812.0 }, "refseq": { "ac": "NP_001622", "name": "intestinal-type alkaline phosphatase precursor", "summary": "There are at least four distinct but related alkaline phosphatases: intestinal, placental, placental-like, and liver/bone/kidney (tissue non-specific). The intestinal alkaline phosphatase gene encodes a digestive brush-border enzyme. This enzyme is a component of the gut mucosal defense system and is thought to function in the detoxification of lipopolysaccharide, and in the prevention of bacterial translocation in the gut. [provided by RefSeq, Dec 2014].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001622" }, "gene_names": [ { "name": "ALPI", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P09923", "id": "P09923" }, { "name": "ALPI", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001622", "id": "NP_001622" }, { "name": "IAP", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001622", "id": "NP_001622" } ], "protein_names": [ { "name": "Intestinal-type alkaline phosphatase", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P09923" }, { "name": "3.1.3.1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P09923" }, { "name": "IAP", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P09923" }, { "name": "Intestinal alkaline phosphatase", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P09923" }, { "name": "alkaline phosphomonoesterase; Kasahara isozyme; glycerophosphatase; intestinal-type alkaline phosphatase; intestinal alkaline phosphatase", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001622", "id": "NP_001622" }, { "name": "intestinal-type alkaline phosphatase precursor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001622", "id": "NP_001622" } ], "function": [ { "annotation": "Alkaline phosphatase that can hydrolyze various phosphate compounds.", "evidence": [ { "database": "UniProtKB", "id": "P09923", "url": "https://www.uniprot.org/uniprot/P09923#function" }, { "database": "UniProtKB", "id": "P15693", "url": "https://www.uniprot.org/uniprot/P15693#function" } ] }, { "annotation": "Characterization and Structure of Alternatively Spliced Transcript Variant of Human Intestinal Alkaline Phosphatase (ALPI) Gene.", "evidence": [ { "database": "RefSeq", "id": "NP_001622", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001622" }, { "database": "PubMed", "id": "36047100", "url": "https://glygen.org/publication/PubMed/36047100" } ] }, { "annotation": "Effect of Surgery on Postoperative Levels of the Gut Homeostasis-Regulating Enzyme Intestinal Alkaline Phosphatase.", "evidence": [ { "database": "RefSeq", "id": "NP_001622", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001622" }, { "database": "PubMed", "id": "37870235", "url": "https://glygen.org/publication/PubMed/37870235" } ] }, { "annotation": "Intestinal Alkaline Phosphatase Prevents Sulfate Reducing Bacteria-Induced Increased Tight Junction Permeability by Inhibiting Snail Pathway. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_001622", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001622" }, { "database": "PubMed", "id": "35694541", "url": "https://glygen.org/publication/PubMed/35694541" } ] }, { "annotation": "The role of intestinal alkaline phosphatase in the development of necrotizing enterocolitis. Review article", "evidence": [ { "database": "RefSeq", "id": "NP_001622", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001622" }, { "database": "PubMed", "id": "37300991", "url": "https://glygen.org/publication/PubMed/37300991" } ] }, { "annotation": "There are at least four distinct but related alkaline phosphatases: intestinal, placental, placental-like, and liver/bone/kidney (tissue non-specific). The intestinal alkaline phosphatase gene encodes a digestive brush-border enzyme. This enzyme is a component of the gut mucosal defense system and is thought to function in the detoxification of lipopolysaccharide, and in the prevention of bacterial translocation in the gut. [provided by RefSeq, Dec 2014].", "evidence": [ { "database": "RefSeq", "id": "NP_001622", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001622" } ] } ], "disease": [], "snv": [ { "evidence": [ { "id": "rs779375665", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs779375665" }, { "id": "rs779375665", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs779375665" }, { "id": "rs779375665", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs779375665" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 141, "end_pos": 141, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTT->KTT).", "chr_id": "2", "chr_pos": "232457021", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N141", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1442871952", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1442871952" }, { "id": "rs1442871952", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1442871952" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 155, "end_pos": 155, "sequence_org": "A", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NRA->NRT).", "chr_id": "2", "chr_pos": "232457061", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "A155", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs771126600", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs771126600" }, { "id": "rs771126600", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs771126600" }, { "id": "rs771126600", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs771126600#frequency_tab" }, { "id": "rs771126600", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs771126600" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 186, "end_pos": 186, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NRN->NRS).", "chr_id": "2", "chr_pos": "232457231", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N186", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P09923", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P09923" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 239, "end_pos": 239, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "D", "sequence_mut": "N", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (DAS->NAS).", "chr_id": "2", "chr_pos": "232457631", "ref_nt": "G", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "D239", "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "P09923", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P09923" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 270, "end_pos": 270, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "T", "sequence_mut": "N", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NRT->NRN).", "chr_id": "2", "chr_pos": "232457820", "ref_nt": "C", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "T270", "disease": [ { "disease_id": "DOID:2394", "recommended_name": { "id": "DOID:2394", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2394", "name": "ovarian cancer", "description": "A female reproductive organ cancer that is located_in the ovary." }, "synonyms": [ { "id": "DOID:2394", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2394", "name": "malignant Ovarian tumor", "description": "" }, { "id": "DOID:2394", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2394", "name": "malignant tumour of ovary", "description": "" }, { "id": "DOID:2394", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2394", "name": "ovarian neoplasm", "description": "" }, { "id": "DOID:2394", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2394", "name": "ovary neoplasm", "description": "" }, { "id": "DOID:2394", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2394", "name": "primary ovarian cancer", "description": "" }, { "id": "DOID:2394", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2394", "name": "tumor of the Ovary", "description": "" }, { "id": "MONDO:0011931", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011931", "name": "ovarian cancer, susceptibility to, 1", "description": "" }, { "id": "MONDO:0011931", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011931", "name": "OVCAS1", "description": "" }, { "id": "MONDO:0011931", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011931", "name": "ovarian cancer, susceptibility to", "description": "" }, { "id": "MONDO:0011931", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011931", "name": "ovarian cancer, susceptibility to, 1", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "ovarian cancer", "description": "A primary or metastatic malignant neoplasm involving the ovary. Most primary malignant ovarian neoplasms are either carcinomas (serous, mucinous, or endometrioid adenocarcinomas) or malignant germ cell tumors. Metastatic malignant neoplasms to the ovary include carcinomas, lymphomas, and melanomas." }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "ovarian neoplasm", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "ovary neoplasm", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "tumor of the ovary", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "tumour of the ovary", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "cancer of ovary", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "cancer of the ovary", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "malignant neoplasm of ovary", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "malignant neoplasm of the ovary", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "malignant ovarian neoplasm", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "malignant ovarian tumor", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "malignant ovarian tumour", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "malignant ovary neoplasm", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "malignant tumor of ovary", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "malignant tumor of the ovary", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "malignant tumour of ovary", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "malignant tumour of the ovary", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "ovarian cancer", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "ovarian cancer, somatic", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "ovarian malignant tumor", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "ovarian malignant tumour", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "ovary cancer", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "ovarian cancer, epithelial", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "primary ovarian cancer", "description": "" }, { "id": "MIM:167000", "resource": "MIM", "url": "https://www.omim.org/entry/167000", "name": "Ovarian cancer", "description": "Ovarian cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs752942241", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs752942241" }, { "id": "rs752942241", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs752942241" }, { "id": "rs752942241", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs752942241" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 278, "end_pos": 278, "sequence_org": "D", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (DQS->NQS).", "chr_id": "2", "chr_pos": "232457843", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "D278", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P09923", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P09923" } ], "glycoeffect": [], "start_pos": 354, "end_pos": 354, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "D", "sequence_mut": "N", "comment": "Somatic mutation passed 1 out of 6 filters: num. of cancers (3).", "chr_id": "2", "chr_pos": "232458285", "ref_nt": "G", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "D354", "disease": [ { "disease_id": "DOID:1319", "recommended_name": { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "brain cancer", "description": "A central nervous system cancer that is characterized by the growth of abnormal cells in the tissues of the brain." }, "synonyms": [ { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "BT - Brain tumour", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "adult brain tumor", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "adult malignant brain neoplasm", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "brain neoplasm", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "brain neoplasm, adult", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant brain tumour", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant primary brain neoplasm", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant primary brain tumor", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant tumor of Brain", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant tumor of adult brain", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "neoplasm of brain", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "primary brain neoplasm", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "primary brain tumor", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "primary malignant neoplasm of brain", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "tumor of the Brain", "description": "" } ] }, { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] }, { "disease_id": "DOID:4159", "recommended_name": { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "skin cancer", "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells." }, "synonyms": [ { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "CA - skin cancer", "description": "" }, { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "malignant neoplasm of skin", "description": "" }, { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "melanoma and Non-melanoma skin cancer", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs748909189", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs748909189" }, { "id": "rs748909189", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs748909189" }, { "id": "rs748909189", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs748909189" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 429, "end_pos": 429, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NES->KES).", "chr_id": "2", "chr_pos": "232458735", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N429", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P09923", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P09923" } ], "glycoeffect": [], "start_pos": 442, "end_pos": 442, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "A", "sequence_mut": "V", "comment": "Somatic mutation passed 1 out of 6 filters: num. of cancers (3).", "chr_id": "2", "chr_pos": "232458884", "ref_nt": "C", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "A442", "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] }, { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] }, { "disease_id": "DOID:4362", "recommended_name": { "id": "DOID:4362", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4362", "name": "cervical cancer", "description": "A female reproductive organ cancer that is located_in the cervix." }, "synonyms": [ { "id": "DOID:4362", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4362", "name": "cervical neoplasm", "description": "" }, { "id": "DOID:4362", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4362", "name": "cervix cancer", "description": "" }, { "id": "DOID:4362", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4362", "name": "cervix uteri cancer", "description": "" }, { "id": "DOID:4362", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4362", "name": "neoplasm of uterine cervix", "description": "" }, { "id": "DOID:4362", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4362", "name": "tumor of the Cervix Uteri", "description": "" }, { "id": "DOID:4362", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4362", "name": "uterine cervical neoplasm", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "cervical cancer", "description": "A primary or metastatic malignant neoplasm involving the cervix." }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "cervical neoplasm", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "tumor of the cervix uteri", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "tumour of the cervix uteri", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "uterine cervical neoplasm", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "cancer of uterine cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "cervical cancer, somatic", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "cervix cancer", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "cervix uteri cancer", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant cervical neoplasm", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant cervical tumor", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant cervical tumour", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant cervix neoplasm", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant cervix tumor", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant cervix tumour", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant cervix uteri neoplasm", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant cervix uteri tumor", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant cervix uteri tumour", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant neoplasm of cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant neoplasm of cervix uteri", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant neoplasm of the cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant neoplasm of the cervix uteri", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant neoplasm of the uterine cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant neoplasm of uterine cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumor of cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumor of cervix uteri", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumor of the cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumor of the cervix uteri", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumor of the uterine cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumor of uterine cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumour of cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumour of cervix uteri", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumour of the cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumour of the cervix uteri", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumour of the uterine cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumour of uterine cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant uterine cervix neoplasm", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant uterine cervix tumor", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant uterine cervix tumour", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "uterine cervix cancer", "description": "" }, { "id": "MIM:603956", "resource": "MIM", "url": "https://www.omim.org/entry/603956", "name": "Cervical cancer", "description": "Cervical cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] } ], "mutagenesis": [], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "53.3", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000163295", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000163295" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "43", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000163295", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000163295" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "46.11", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000163295", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000163295" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "49.96", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000163295", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000163295" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "44.38", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000163295", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000163295" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "77.49", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000163295", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000163295" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "53.61", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000163295", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000163295" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "34.83", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000163295", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000163295" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "24.62", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000163295", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000163295" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "47.6", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000163295", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000163295" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "24.08", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000163295", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000163295" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "23.08", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000163295", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000163295" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "22.01", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000163295", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000163295" } ] } ], "expression_disease": [ { "significant": "No", "trend": "up", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "P09923", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09923" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "P09923", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09923" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "P09923", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09923" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "P09923", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09923" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "P09923", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09923" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "P09923", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09923" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "P09923", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09923" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "P09923", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09923" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "P09923", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09923" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "P09923", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09923" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "P09923", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09923" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "P09923", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09923" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P09923", "url": "https://www.uniprot.org/uniprot/P09923" } ], "common_name": "Human" } ], "gene": [ { "name": "ALPI", "url": "https://www.uniprot.org/uniprot/P09923", "locus": { "chromosome": "2", "start_pos": 232460753, "end_pos": 232456125, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000163295", "url": "https://www.ensembl.org/id/ENSG00000163295" } ] } } ], "crossref": [ { "id": "ENSG00000163295", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000163295", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "P09923", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P09923", "database": "BioMuta", "categories": [ "Variation" ] }, { "id": "cd16012", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd16012", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "CHEMBL5573", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL5573", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "ALPI", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=ALPI", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "248", "url": "https://www.ncbi.nlm.nih.gov/gene/248", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "11", "url": "https://glyconnect.expasy.org/browser/proteins/11", "database": "GlyConnect", "categories": [ "Glycoproteomics", "Glycan" ] }, { "id": "437", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=437", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "P09923", "url": "https://www.ebi.ac.uk/intact/interactors/id:P09923*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR001952", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001952", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR017850", "url": "https://www.ebi.ac.uk/interpro/entry/IPR017850", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR018299", "url": "https://www.ebi.ac.uk/interpro/entry/IPR018299", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:248", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:248", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "171740", "url": "http://www.omim.org/entry/171740", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_P09923", "url": "https://www.nextprot.org/entry/NX_P09923", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "P09923", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P09923", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "SYHGNID", "url": "https://omabrowser.org/oma/group/SYHGNID/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "35876at2759", "url": "http://www.orthodb.org/?query=35876at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR11596", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11596", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11596:SF30", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11596:SF30", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00245", "url": "http://pfam.xfam.org/family/PF00245", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "P09923", "url": "https://pharos.nih.gov/targets/P09923", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_P09923", "url": "http://purl.obolibrary.org/obo/PR_P09923", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-1483166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-163125", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-163125", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-8935690", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8935690", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001622", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001622", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "15017", "url": "https://www.rhea-db.org/rhea/15017", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "F8WEQ0", "url": "https://www.uniprot.org/uniprot/F8WEQ0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F8WEQ0-1", "url": "https://www.uniprot.org/uniprot/F8WEQ0-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P09923", "url": "https://www.uniprot.org/uniprot/P09923", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P09923-1", "url": "https://www.uniprot.org/uniprot/P09923-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MQGPWVLLLLGLRLQLSLGVIPAEEENPAFWNRQAAEALDAAKKLQPIQKVAKNLILFLGDGLGVPTVTATRILKGQKNGKLGPETPLAMDRFPYLALSKTYNVDRQVPDSAATATAYLCGVKANFQTIGLSAAARFNQCNTTRGNEVISVMNRAKQAGKSVGVVTTTRVQHASPAGTYAHTVNRNWYSDADMPASARQEGCQDIATQLISNMDIDVILGGGRKYMFPMGTPDPEYPADASQNGIRLDGKNLVQEWLAKHQGAWYVWNRTELMQASLDQSVTHLMGLFEPGDTKYEIHRDPTLDPSLMEMTEAALRLLSRNPRGFYLFVEGGRIDHGHHEGVAYQALTEAVMFDDAIERAGQLTSEEDTLTLVTADHSHVFSFGGYTLRGSSIFGLAPSKAQDSKAYTSILYGNGPGYVFNSGVRPDVNESESGSPDYQQQAAVPLSSETHGGEDVAVFARGPQAHLVHGVQEQSFVAHVMAFAACLEPYTACDLAPPACTTDAAHPVAASLPLLAGTLLLLGASAAP", "length": 528, "header": "sp|P09923-1|PPBI_HUMAN Isoform 1 of Intestinal-type alkaline phosphatase OS=Homo sapiens OX=9606 GN=ALPI PE=1 SV=2 CANONICAL=P09923-1" }, "isoforms": [ { "isoform_ac": "F8WEQ0-1", "url": "", "sequence": { "sequence": "MQGPWVLLLLGLRLQLSLGVIPGNEAPQAVPHTGHPLSQADLISTLPLAS", "length": 50, "header": "tr|F8WEQ0-1|F8WEQ0_HUMAN Computationally mapped isoform of Alkaline phosphatase, intestinal OS=Homo sapiens OX=9606 GN=ALPI PE=4 SV=1 CANONICAL=P09923-1" }, "locus": {} }, { "isoform_ac": "P09923-1", "url": "", "sequence": { "sequence": "MQGPWVLLLLGLRLQLSLGVIPAEEENPAFWNRQAAEALDAAKKLQPIQKVAKNLILFLGDGLGVPTVTATRILKGQKNGKLGPETPLAMDRFPYLALSKTYNVDRQVPDSAATATAYLCGVKANFQTIGLSAAARFNQCNTTRGNEVISVMNRAKQAGKSVGVVTTTRVQHASPAGTYAHTVNRNWYSDADMPASARQEGCQDIATQLISNMDIDVILGGGRKYMFPMGTPDPEYPADASQNGIRLDGKNLVQEWLAKHQGAWYVWNRTELMQASLDQSVTHLMGLFEPGDTKYEIHRDPTLDPSLMEMTEAALRLLSRNPRGFYLFVEGGRIDHGHHEGVAYQALTEAVMFDDAIERAGQLTSEEDTLTLVTADHSHVFSFGGYTLRGSSIFGLAPSKAQDSKAYTSILYGNGPGYVFNSGVRPDVNESESGSPDYQQQAAVPLSSETHGGEDVAVFARGPQAHLVHGVQEQSFVAHVMAFAACLEPYTACDLAPPACTTDAAHPVAASLPLLAGTLLLLGASAAP", "length": 528, "header": "sp|P09923-1|PPBI_HUMAN Isoform 1 of Intestinal-type alkaline phosphatase OS=Homo sapiens OX=9606 GN=ALPI PE=1 SV=2 CANONICAL=P09923-1" }, "locus": { "chromosome": "2", "start_pos": 232459143, "end_pos": 232456200, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000295463.4", "url": "https://www.ensembl.org/id/ENST00000295463.4" }, { "database": "Ensembl Peptide", "id": "ENSP00000295463.3", "url": "https://www.ensembl.org/id/ENSP00000295463.3" } ] } } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 141, "start_aa": "Asn", "end_pos": 141, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn141", "evidence": [ { "id": "P09923", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09923#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 268, "start_aa": "Asn", "end_pos": 268, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn268", "evidence": [ { "id": "P09923", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09923#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 429, "start_aa": "Asn", "end_pos": 429, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn429", "evidence": [ { "id": "P09923", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09923#ptm_processing" } ] }, { "glytoucan_ac": "G18938DW", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "11", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/11" }, { "id": "2297756", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2297756" } ] }, { "glytoucan_ac": "G20425TQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "11", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/11" }, { "id": "2297756", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2297756" } ] }, { "glytoucan_ac": "G23453IV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "11", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/11" }, { "id": "2297756", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2297756" } ] }, { "glytoucan_ac": "G23863VK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "11", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/11" }, { "id": "2297756", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2297756" } ] }, { "glytoucan_ac": "G29857RC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "11", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/11" }, { "id": "2297756", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2297756" } ] }, { "glytoucan_ac": "G31544HA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "11", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/11" }, { "id": "2297756", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2297756" } ] }, { "glytoucan_ac": "G31991IV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "11", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/11" }, { "id": "2297756", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2297756" } ] }, { "glytoucan_ac": "G36191CD", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "11", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/11" }, { "id": "2297756", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2297756" } ] }, { "glytoucan_ac": "G47012YE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "11", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/11" }, { "id": "2297756", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2297756" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "evidence": [ { "id": "P09923", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P09923" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" } ] }, { "glytoucan_ac": "G50045TK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "11", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/11" }, { "id": "2297756", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2297756" } ] }, { "glytoucan_ac": "G63889NK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "11", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/11" }, { "id": "2297756", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2297756" } ] }, { "glytoucan_ac": "G69411IG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "11", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/11" }, { "id": "2297756", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2297756" } ] }, { "glytoucan_ac": "G72797UR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "11", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/11" }, { "id": "2297756", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2297756" } ] }, { "glytoucan_ac": "G75308SV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "11", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/11" }, { "id": "2297756", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2297756" } ] }, { "glytoucan_ac": "G78059CC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "11", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/11" }, { "id": "2297756", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2297756" } ] }, { "glytoucan_ac": "G86357DX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "11", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/11" }, { "id": "2297756", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2297756" } ] }, { "glytoucan_ac": "G90093AU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "11", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/11" }, { "id": "2297756", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2297756" } ] } ], "phosphorylation": [ { "start_pos": 111, "end_pos": 111, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P09923", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09923" }, { "database": "PubMed", "id": "17322306", "url": "https://glygen.org/publication/PubMed/17322306" }, { "database": "PubMed", "id": "18767875", "url": "https://glygen.org/publication/PubMed/18767875" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "phospho.ELM", "id": "P09923", "url": "http://phospho.elm.eu.org/byAccession/P09923.html" }, { "database": "PubMed", "id": "15302935", "url": "https://glygen.org/publication/PubMed/15302935" } ], "site_lbl": "Ser111" } ], "glycation": [], "keywords": [ "enzyme", "glycoprotein", "glycoprotein_predicted", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "Cloning and characterization of novel mouse and human secretory phospholipase A(2)s.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Ishizaki J, Suzuki N, Higashino K, Yokota Y, Ono T, Kawamoto K, Fujii N, Arita H, Hanasaki K", "evidence": [ { "database": "Reactome", "id": "R-HSA-1483166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166" } ], "reference": [ { "type": "PubMed", "id": "10455175", "url": "https://glygen.org/publication/PubMed/10455175" } ] }, { "title": "Isolation of a cDNA encoding human lysophosphatidic acid phosphatase that is involved in the regulation of mitochondrial lipid biosynthesis.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Hiroyama M, Takenawa T", "evidence": [ { "database": "Reactome", "id": "R-HSA-1483166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166" } ], "reference": [ { "type": "PubMed", "id": "10506173", "url": "https://glygen.org/publication/PubMed/10506173" } ] }, { "title": "Ether lipid biosynthesis: alkyl-dihydroxyacetonephosphate synthase protein deficiency leads to reduced dihydroxyacetonephosphate acyltransferase activities.", "journal": "Journal of lipid research", "date": "1999", "authors": "de Vet EC, Ijlst L, Oostheim W, Dekker C, Moser HW, van Den Bosch H, Wanders RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-1483166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166" } ], "reference": [ { "type": "PubMed", "id": "10553003", "url": "https://glygen.org/publication/PubMed/10553003" } ] }, { "title": "Structures, enzymatic properties, and expression of novel human and mouse secretory phospholipase A(2)s.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Suzuki N, Ishizaki J, Yokota Y, Higashino K, Ono T, Ikeda M, Fujii N, Kawamoto K, Hanasaki K", "evidence": [ { "database": "Reactome", "id": "R-HSA-1483166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166" } ], "reference": [ { "type": "PubMed", "id": "10681567", "url": "https://glygen.org/publication/PubMed/10681567" } ] }, { "title": "Cloning and recombinant expression of a structurally novel human secreted phospholipase A2.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Gelb MH, Valentin E, Ghomashchi F, Lazdunski M, Lambeau G", "evidence": [ { "database": "Reactome", "id": "R-HSA-1483166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166" } ], "reference": [ { "type": "PubMed", "id": "11031251", "url": "https://glygen.org/publication/PubMed/11031251" } ] }, { "title": "Structure and expression of the human glycosylphosphatidylinositol phospholipase D1 (GPLD1) gene.", "journal": "Biochimica et biophysica acta", "date": "2000", "authors": "Schofield JN, Rademacher TW", "evidence": [ { "database": "Reactome", "id": "R-HSA-163125", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-163125" } ], "reference": [ { "type": "PubMed", "id": "11072085", "url": "https://glygen.org/publication/PubMed/11072085" } ] }, { "title": "Cloning and recombinant expression of human group IIF-secreted phospholipase A(2).", "journal": "Biochemical and biophysical research communications", "date": "2000", "authors": "Valentin E, Singer AG, Ghomashchi F, Lazdunski M, Gelb MH, Lambeau G", "evidence": [ { "database": "Reactome", "id": "R-HSA-1483166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166" } ], "reference": [ { "type": "PubMed", "id": "11112443", "url": "https://glygen.org/publication/PubMed/11112443" } ] }, { "title": "Biochemical characterization of the intracellular domain of the human guanylyl cyclase C receptor provides evidence for a catalytically active homotrimer.", "journal": "Biochemistry", "date": "2000", "authors": "Vijayachandra K, Guruprasad M, Bhandari R, Manjunath UH, Somesh BP, Srinivasan N, Suguna K, Visweswariah SS", "evidence": [ { "database": "Reactome", "id": "R-HSA-8935690", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8935690" } ], "reference": [ { "type": "PubMed", "id": "11123935", "url": "https://glygen.org/publication/PubMed/11123935" } ] }, { "title": "A novel phospholipase A1 with sequence homology to a mammalian Sec23p-interacting protein, p125.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Nakajima K, Sonoda H, Mizoguchi T, Aoki J, Arai H, Nagahama M, Tagaya M, Tani K", "evidence": [ { "database": "Reactome", "id": "R-HSA-1483166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166" } ], "reference": [ { "type": "PubMed", "id": "11788596", "url": "https://glygen.org/publication/PubMed/11788596" } ] }, { "title": "Identification of a soluble form phospholipase A2 receptor as a circulating endogenous inhibitor for secretory phospholipase A2.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Higashino Ki K, Yokota Y, Ono T, Kamitani S, Arita H, Hanasaki K", "evidence": [ { "database": "Reactome", "id": "R-HSA-1483166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166" } ], "reference": [ { "type": "PubMed", "id": "11830583", "url": "https://glygen.org/publication/PubMed/11830583" } ] }, { "title": "A novel phosphatidic acid-selective phospholipase A1 that produces lysophosphatidic acid.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Sonoda H, Aoki J, Hiramatsu T, Ishida M, Bandoh K, Nagai Y, Taguchi R, Inoue K, Arai H", "evidence": [ { "database": "Reactome", "id": "R-HSA-1483166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166" } ], "reference": [ { "type": "PubMed", "id": "12063250", "url": "https://glygen.org/publication/PubMed/12063250" } ] }, { "title": "Crystal structure of human group X secreted phospholipase A2. Electrostatically neutral interfacial surface targets zwitterionic membranes.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Pan YH, Yu BZ, Singer AG, Ghomashchi F, Lambeau G, Gelb MH, Jain MK, Bahnson BJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-1483166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166" } ], "reference": [ { "type": "PubMed", "id": "12161451", "url": "https://glygen.org/publication/PubMed/12161451" } ] }, { "title": "Interfacial kinetic and binding properties of the complete set of human and mouse groups I, II, V, X, and XII secreted phospholipases A2.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Singer AG, Ghomashchi F, Le Calvez C, Bollinger J, Bezzine S, Rouault M, Sadilek M, Nguyen E, Lazdunski M, Lambeau G, Gelb MH", "evidence": [ { "database": "Reactome", "id": "R-HSA-1483166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166" } ], "reference": [ { "type": "PubMed", "id": "12359733", "url": "https://glygen.org/publication/PubMed/12359733" } ] }, { "title": "Cellular arachidonate-releasing function of novel classes of secretory phospholipase A2s (groups III and XII).", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Murakami M, Masuda S, Shimbara S, Bezzine S, Lazdunski M, Lambeau G, Gelb MH, Matsukura S, Kokubu F, Adachi M, Kudo I", "evidence": [ { "database": "Reactome", "id": "R-HSA-1483166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166" } ], "reference": [ { "type": "PubMed", "id": "12522102", "url": "https://glygen.org/publication/PubMed/12522102" } ] }, { "title": "Biochemical and molecular characterization of two phosphatidic acid-selective phospholipase A1s, mPA-PLA1alpha and mPA-PLA1beta.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Hiramatsu T, Sonoda H, Takanezawa Y, Morikawa R, Ishida M, Kasahara K, Sanai Y, Taguchi R, Aoki J, Arai H", "evidence": [ { "database": "Reactome", "id": "R-HSA-1483166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166" } ], "reference": [ { "type": "PubMed", "id": "12963729", "url": "https://glygen.org/publication/PubMed/12963729" } ] }, { "title": "Phospholipid scramblase 3 controls mitochondrial structure, function, and apoptotic response.", "journal": "Molecular cancer research : MCR", "date": "2003", "authors": "Liu J, Dai Q, Chen J, Durrant D, Freeman A, Liu T, Grossman D, Lee RM", "evidence": [ { "database": "Reactome", "id": "R-HSA-1483166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166" } ], "reference": [ { "type": "PubMed", "id": "14573790", "url": "https://glygen.org/publication/PubMed/14573790" } ] }, { "title": "Chemical nature of intestinal-type alkaline phosphatase in human kidney.", "journal": "Clin. Chem.", "date": "1992", "authors": "Nishihara Y, Hayashi Y, Adachi T, Koyama I, Stigbrand T, Hirano K", "evidence": [ { "database": "UniProtKB", "id": "P09923", "url": "https://www.uniprot.org/uniprot/P09923" } ], "reference": [ { "type": "PubMed", "id": "1458595", "url": "https://glygen.org/publication/PubMed/1458595" } ] }, { "title": "Large-scale characterization of HeLa cell nuclear phosphoproteins.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2004", "authors": "Beausoleil SA, Jedrychowski M, Schwartz D, Elias JE, Villen J, Li J, Cohn MA, Cantley LC, Gygi SP", "evidence": [ { "database": "iPTMnet", "id": "P09923", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09923" } ], "reference": [ { "type": "PubMed", "id": "15302935", "url": "https://glygen.org/publication/PubMed/15302935" } ] }, { "title": "Cloning and characterization of murine 1-acyl-sn-glycerol 3-phosphate acyltransferases and their regulation by PPARalpha in murine heart.", "journal": "The Biochemical journal", "date": "2005", "authors": "Lu B, Jiang YJ, Zhou Y, Xu FY, Hatch GM, Choy PC", "evidence": [ { "database": "Reactome", "id": "R-HSA-1483166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166" } ], "reference": [ { "type": "PubMed", "id": "15367102", "url": "https://glygen.org/publication/PubMed/15367102" } ] }, { "title": "Structural and biochemical analysis reveal pirins to possess quercetinase activity.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Adams M, Jia Z", "evidence": [ { "database": "Reactome", "id": "R-HSA-8935690", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8935690" } ], "reference": [ { "type": "PubMed", "id": "15951572", "url": "https://glygen.org/publication/PubMed/15951572" } ] }, { "title": "Crystal structures of human glycerol 3-phosphate dehydrogenase 1 (GPD1).", "journal": "Journal of molecular biology", "date": "2006", "authors": "Ou X, Ji C, Han X, Zhao X, Li X, Mao Y, Wong LL, Bartlam M, Rao Z", "evidence": [ { "database": "Reactome", "id": "R-HSA-1483166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166" } ], "reference": [ { "type": "PubMed", "id": "16460752", "url": "https://glygen.org/publication/PubMed/16460752" } ] }, { "title": "A regulatory role for 1-acylglycerol-3-phosphate-O-acyltransferase 2 in adipocyte differentiation.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Gale SE, Frolov A, Han X, Bickel PE, Cao L, Bowcock A, Schaffer JE, Ory DS", "evidence": [ { "database": "Reactome", "id": "R-HSA-1483166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166" } ], "reference": [ { "type": "PubMed", "id": "16495223", "url": "https://glygen.org/publication/PubMed/16495223" } ] }, { "title": "Functional characterization of human 1-acylglycerol-3-phosphate acyltransferase isoform 8: cloning, tissue distribution, gene structure, and enzymatic activity.", "journal": "Archives of biochemistry and biophysics", "date": "2006", "authors": "Agarwal AK, Barnes RI, Garg A", "evidence": [ { "database": "Reactome", "id": "R-HSA-1483166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166" } ], "reference": [ { "type": "PubMed", "id": "16620771", "url": "https://glygen.org/publication/PubMed/16620771" } ] }, { "title": "Cloning and characterization of mouse lung-type acyl-CoA:lysophosphatidylcholine acyltransferase 1 (LPCAT1). Expression in alveolar type II cells and possible involvement in surfactant production.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Nakanishi H, Shindou H, Hishikawa D, Harayama T, Ogasawara R, Suwabe A, Taguchi R, Shimizu T", "evidence": [ { "database": "Reactome", "id": "R-HSA-1483166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166" } ], "reference": [ { "type": "PubMed", "id": "16704971", "url": "https://glygen.org/publication/PubMed/16704971" } ] }, { "title": "Identification and characterization of a lysophosphatidylcholine acyltransferase in alveolar type II cells.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2006", "authors": "Chen X, Hyatt BA, Mucenski ML, Mason RJ, Shannon JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-1483166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166" } ], "reference": [ { "type": "PubMed", "id": "16864775", "url": "https://glygen.org/publication/PubMed/16864775" } ] }, { "title": "A common lipid links Mfn-mediated mitochondrial fusion and SNARE-regulated exocytosis.", "journal": "Nature cell biology", "date": "2006", "authors": "Choi SY, Huang P, Jenkins GM, Chan DC, Schiller J, Frohman MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-1483166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166" } ], "reference": [ { "type": "PubMed", "id": "17028579", "url": "https://glygen.org/publication/PubMed/17028579" } ] }, { "title": "Molecular identification of microsomal acyl-CoA:glycerol-3-phosphate acyltransferase, a key enzyme in de novo triacylglycerol synthesis.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2006", "authors": "Cao J, Li JL, Li D, Tobin JF, Gimeno RE", "evidence": [ { "database": "Reactome", "id": "R-HSA-1483166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166" } ], "reference": [ { "type": "PubMed", "id": "17170135", "url": "https://glygen.org/publication/PubMed/17170135" } ] }, { "title": "Phosphopeptide enrichment by aliphatic hydroxy acid-modified metal oxide chromatography for nano-LC-MS/MS in proteomics applications.", "journal": "Molecular & cellular proteomics : MCP", "date": "2007", "authors": "Sugiyama N, Masuda T, Shinoda K, Nakamura A, Tomita M, Ishihama Y", "evidence": [ { "database": "iPTMnet", "id": "P09923", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09923" } ], "reference": [ { "type": "PubMed", "id": "17322306", "url": "https://glygen.org/publication/PubMed/17322306" } ] }, { "title": "Topology of acyltransferase motifs and substrate specificity and accessibility in 1-acyl-sn-glycero-3-phosphate acyltransferase 1.", "journal": "Biochimica et biophysica acta", "date": "2007", "authors": "Yamashita A, Nakanishi H, Suzuki H, Kamata R, Tanaka K, Waku K, Sugiura T", "evidence": [ { "database": "Reactome", "id": "R-HSA-1483166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166" } ], "reference": [ { "type": "PubMed", "id": "17707131", "url": "https://glygen.org/publication/PubMed/17707131" } ] }, { "title": "AGPAT6 is a novel microsomal glycerol-3-phosphate acyltransferase.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Chen YQ, Kuo MS, Li S, Bui HH, Peake DA, Sanders PE, Thibodeaux SJ, Chu S, Qian YW, Zhao Y, Bredt DS, Moller DE, Konrad RJ, Beigneux AP, Young SG, Cao G", "evidence": [ { "database": "Reactome", "id": "R-HSA-1483166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166" } ], "reference": [ { "type": "PubMed", "id": "18238778", "url": "https://glygen.org/publication/PubMed/18238778" } ] }, { "title": "Acyl-CoA:lysophospholipid acyltransferases.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Shindou H, Shimizu T", "evidence": [ { "database": "Reactome", "id": "R-HSA-1483166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166" } ], "reference": [ { "type": "PubMed", "id": "18718904", "url": "https://glygen.org/publication/PubMed/18718904" } ] }, { "title": "Successive and selective release of phosphorylated peptides captured by hydroxy acid-modified metal oxide chromatography.", "journal": "Journal of proteome research", "date": "2008", "authors": "Kyono Y, Sugiyama N, Imami K, Tomita M, Ishihama Y", "evidence": [ { "database": "iPTMnet", "id": "P09923", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09923" } ], "reference": [ { "type": "PubMed", "id": "18767875", "url": "https://glygen.org/publication/PubMed/18767875" } ] }, { "title": "Biochemistry, physiology, and genetics of GPAT, AGPAT, and lipin enzymes in triglyceride synthesis.", "journal": "American journal of physiology. Endocrinology and metabolism", "date": "2009", "authors": "Takeuchi K, Reue K", "evidence": [ { "database": "Reactome", "id": "R-HSA-1483166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166" } ], "reference": [ { "type": "PubMed", "id": "19336658", "url": "https://glygen.org/publication/PubMed/19336658" } ] }, { "title": "GPD1L links redox state to cardiac excitability by PKC-dependent phosphorylation of the sodium channel SCN5A.", "journal": "American journal of physiology. Heart and circulatory physiology", "date": "2009", "authors": "Valdivia CR, Ueda K, Ackerman MJ, Makielski JC", "evidence": [ { "database": "Reactome", "id": "R-HSA-1483166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166" } ], "reference": [ { "type": "PubMed", "id": "19666841", "url": "https://glygen.org/publication/PubMed/19666841" } ] }, { "title": "Receptor guanylyl cyclase C (GC-C): regulation and signal transduction.", "journal": "Molecular and cellular biochemistry", "date": "2010", "authors": "Basu N, Arshad N, Visweswariah SS", "evidence": [ { "database": "Reactome", "id": "R-HSA-8935690", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8935690" } ], "reference": [ { "type": "PubMed", "id": "19960363", "url": "https://glygen.org/publication/PubMed/19960363" } ] }, { "title": "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.", "journal": "Science signaling", "date": "2010", "authors": "Olsen JV, Vermeulen M, Santamaria A, Kumar C, Miller ML, Jensen LJ, Gnad F, Cox J, Jensen TS, Nigg EA, Brunak S, Mann M", "evidence": [ { "database": "iPTMnet", "id": "P09923", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09923" } ], "reference": [ { "type": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ] }, { "title": "Interfacial kinetic and binding properties of mammalian group IVB phospholipase A2 (cPLA2beta) and comparison with the other cPLA2 isoforms.", "journal": "The Journal of biological chemistry", "date": "2010", "authors": "Ghomashchi F, Naika GS, Bollinger JG, Aloulou A, Lehr M, Leslie CC, Gelb MH", "evidence": [ { "database": "Reactome", "id": "R-HSA-1483166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166" } ], "reference": [ { "type": "PubMed", "id": "20705608", "url": "https://glygen.org/publication/PubMed/20705608" } ] }, { "title": "Enzymatic activities of the human AGPAT isoform 3 and isoform 5: localization of AGPAT5 to mitochondria.", "journal": "Journal of lipid research", "date": "2011", "authors": "Prasad SS, Garg A, Agarwal AK", "evidence": [ { "database": "Reactome", "id": "R-HSA-1483166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166" } ], "reference": [ { "type": "PubMed", "id": "21173190", "url": "https://glygen.org/publication/PubMed/21173190" } ] }, { "title": "Lysophospholipid acyltransferases: 1-acylglycerol-3-phosphate O-acyltransferases. From discovery to disease.", "journal": "Current opinion in lipidology", "date": "2012", "authors": "Agarwal AK", "evidence": [ { "database": "Reactome", "id": "R-HSA-1483166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166" } ], "reference": [ { "type": "PubMed", "id": "22777291", "url": "https://glygen.org/publication/PubMed/22777291" } ] }, { "title": "Roles of SAM and DDHD domains in mammalian intracellular phospholipase A1 KIAA0725p.", "journal": "Biochimica et biophysica acta", "date": "2012", "authors": "Inoue H, Baba T, Sato S, Ohtsuki R, Takemori A, Watanabe T, Tagaya M, Tani K", "evidence": [ { "database": "Reactome", "id": "R-HSA-1483166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166" } ], "reference": [ { "type": "PubMed", "id": "22922100", "url": "https://glygen.org/publication/PubMed/22922100" } ] }, { "title": "Structures of the asparagine-linked oligosaccharides of an alkaline phosphatase, kasahara isozyme, purified from FL amnion cells.", "journal": "Cancer research", "date": "1990", "authors": "Endo T, Higashino K, Hada T, Imanishi H, Muratani K, Kochibe N, Kobata A", "evidence": [ { "database": "GlyConnect", "id": "11", "url": "https://glyconnect.expasy.org/browser/proteins/11" } ], "reference": [ { "type": "PubMed", "id": "2297756", "url": "https://glygen.org/publication/PubMed/2297756" } ] }, { "title": "Alteration of fatty-acid-metabolizing enzymes affects mitochondrial form and function in hereditary spastic paraplegia.", "journal": "American journal of human genetics", "date": "2012", "authors": "Tesson C, Nawara M, Salih MA, Rossignol R, Zaki MS, Al Balwi M, Schule R, Mignot C, Obre E, Bouhouche A, Santorelli FM, Durand CM, Oteyza AC, El-Hachimi KH, Al Drees A, Bouslam N, Lamari F, Elmalik SA, Kabiraj MM, Seidahmed MZ, Esteves T, Gaussen M, Monin ML, Gyapay G, Lechner D, Gonzalez M, Depienne C, Mochel F, Lavie J, Schols L, Lacombe D, Yahyaoui M, Al Abdulkareem I, Zuchner S, Yamashita A, Benomar A, Goizet C, Durr A, Gleeson JG, Darios F, Brice A, Stevanin G", "evidence": [ { "database": "Reactome", "id": "R-HSA-1483166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166" } ], "reference": [ { "type": "PubMed", "id": "23176821", "url": "https://glygen.org/publication/PubMed/23176821" } ] }, { "title": "Mutations in DDHD2, encoding an intracellular phospholipase A(1), cause a recessive form of complex hereditary spastic paraplegia.", "journal": "American journal of human genetics", "date": "2012", "authors": "Schuurs-Hoeijmakers JH, Geraghty MT, Kamsteeg EJ, Ben-Salem S, de Bot ST, Nijhof B, van de Vondervoort II, van der Graaf M, Nobau AC, Otte-Holler I, Vermeer S, Smith AC, Humphreys P, Schwartzentruber J, Ali BR, Al-Yahyaee SA, Tariq S, Pramathan T, Bayoumi R, Kremer HP, van de Warrenburg BP, van den Akker WM, Gilissen C, Veltman JA, Janssen IM, Vulto-van Silfhout AT, van der Velde-Visser S, Lefeber DJ, Diekstra A, Erasmus CE, Willemsen MA, Vissers LE, Lammens M, van Bokhoven H, Brunner HG, Wevers RA, Schenck A, Al-Gazali L, de Vries BB, de Brouwer AP", "evidence": [ { "database": "Reactome", "id": "R-HSA-1483166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166" } ], "reference": [ { "type": "PubMed", "id": "23176823", "url": "https://glygen.org/publication/PubMed/23176823" } ] }, { "title": "Site-specific N-linked glycosylation of receptor guanylyl cyclase C regulates ligand binding, ligand-mediated activation and interaction with vesicular integral membrane protein 36, VIP36.", "journal": "The Journal of biological chemistry", "date": "2013", "authors": "Arshad N, Ballal S, Visweswariah SS", "evidence": [ { "database": "Reactome", "id": "R-HSA-8935690", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8935690" } ], "reference": [ { "type": "PubMed", "id": "23269669", "url": "https://glygen.org/publication/PubMed/23269669" } ] }, { "title": "Crystal structures and biochemical studies of human lysophosphatidic acid phosphatase type 6.", "journal": "Protein & cell", "date": "2013", "authors": "Li J, Dong Y, Lu X, Wang L, Peng W, Zhang XC, Rao Z", "evidence": [ { "database": "Reactome", "id": "R-HSA-1483166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166" } ], "reference": [ { "type": "PubMed", "id": "23807634", "url": "https://glygen.org/publication/PubMed/23807634" } ] }, { "title": "A glycan-phosphatidylinositol-specific phospholipase D in human serum.", "journal": "Science (New York, N.Y.)", "date": "1987", "authors": "Davitz MA, Hereld D, Shak S, Krakow J, Englund PT, Nussenzweig V", "evidence": [ { "database": "Reactome", "id": "R-HSA-163125", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-163125" } ], "reference": [ { "type": "PubMed", "id": "2443973", "url": "https://glygen.org/publication/PubMed/2443973" } ] }, { "title": "Alkaline phosphatase: an overview.", "journal": "Indian journal of clinical biochemistry : IJCB", "date": "2014", "authors": "Sharma U, Pal D, Prasad R", "evidence": [ { "database": "Reactome", "id": "R-HSA-1483166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166" } ], "reference": [ { "type": "PubMed", "id": "24966474", "url": "https://glygen.org/publication/PubMed/24966474" } ] }, { "title": "Mitoguardin Regulates Mitochondrial Fusion through MitoPLD and Is Required for Neuronal Homeostasis.", "journal": "Molecular cell", "date": "2016", "authors": "Zhang Y, Liu X, Bai J, Tian X, Zhao X, Liu W, Duan X, Shang W, Fan HY, Tong C", "evidence": [ { "database": "Reactome", "id": "R-HSA-1483166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166" } ], "reference": [ { "type": "PubMed", "id": "26711011", "url": "https://glygen.org/publication/PubMed/26711011" } ] }, { "title": "Sequence and characterization of the human intestinal alkaline phosphatase gene.", "journal": "J. Biol. Chem.", "date": "1988", "authors": "Henthorn PS, Raducha M, Kadesch T, Weiss MJ, Harris H", "evidence": [ { "database": "UniProtKB", "id": "P09923", "url": "https://www.uniprot.org/uniprot/P09923" } ], "reference": [ { "type": "PubMed", "id": "2841341", "url": "https://glygen.org/publication/PubMed/2841341" } ] }, { "title": "Cloning and recombinant expression of phospholipase A2 present in rheumatoid arthritic synovial fluid.", "journal": "The Journal of biological chemistry", "date": "1989", "authors": "Seilhamer JJ, Pruzanski W, Vadas P, Plant S, Miller JA, Kloss J, Johnson LK", "evidence": [ { "database": "Reactome", "id": "R-HSA-1483166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166" } ], "reference": [ { "type": "PubMed", "id": "2925608", "url": "https://glygen.org/publication/PubMed/2925608" } ] }, { "title": "Proteomic profiling and genome-wide mapping of O-GlcNAc chromatin-associated proteins reveal an O-GlcNAc-regulated genotoxic stress response.", "journal": "Nature communications", "date": "2020", "authors": "Liu Y, Chen Q, Zhang N, Zhang K, Dou T, Cao Y, Liu Y, Li K, Hao X, Xie X, Li W, Ren Y, Zhang J", "evidence": [ { "database": "O-GlcNAc Database", "id": "P09923", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P09923" } ], "reference": [ { "type": "PubMed", "id": "33214551", "url": "https://glygen.org/publication/PubMed/33214551" } ] }, { "title": "A phospholipase D specific for the phosphatidylinositol anchor of cell-surface proteins is abundant in plasma.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1988", "authors": "Low MG, Prasad AR", "evidence": [ { "database": "Reactome", "id": "R-HSA-163125", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-163125" } ], "reference": [ { "type": "PubMed", "id": "3422494", "url": "https://glygen.org/publication/PubMed/3422494" } ] }, { "title": "Two gene duplication events in the evolution of the human heat-stable alkaline phosphatases.", "journal": "Gene", "date": "1987", "authors": "Knoll BJ, Rothblum KN, Longley M", "evidence": [ { "database": "UniProtKB", "id": "P09923", "url": "https://www.uniprot.org/uniprot/P09923" } ], "reference": [ { "type": "PubMed", "id": "3443302", "url": "https://glygen.org/publication/PubMed/3443302" } ] }, { "title": "Partial sequencing of human adult, human fetal, and bovine intestinal alkaline phosphatases: comparison with the human placental and liver isozymes.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1986", "authors": "Hua JC, Berger J, Pan YC, Hulmes JD, Udenfriend S", "evidence": [ { "database": "UniProtKB", "id": "P09923", "url": "https://www.uniprot.org/uniprot/P09923" }, { "database": "Reactome", "id": "R-HSA-1483166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166" } ], "reference": [ { "type": "PubMed", "id": "3458202", "url": "https://glygen.org/publication/PubMed/3458202" } ] }, { "title": "Cloning and sequencing of human intestinal alkaline phosphatase cDNA.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1987", "authors": "Berger J, Garattini E, Hua JC, Udenfriend S", "evidence": [ { "database": "UniProtKB", "id": "P09923", "url": "https://www.uniprot.org/uniprot/P09923" } ], "reference": [ { "type": "PubMed", "id": "3468508", "url": "https://glygen.org/publication/PubMed/3468508" } ] }, { "title": "Nucleotide and amino acid sequences of human intestinal alkaline phosphatase: close homology to placental alkaline phosphatase.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1987", "authors": "Henthorn P S, Raducha M, Edwards Y H, Weiss M J, Slaughter C, Lafferty M A, Harris H", "evidence": [ { "database": "UniProtKB", "id": "P09923", "url": "https://www.uniprot.org/uniprot/P09923" } ], "reference": [ { "type": "PubMed", "id": "3469665", "url": "https://glygen.org/publication/PubMed/3469665" } ] }, { "title": "Intestinal Alkaline Phosphatase Prevents Sulfate Reducing Bacteria-Induced Increased Tight Junction Permeability by Inhibiting Snail Pathway.", "journal": "Frontiers in cellular and infection microbiology", "date": "2022", "authors": "Singh SB, Coffman CN, Varga MG, Carroll-Portillo A, Braun CA, Lin HC", "evidence": [ { "database": "RefSeq", "id": "NP_001622", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001622" } ], "reference": [ { "type": "PubMed", "id": "35694541", "url": "https://glygen.org/publication/PubMed/35694541" } ] }, { "title": "Characterization and Structure of Alternatively Spliced Transcript Variant of Human Intestinal Alkaline Phosphatase (ALPI) Gene.", "journal": "Journal of nutritional science and vitaminology", "date": "2022", "authors": "Noda S, Yamada A, Asawa Y, Nakamura H, Matsumura T, Orimo H, Goseki-Sone M", "evidence": [ { "database": "RefSeq", "id": "NP_001622", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001622" } ], "reference": [ { "type": "PubMed", "id": "36047100", "url": "https://glygen.org/publication/PubMed/36047100" } ] }, { "title": "Promoter structure of the human intestinal alkaline phosphatase gene.", "journal": "Nucleic Acids Res.", "date": "1987", "authors": "Mill\u00e1n J L", "evidence": [ { "database": "UniProtKB", "id": "P09923", "url": "https://www.uniprot.org/uniprot/P09923" } ], "reference": [ { "type": "PubMed", "id": "3697102", "url": "https://glygen.org/publication/PubMed/3697102" } ] }, { "title": "The role of intestinal alkaline phosphatase in the development of necrotizing enterocolitis.", "journal": "Early human development", "date": "2023-08", "authors": "Martins Raquel Dos Santos, Kooi Elisabeth M W, Poelstra Klaas, Hulscher Jan B F", "evidence": [ { "database": "RefSeq", "id": "NP_001622", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001622" } ], "reference": [ { "type": "PubMed", "id": "37300991", "url": "https://glygen.org/publication/PubMed/37300991" } ] }, { "title": "Effect of Surgery on Postoperative Levels of the Gut Homeostasis-Regulating Enzyme Intestinal Alkaline Phosphatase.", "journal": "Journal of the American College of Surgeons", "date": "2024-01-01", "authors": "Duan Ruifeng, von Ehrlich-Treuenst\u00e4tt Viktor H, Kakoschke Sara C, Schardey Josefine, Wirth Ulrich, Albertsmeier Markus, Renz Bernhard W, Andrassy Joachim, Bazhin Alexandr V, Hodin Richard A, Werner Jens, Ilmer Matthias, K\u00fchn Florian", "evidence": [ { "database": "RefSeq", "id": "NP_001622", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001622" } ], "reference": [ { "type": "PubMed", "id": "37870235", "url": "https://glygen.org/publication/PubMed/37870235" } ] }, { "title": "Studies on prophospholipase A2 and its enzyme from human pancreatic juice. Catalytic properties and sequence of the N-terminal region.", "journal": "European journal of biochemistry", "date": "1982", "authors": "Grataroli R, Dijkman R, Dutilh CE, van der Ouderaa F, De Haas GH, Figarella C", "evidence": [ { "database": "Reactome", "id": "R-HSA-1483166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166" } ], "reference": [ { "type": "PubMed", "id": "7060561", "url": "https://glygen.org/publication/PubMed/7060561" } ] }, { "title": "The sequence of a human mitochondrial glycerol-3-phosphate dehydrogenase-encoding cDNA.", "journal": "Gene", "date": "1994", "authors": "Lehn DA, Brown LJ, Simonson GD, Moran SM, MacDonald MJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-1483166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166" } ], "reference": [ { "type": "PubMed", "id": "7821823", "url": "https://glygen.org/publication/PubMed/7821823" } ] }, { "title": "Uroguanylin: structure and activity of a second endogenous peptide that stimulates intestinal guanylate cyclase.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1993", "authors": "Hamra FK, Forte LR, Eber SL, Pidhorodeckyj NV, Krause WJ, Freeman RH, Chin DT, Tompkins JA, Fok KF, Smith CE, et al.", "evidence": [ { "database": "Reactome", "id": "R-HSA-8935690", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8935690" } ], "reference": [ { "type": "PubMed", "id": "7902563", "url": "https://glygen.org/publication/PubMed/7902563" } ] }, { "title": "The circulating bioactive form of human guanylin is a high molecular weight peptide (10.3 kDa).", "journal": "FEBS letters", "date": "1993", "authors": "Kuhn M, Raida M, Adermann K, Schulz-Knappe P, Gerzer R, Heim JM, Forssmann WG", "evidence": [ { "database": "Reactome", "id": "R-HSA-8935690", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8935690" } ], "reference": [ { "type": "PubMed", "id": "8095028", "url": "https://glygen.org/publication/PubMed/8095028" } ] }, { "title": "Enzymatic, metabolic and secretory patterns in human islets of type 2 (non-insulin-dependent) diabetic patients.", "journal": "Diabetologia", "date": "1994", "authors": "Fernandez-Alvarez J, Conget I, Rasschaert J, Sener A, Gomis R, Malaisse WJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-1483166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166" } ], "reference": [ { "type": "PubMed", "id": "8163052", "url": "https://glygen.org/publication/PubMed/8163052" } ] }, { "title": "Purification of peroxisomal acyl-CoA: dihydroxyacetonephosphate acyltransferase from human placenta.", "journal": "Biochimica et biophysica acta", "date": "1994", "authors": "Ofman R, Wanders RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-1483166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166" } ], "reference": [ { "type": "PubMed", "id": "8186247", "url": "https://glygen.org/publication/PubMed/8186247" } ] }, { "title": "Cloning and recombinant expression of a novel human low molecular weight Ca(2+)-dependent phospholipase A2.", "journal": "The Journal of biological chemistry", "date": "1994", "authors": "Chen J, Engle SJ, Seilhamer JJ, Tischfield JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-1483166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166" } ], "reference": [ { "type": "PubMed", "id": "8300559", "url": "https://glygen.org/publication/PubMed/8300559" } ] }, { "title": "Guanylin stimulation of Cl- secretion in human intestinal T84 cells via cyclic guanosine monophosphate.", "journal": "The Journal of clinical investigation", "date": "1993", "authors": "Forte LR, Eber SL, Turner JT, Freeman RH, Fok KF, Currie MG", "evidence": [ { "database": "Reactome", "id": "R-HSA-8935690", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8935690" } ], "reference": [ { "type": "PubMed", "id": "8390480", "url": "https://glygen.org/publication/PubMed/8390480" } ] }, { "title": "Human ADP-ribosylation factor-activated phosphatidylcholine-specific phospholipase D defines a new and highly conserved gene family.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Hammond SM, Altshuller YM, Sung TC, Rudge SA, Rose K, Engebrecht J, Morris AJ, Frohman MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-1483166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166" } ], "reference": [ { "type": "PubMed", "id": "8530346", "url": "https://glygen.org/publication/PubMed/8530346" } ] }, { "title": "Molecular cloning of human mitochondrial glycerophosphate dehydrogenase gene: genomic structure, chromosomal localization, and existence of a pseudogene.", "journal": "Biochemical and biophysical research communications", "date": "1996", "authors": "Matsutani A, Takeuchi Y, Ishihara H, Kuwano S, Oka Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-1483166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166" } ], "reference": [ { "type": "PubMed", "id": "8687421", "url": "https://glygen.org/publication/PubMed/8687421" } ] }, { "title": "Identification of pirin, a novel highly conserved nuclear protein.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Wendler WM, Kremmer E, Forster R, Winnacker EL", "evidence": [ { "database": "Reactome", "id": "R-HSA-8935690", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8935690" } ], "reference": [ { "type": "PubMed", "id": "9079676", "url": "https://glygen.org/publication/PubMed/9079676" } ] }, { "title": "Cloning, chromosomal mapping, and expression of a novel human secretory phospholipase A2.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Cupillard L, Koumanov K, Mattei MG, Lazdunski M, Lambeau G", "evidence": [ { "database": "Reactome", "id": "R-HSA-1483166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166" } ], "reference": [ { "type": "PubMed", "id": "9188469", "url": "https://glygen.org/publication/PubMed/9188469" } ] }, { "title": "Cloning and expression of two human lysophosphatidic acid acyltransferase cDNAs that enhance cytokine-induced signaling responses in cells.", "journal": "DNA and cell biology", "date": "1997", "authors": "West J, Tompkins CK, Balantac N, Nudelman E, Meengs B, White T, Bursten S, Coleman J, Kumar A, Singer JW, Leung DW", "evidence": [ { "database": "Reactome", "id": "R-HSA-1483166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166" } ], "reference": [ { "type": "PubMed", "id": "9212163", "url": "https://glygen.org/publication/PubMed/9212163" } ] }, { "title": "Characterization of a human lysophosphatidic acid acyltransferase that is encoded by a gene located in the class III region of the human major histocompatibility complex.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Aguado B, Campbell RD", "evidence": [ { "database": "Reactome", "id": "R-HSA-1483166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166" } ], "reference": [ { "type": "PubMed", "id": "9461603", "url": "https://glygen.org/publication/PubMed/9461603" } ] }, { "title": "Cloning and initial characterization of a human phospholipase D2 (hPLD2). ADP-ribosylation factor regulates hPLD2.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Lopez I, Arnold RS, Lambeth JD", "evidence": [ { "database": "Reactome", "id": "R-HSA-1483166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166" } ], "reference": [ { "type": "PubMed", "id": "9582313", "url": "https://glygen.org/publication/PubMed/9582313" } ] } ], "pathway": [ { "id": "hsa:248", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:248", "resource": "KEGG Pathway" }, { "id": "R-HSA-1483166", "name": "Synthesis of PA", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166", "resource": "Reactome", "description": "Synthesis of PA" }, { "id": "R-HSA-163125", "name": "Post-translational modification: synthesis of GPI-anchored proteins", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-163125", "resource": "Reactome", "description": "Post-translational modification: synthesis of GPI-anchored proteins" }, { "id": "R-HSA-8935690", "name": "Digestion", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8935690", "resource": "Reactome", "description": "Digestion" } ], "orthologs": [ { "uniprot_canonical_ac": "F8VPQ6-1", "protein_name": "Alkaline phosphatase", "gene_name": "Alpi", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MQGDWVLLLFLGLRIHLSFGIIPAEEENPAFWNKKAAEALDAAKKLQPIQTSAKNLIIFLGDGMGVPTVTATRILKGQLEGHLGPETPLAMDLFPYMALSKTYNVDRQVPDSAGTATAYLCGVKANYKTIGLSAAARLDQCNTTFGNEVFSVMYRAKKAGKSVGVVTTTRVQHASPAGTYAHTVNRNWYSDAEMPASALQDGCKDIATQLISNMDIDVILGGGRKFMFPKGTPDPEYPSDSNQSGTRLDDQNLVQTWLSKHQGARYVWNRSELIQASQDPAVTHLMGLFEPTEMKYDANRNPSVDPSLAEMTEVAVRMLSRNPQGFYLFVEGGRIDQGHHAGTAYLALTEAVMFDSAIEKASQLTNEKDTLILITADHSHVFAFGGYTLRGTSIFGLAPLKALDDKSYTSILYGNGPGYELKSGNRPNVTEAQSVDPNYKQQAAVPLSSETHGGEDVAIFARGPQAHLVHGVQEQNYIAHVMAFAGCLEPYTDCGLAPPAGQSPVITPGQATTTNNAAGQATTTNNAAGQATVLLSLQLLVSMLLLVGTAMVVS", "length": 554 }, "evidence": [ { "id": "45922025", "url": "http://www.informatics.jax.org/homology/45922025", "database": "MGI" }, { "id": "P09923", "url": "https://omabrowser.org/oma/group/P09923/", "database": "OMA" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "P05187-1", "protein_name": "Alkaline phosphatase, placental type", "gene_name": "ALPP", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MLGPCMLLLLLLLGLRLQLSLGIIPVEEENPDFWNREAAEALGAAKKLQPAQTAAKNLIIFLGDGMGVSTVTAARILKGQKKDKLGPEIPLAMDRFPYVALSKTYNVDKHVPDSGATATAYLCGVKGNFQTIGLSAAARFNQCNTTRGNEVISVMNRAKKAGKSVGVVTTTRVQHASPAGTYAHTVNRNWYSDADVPASARQEGCQDIATQLISNMDIDVILGGGRKYMFRMGTPDPEYPDDYSQGGTRLDGKNLVQEWLAKRQGARYVWNRTELMQASLDPSVTHLMGLFEPGDMKYEIHRDSTLDPSLMEMTEAALRLLSRNPRGFFLFVEGGRIDHGHHESRAYRALTETIMFDDAIERAGQLTSEEDTLSLVTADHSHVFSFGGYPLRGSSIFGLAPGKARDRKAYTVLLYGNGPGYVLKDGARPDVTESESGSPEYRQQSAVPLDEETHAGEDVAVFARGPQAHLVHGVQEQTFIAHVMAFAACLEPYTACDLAPPAGTTDAAHPGRSVVPALLPLLAGTLLLLETATAP", "length": 535 }, "evidence": [ { "id": "45922025", "url": "http://www.informatics.jax.org/homology/45922025", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "P10696-1", "protein_name": "Alkaline phosphatase, germ cell type", "gene_name": "ALPG", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MQGPWVLLLLGLRLQLSLGIIPVEEENPDFWNRQAAEALGAAKKLQPAQTAAKNLIIFLGDGMGVSTVTAARILKGQKKDKLGPETFLAMDRFPYVALSKTYSVDKHVPDSGATATAYLCGVKGNFQTIGLSAAARFNQCNTTRGNEVISVMNRAKKAGKSVGVVTTTRVQHASPAGAYAHTVNRNWYSDADVPASARQEGCQDIATQLISNMDIDVILGGGRKYMFPMGTPDPEYPDDYSQGGTRLDGKNLVQEWLAKHQGARYVWNRTELLQASLDPSVTHLMGLFEPGDMKYEIHRDSTLDPSLMEMTEAALLLLSRNPRGFFLFVEGGRIDHGHHESRAYRALTETIMFDDAIERAGQLTSEEDTLSLVTADHSHVFSFGGYPLRGSSIFGLAPGKARDRKAYTVLLYGNGPGYVLKDGARPDVTESESGSPEYRQQSAVPLDGETHAGEDVAVFARGPQAHLVHGVQEQTFIAHVMAFAACLEPYTACDLAPRAGTTDAAHPGPSVVPALLPLLAGTLLLLGTATAP", "length": 532 }, "evidence": [ { "id": "45922024", "url": "http://www.informatics.jax.org/homology/45922024", "database": "MGI" }, { "id": "45922025", "url": "http://www.informatics.jax.org/homology/45922025", "database": "MGI" }, { "id": "45922026", "url": "http://www.informatics.jax.org/homology/45922026", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "P15693-1", "protein_name": "Intestinal-type alkaline phosphatase 1", "gene_name": "Alpi", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MQGDWVLLLLLGLRIHLSFGVIPVEEENPVFWNQKAKEALDVAKKLQPIQTSAKNLILFLGDGMGVPTVTATRILKGQLGGHLGPETPLAMDHFPFTALSKTYNVDRQVPDSAGTATAYLCGVKANYKTIGVSAAARFNQCNSTFGNEVFSVMHRAKKAGKSVGVVTTTRVQHASPAGTYAHTVNRDWYSDADMPSSALQEGCKDIATQLISNMDIDVILGGGRKFMFPKGTPDPEYPGDSDQSGVRLDSRNLVEEWLAKYQGTRYVWNREQLMQASQDPAVTRLMGLFEPTEMKYDVNRNASADPSLAEMTEVAVRLLSRNPQGFYLFVEGGRIDQGHHAGTAYLALTEAVMFDSAIEKASQLTNEKDTLTLITADHSHVFAFGGYTLRGTSIFGLAPLNAQDGKSYTSILYGNGPGYVLNSGNRPNVTDAESGDVNYKQQAAVPLSSETHGGEDVAIFARGPQAHLVHGVQEQNYIAHVMAFAGCLEPYTDCGLAPPADENRPTTPVQNSAITMNNVLLSLQLLVSMLLLVGTALVVS", "length": 540 }, "evidence": [ { "id": "45922025", "url": "http://www.informatics.jax.org/homology/45922025", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "P24822-1", "protein_name": "Intestinal-type alkaline phosphatase", "gene_name": "Iap", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MQGPWVLLLLGLRLQLSLSVIPVEEENPAFWNKKAAEALDAAKKLQPIQTSAKNLIIFLGDGMGVPTVTATRILKGQLEGHLGPETPLAMDRFPYMALSKTYSVDRQVPDSASTATAYLCGVKTNYKTIGLSAAARFDQCNTTFGNEVFSVMYRAKKAGKSVGVVTTTRVQHASPSGTYVHTVNRNWYGDADMPASALREGCKDIATQLISNMDINVILGGGRKYMFPAGTPDPEYPNDANETGTRLDGRNLVQEWLSKHQGSQYVWNREQLIQKAQDPSVTYLMGLFEPVDTKFDIQRDPLMDPSLKDMTETAVKVLSRNPKGFYLFVEGGRIDRGHHLGTAYLALTEAVMFDLAIERASQLTSERDTLTIVTADHSHVFSFGGYTLRGTSIFGLAPLNALDGKPYTSILYGNGPGYVGTGERPNVTAAESSGSSYRRQAAVPVKSETHGGEDVAIFARGPQAHLVHGVQEQNYIAHVMASAGCLEPYTDCGLAPPADESQTTTTTRQTTITTTTTTTTTTTTPVHNSARSLGPATAPLALALLAGMLMLLLGAPAES", "length": 559 }, "evidence": [ { "id": "45922026", "url": "http://www.informatics.jax.org/homology/45922026", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "P24823-1", "protein_name": "Alkaline phosphatase, germ cell type", "gene_name": "Alpg", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MWGACLLLLGLSLQVCPSVIPVEEENPAFWNRKAAEALDAAKKLKPIQTSAKNLVILMGDGMGVSTVTATRILKGQQQGHLGPETQLAMDRFPHMALSKTYNTDKQIPDSAGTGTAFLCGVKTNMKVIGLSAAARFNQCNTTWGNEVVSVMHRAKKAGKSVGVVTTTSVQHASPAGTYAHTVNRGWYSDAQMPASALQDGCKDISTQLISNMDIDVILGGGRKFMFPKGTPDQEYPTDTKQAGTRLDGRNLVQEWLAKHQGARYVWNRSELIQASLNRSVTHLMGLFEPNDMKYEIHRDPAQDPSLAEMTEVAVRMLSRNPKGFYLFVEGGRIDHGHHETVAYRALTEAVMFDSAVDKADKLTSEQDTMILVTADHSHVFSFGGYTQRGASIFGLAPFKAEDGKSFTSILYGNGPGYKLHNGARADVTEEESSNPTYQQQAAVPLSSETHSGEDVAIFARGPQAHLVHGVQEQNYIAHVMAFAACLEPYTDCGLASPAGQSSAVSPGYMSTLLCLLAGKMLMLMAAAEP", "length": 529 }, "evidence": [ { "id": "45922024", "url": "http://www.informatics.jax.org/homology/45922024", "database": "MGI" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "dephosphorylation", "id": "GO:0016311", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016311", "evidence": [ { "database": "UniProtKB", "id": "P09923", "url": "https://www.uniprot.org/uniprot/P09923" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 4, "go_terms": [ { "name": "alkaline phosphatase activity", "id": "GO:0004035", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004035", "evidence": [ { "database": "UniProtKB", "id": "P09923", "url": "https://www.uniprot.org/uniprot/P09923" } ], "pmid": "" }, { "name": "magnesium ion binding", "id": "GO:0000287", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000287", "evidence": [ { "database": "UniProtKB", "id": "P09923", "url": "https://www.uniprot.org/uniprot/P09923" } ], "pmid": "" }, { "name": "protease binding", "id": "GO:0002020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002020", "evidence": [ { "database": "UniProtKB", "id": "P09923", "url": "https://www.uniprot.org/uniprot/P09923" } ], "pmid": "" }, { "name": "zinc ion binding", "id": "GO:0008270", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008270", "evidence": [ { "database": "UniProtKB", "id": "P09923", "url": "https://www.uniprot.org/uniprot/P09923" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 3, "go_terms": [ { "name": "extracellular region", "id": "GO:0005576", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576", "evidence": [ { "database": "UniProtKB", "id": "P09923", "url": "https://www.uniprot.org/uniprot/P09923" } ], "pmid": "" }, { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "P09923", "url": "https://www.uniprot.org/uniprot/P09923" } ], "pmid": "" }, { "name": "side of membrane", "id": "GO:0098552", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0098552", "evidence": [ { "database": "UniProtKB", "id": "P09923", "url": "https://www.uniprot.org/uniprot/P09923" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 141, "end_pos": 143, "annotation": "n_glycosylation_sequon" }, { "start_pos": 268, "end_pos": 270, "annotation": "n_glycosylation_sequon" }, { "start_pos": 429, "end_pos": 431, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "15017", "name": "", "equation": "a phosphate monoester + H2O = an alcohol + phosphate", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P20611-1", "P51740-1", "P08289-1", "P15693-1", "P29288-1", "P20646-1", "P41498-1", "F1M8U7-1", "A0A0G2JZL2-1", "D4ADM6-1", "M0RCA8-1", "A0A8I6G7Q4-1", "Q6ZNF0-1", "Q9BZG2-1", "P13686-1", "P11117-1", "P05186-1", "P15309-1", "P09923-1", "Q9NPH0-1", "P05187-1", "P10696-1", "P24666-1", "Q8BX37-1", "D3YTS9-1", "Q8BP40-1", "Q9D358-1", "Q05117-1", "P24638-1", "P24822-1", "P24823-1", "Q8CE08-1", "P09242-1", "F8VPQ6-1", "P00635-1", "P11491-1", "P35842-1", "P40347-1", "P24031-1", "P38693-1", "P52290-1", "Q54NC3-1", "Q54P71-1", "Q54P72-1", "Q54SB4-1", "Q54TC4-1", "Q558S4-1", "Q54BS2-1", "Q54Y02-1", "Q55GW2-1", "Q55F77-1", "Q55F12-1", "P82890-1", "P82891-1", "Q24238-1", "X2JB52-1", "Q9W273-1", "Q9W274-1", "Q9VDG4-1", "Q7K3X8-1", "Q9VHD0-1", "Q9W275-1", "B7Z080-1", "Q8I0P9-1", "Q9VW00-1", "Q9VQ86-1" ], "evidence": [ { "id": "15017", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/15017" } ] }, { "id": "R-HSA-8878787", "name": "ALPI dimer hydrolyses phosphate monoesters", "equation": "", "summary": "Alkaline phosphatases (ALPs) are ubiquitous membrane-bound glycoproteins that catalyse the hydrolysis of phosphate monoesters in alkaline conditions (Sharma et al. 2014). To date, little is known about the physiological function of ALPs in most tissues. In humans, four isozymes exist, named from their tissue localisations. One isozyme, intestinal-type alkaline phosphatase (ALPI, IAP), possesses alkaline phosphatase activity but has no specific physiological substrate defiend for it yet. It may be involved in the hydrolysis of pro-drugs in the intestine (Lowe et al. 1990).", "cellular_location": "extracellular region, plasma membrane", "input_participant_list": [ "R-ALL-8878780" ], "output_participant_list": [], "enzyme_list": [ "P09923-1" ], "evidence": [ { "id": "R-HSA-8878787", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8878787" } ] }, { "id": "R-HSA-8940388", "name": "GPLD1 hydrolyses GPI-anchors from proteins", "equation": "", "summary": "Some proteins function at the cell's surface, attached to the plasma membrane via GPI (glycosylphosphatidylinositol) anchors and include enzymes, receptors, cell adhesion molecules and antigens. These GPI-anchored proteins participate in many important cellular functions including immune recognition, complement regulation and intracellular signaling. Phosphatidylinositol-glycan-specific phospholipase D (GPLD1) (Schofield et al. 2000) is a secreted protein that specifically cleaves GPI-anchored proteins by cleaving the linkage between the phosphate and inositol in GPI (Davitz et al. 1987, Low & Prasad 1988). In addition, it also localises to the ER where it can cleave GPI anchor intermediates transiting to the plasma membrane (not shown here). GPLD1 may play a role in the regulation of GPI-anchored proteins on (intra)cellular membranes.", "cellular_location": "extracellular region, plasma membrane", "input_participant_list": [], "output_participant_list": [ "R-ALL-2197633" ], "enzyme_list": [ "Q7RTY9-1", "Q9Y6M0-1", "O43895-1", "Q13508-1", "P80108-1", "P10696-1", "Q93070-1", "O95497-1", "O95498-1", "Q10588-1", "P14384-1", "P09923-1", "P05186-1" ], "evidence": [ { "id": "R-HSA-8940388", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8940388" } ] } ], "reaction_participants": [ { "participant_id": "R-ALL-2197633", "participant_name": "PI [extracellular region]", "crossref": [ { "id": "57880", "database": "ChEBI", "url": "" }, { "id": "57880", "database": "ChEBI", "url": "" }, { "id": "57880", "database": "ChEBI", "url": "" }, { "id": "57880", "database": "ChEBI", "url": "" }, { "id": "57880", "database": "ChEBI", "url": "" }, { "id": "57880", "database": "ChEBI", "url": "" } ] }, { "participant_id": "R-ALL-8878780", "participant_name": "phosphate monoester [extracellular region]", "crossref": [ { "id": "C01153", "database": "COMPOUND", "url": "" }, { "id": "Orthophosphoric-Monoesters", "database": "AraCyc", "url": "" }, { "id": "7794", "database": "ChEBI", "url": "" }, { "id": "C01153", "database": "KEGG Gene", "url": "" }, { "id": "7794", "database": "ChEBI", "url": "" }, { "id": "C01153", "database": "COMPOUND", "url": "" }, { "id": "C01153", "database": "KEGG Gene", "url": "" }, { "id": "Orthophosphoric-Monoesters", "database": "AraCyc", "url": "" }, { "id": "7794", "database": "ChEBI", "url": "" }, { "id": "C01153", "database": "COMPOUND", "url": "" }, { "id": "C01153", "database": "KEGG Gene", "url": "" }, { "id": "Orthophosphoric-Monoesters", "database": "AraCyc", "url": "" }, { "id": "C01153", "database": "COMPOUND", "url": "" }, { "id": "Orthophosphoric-Monoesters", "database": "AraCyc", "url": "" }, { "id": "C01153", "database": "KEGG Gene", "url": "" }, { "id": "7794", "database": "ChEBI", "url": "" }, { "id": "C01153", "database": "COMPOUND", "url": "" }, { "id": "Orthophosphoric-Monoesters", "database": "AraCyc", "url": "" }, { "id": "C01153", "database": "KEGG Gene", "url": "" }, { "id": "7794", "database": "ChEBI", "url": "" } ] } ], "reaction_enzymes": [ { "uniprot_ac": "A0A0G2JZL2", "gene_name": "Akp3", "activity": [ { "ec_number": "3.1.3.1", "activity": "a phosphate monoester + H2O = an alcohol + phosphate.", "evidence": [ { "id": "A0A0G2JZL2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2JZL2" } ] }, { "ec_number": "3.1.3.1", "activity": "", "evidence": [ { "id": "A0A0G2JZL2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2JZL2" } ] } ] }, { "uniprot_ac": "A0A8I6G7Q4", "gene_name": "AABR07036974.1", "activity": [ { "ec_number": "3.1.3.2", "activity": "a phosphate monoester + H2O = an alcohol + phosphate.", "evidence": [ { "id": "A0A8I6G7Q4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I6G7Q4" } ] }, { "ec_number": "3.1.3.48", "activity": "H2O + O-phospho-L-tyrosyl-[protein] = L-tyrosyl-[protein] + phosphate.", "evidence": [ { "id": "A0A8I6G7Q4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I6G7Q4" } ] }, { "ec_number": "3.1.3.2", "activity": "", "evidence": [ { "id": "A0A8I6G7Q4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I6G7Q4" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "A0A8I6G7Q4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I6G7Q4" } ] } ] }, { "uniprot_ac": "B7Z080", "gene_name": "Dmel\\CG9449", "activity": [ { "ec_number": "3.1.3.-", "activity": "", "evidence": [ { "id": "B7Z080", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B7Z080" } ] }, { "ec_number": "3.1.3.2", "activity": "a phosphate monoester + H2O = an alcohol + phosphate.", "evidence": [ { "id": "B7Z080", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B7Z080" } ] } ] }, { "uniprot_ac": "D3YTS9", "gene_name": "Acp4", "activity": [ { "ec_number": "3.1.3.2", "activity": "a phosphate monoester + H2O = an alcohol + phosphate.", "evidence": [ { "id": "D3YTS9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3YTS9" } ] }, { "ec_number": "3.1.3.2", "activity": "", "evidence": [ { "id": "D3YTS9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3YTS9" } ] } ] }, { "uniprot_ac": "D4ADM6", "gene_name": "Alpp", "activity": [ { "ec_number": "3.1.3.1", "activity": "a phosphate monoester + H2O = an alcohol + phosphate.", "evidence": [ { "id": "D4ADM6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D4ADM6" } ] }, { "ec_number": "3.1.3.1", "activity": "", "evidence": [ { "id": "D4ADM6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D4ADM6" } ] } ] }, { "uniprot_ac": "F1M8U7", "gene_name": "Alpg", "activity": [ { "ec_number": "3.1.3.1", "activity": "a phosphate monoester + H2O = an alcohol + phosphate.", "evidence": [ { "id": "F1M8U7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F1M8U7" } ] }, { "ec_number": "3.1.3.1", "activity": "", "evidence": [ { "id": "F1M8U7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F1M8U7" } ] } ] }, { "uniprot_ac": "F8VPQ6", "gene_name": "Alpi", "activity": [ { "ec_number": "3.1.3.1", "activity": "a phosphate monoester + H2O = an alcohol + phosphate.", "evidence": [ { "id": "F8VPQ6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F8VPQ6" } ] }, { "ec_number": "3.1.3.1", "activity": "", "evidence": [ { "id": "F8VPQ6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F8VPQ6" } ] } ] }, { "uniprot_ac": "M0RCA8", "gene_name": "Acp7", "activity": [ { "ec_number": "3.1.3.2", "activity": "a phosphate monoester + H2O = an alcohol + phosphate.", "evidence": [ { "id": "M0RCA8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/M0RCA8" } ] }, { "ec_number": "3.1.3.2", "activity": "", "evidence": [ { "id": "M0RCA8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/M0RCA8" } ] } ] }, { "uniprot_ac": "O43895", "gene_name": "XPNPEP2", "activity": [ { "ec_number": "3.4.11.9", "activity": "Release of any N-terminal amino acid, including proline, that is linked to proline, even from a dipeptide or tripeptide.", "evidence": [ { "id": "O43895", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O43895" } ] }, { "ec_number": "3.4.11.9", "activity": "", "evidence": [ { "id": "O43895", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O43895" } ] } ] }, { "uniprot_ac": "O95497", "gene_name": "VNN1", "activity": [ { "ec_number": "3.5.1.92", "activity": "(R)-pantetheine + H2O = (R)-pantothenate + cysteamine.", "evidence": [ { "id": "O95497", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O95497" } ] }, { "ec_number": "3.5.1.92", "activity": "", "evidence": [ { "id": "O95497", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O95497" } ] } ] }, { "uniprot_ac": "O95498", "gene_name": "VNN2", "activity": [ { "ec_number": "3.5.1.92", "activity": "(R)-pantetheine + H2O = (R)-pantothenate + cysteamine.", "evidence": [ { "id": "O95498", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O95498" } ] }, { "ec_number": "3.5.1.92", "activity": "", "evidence": [ { "id": "O95498", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O95498" } ] } ] }, { "uniprot_ac": "P00635", "gene_name": "PHO5", "activity": [ { "ec_number": "3.1.3.2", "activity": "a phosphate monoester + H2O = an alcohol + phosphate.", "evidence": [ { "id": "P00635", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00635" } ] }, { "ec_number": "3.1.3.2", "activity": "", "evidence": [ { "id": "P00635", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00635" } ] } ] }, { "uniprot_ac": "P05186", "gene_name": "ALPL", "activity": [ { "ec_number": "3.1.3.1", "activity": "a phosphate monoester + H2O = an alcohol + phosphate.", "evidence": [ { "id": "P05186", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P05186" } ] }, { "ec_number": "3.9.1.1", "activity": "H2O + N-phosphocreatine = creatine + phosphate.", "evidence": [ { "id": "P05186", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P05186" } ] }, { "ec_number": "3.1.3.1", "activity": "", "evidence": [ { "id": "P05186", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P05186" } ] }, { "ec_number": "3.9.1.1", "activity": "", "evidence": [ { "id": "P05186", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P05186" } ] } ] }, { "uniprot_ac": "P05187", "gene_name": "ALPP", "activity": [ { "ec_number": "3.1.3.1", "activity": "a phosphate monoester + H2O = an alcohol + phosphate.", "evidence": [ { "id": "P05187", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P05187" } ] }, { "ec_number": "3.1.3.1", "activity": "", "evidence": [ { "id": "P05187", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P05187" } ] } ] }, { "uniprot_ac": "P08289", "gene_name": "Alpl", "activity": [ { "ec_number": "3.1.3.1", "activity": "a phosphate monoester + H2O = an alcohol + phosphate.", "evidence": [ { "id": "P08289", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08289" } ] }, { "ec_number": "3.9.1.1", "activity": "H2O + N-phosphocreatine = creatine + phosphate.", "evidence": [ { "id": "P08289", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08289" } ] }, { "ec_number": "3.1.3.1", "activity": "", "evidence": [ { "id": "P08289", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08289" } ] } ] }, { "uniprot_ac": "P09242", "gene_name": "Alpl", "activity": [ { "ec_number": "3.1.3.1", "activity": "a phosphate monoester + H2O = an alcohol + phosphate.", "evidence": [ { "id": "P09242", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09242" } ] }, { "ec_number": "3.9.1.1", "activity": "H2O + N-phosphocreatine = creatine + phosphate.", "evidence": [ { "id": "P09242", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09242" } ] }, { "ec_number": "3.1.3.1", "activity": "", "evidence": [ { "id": "P09242", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09242" } ] }, { "ec_number": "3.9.1.1", "activity": "", "evidence": [ { "id": "P09242", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09242" } ] } ] }, { "uniprot_ac": "P09923", "gene_name": "ALPI", "activity": [ { "ec_number": "3.1.3.1", "activity": "a phosphate monoester + H2O = an alcohol + phosphate.", "evidence": [ { "id": "P09923", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09923" } ] }, { "ec_number": "3.1.3.1", "activity": "", "evidence": [ { "id": "P09923", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09923" } ] } ] }, { "uniprot_ac": "P10696", "gene_name": "ALPG", "activity": [ { "ec_number": "3.1.3.1", "activity": "a phosphate monoester + H2O = an alcohol + phosphate.", "evidence": [ { "id": "P10696", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P10696" } ] }, { "ec_number": "3.1.3.1", "activity": "", "evidence": [ { "id": "P10696", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P10696" } ] } ] }, { "uniprot_ac": "P11117", "gene_name": "ACP2", "activity": [ { "ec_number": "3.1.3.2", "activity": "a phosphate monoester + H2O = an alcohol + phosphate.", "evidence": [ { "id": "P11117", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11117" } ] }, { "ec_number": "3.1.3.2", "activity": "", "evidence": [ { "id": "P11117", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11117" } ] } ] }, { "uniprot_ac": "P11491", "gene_name": "PHO8", "activity": [ { "ec_number": "3.1.7.6", "activity": "(2E,6E)-farnesyl diphosphate + H2O = (2E,6E)-farnesol + diphosphate.", "evidence": [ { "id": "P11491", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11491" } ] }, { "ec_number": "3.1.3.1", "activity": "a phosphate monoester + H2O = an alcohol + phosphate.", "evidence": [ { "id": "P11491", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11491" } ] }, { "ec_number": "3.1.3.54", "activity": "beta-D-fructose 2,6-bisphosphate + H2O = beta-D-fructose 2-phosphate + phosphate.", "evidence": [ { "id": "P11491", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11491" } ] }, { "ec_number": "3.1.3.1", "activity": "", "evidence": [ { "id": "P11491", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11491" } ] } ] }, { "uniprot_ac": "P13686", "gene_name": "ACP5", "activity": [ { "ec_number": "3.1.3.2", "activity": "a phosphate monoester + H2O = an alcohol + phosphate.", "evidence": [ { "id": "P13686", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13686" } ] }, { "ec_number": "3.1.3.2", "activity": "", "evidence": [ { "id": "P13686", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13686" } ] } ] }, { "uniprot_ac": "P14384", "gene_name": "CPM", "activity": [ { "ec_number": "3.4.17.12", "activity": "Cleavage of C-terminal arginine or lysine residues from polypeptides.", "evidence": [ { "id": "P14384", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P14384" } ] }, { "ec_number": "3.4.17.12", "activity": "", "evidence": [ { "id": "P14384", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P14384" } ] } ] }, { "uniprot_ac": "P15309", "gene_name": "ACP3", "activity": [ { "ec_number": "3.1.3.5", "activity": "a ribonucleoside 5'-phosphate + H2O = a ribonucleoside + phosphate.", "evidence": [ { "id": "P15309", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P15309" } ] }, { "ec_number": "3.1.3.2", "activity": "a phosphate monoester + H2O = an alcohol + phosphate.", "evidence": [ { "id": "P15309", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P15309" } ] }, { "ec_number": "3.1.3.48", "activity": "H2O + O-phospho-L-tyrosyl-[protein] = L-tyrosyl-[protein] + phosphate.", "evidence": [ { "id": "P15309", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P15309" } ] }, { "ec_number": "3.1.3.2", "activity": "", "evidence": [ { "id": "P15309", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P15309" } ] } ] }, { "uniprot_ac": "P15693", "gene_name": "Alpi", "activity": [ { "ec_number": "3.1.3.1", "activity": "a phosphate monoester + H2O = an alcohol + phosphate.", "evidence": [ { "id": "P15693", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P15693" } ] }, { "ec_number": "3.1.3.1", "activity": "", "evidence": [ { "id": "P15693", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P15693" } ] } ] }, { "uniprot_ac": "P20611", "gene_name": "Acp2", "activity": [ { "ec_number": "3.1.3.2", "activity": "a phosphate monoester + H2O = an alcohol + phosphate.", "evidence": [ { "id": "P20611", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P20611" } ] }, { "ec_number": "3.1.3.2", "activity": "", "evidence": [ { "id": "P20611", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P20611" } ] } ] }, { "uniprot_ac": "P20646", "gene_name": "Acp3", "activity": [ { "ec_number": "3.1.3.2", "activity": "a phosphate monoester + H2O = an alcohol + phosphate.", "evidence": [ { "id": "P20646", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P20646" } ] }, { "ec_number": "3.1.3.2", "activity": "", "evidence": [ { "id": "P20646", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P20646" } ] }, { "ec_number": "3.1.3.5", "activity": "a ribonucleoside 5'-phosphate + H2O = a ribonucleoside + phosphate.", "evidence": [ { "id": "P20646", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P20646" } ] }, { "ec_number": "3.1.3.48", "activity": "H2O + O-phospho-L-tyrosyl-[protein] = L-tyrosyl-[protein] + phosphate.", "evidence": [ { "id": "P20646", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P20646" } ] } ] }, { "uniprot_ac": "P24031", "gene_name": "PHO3", "activity": [ { "ec_number": "3.1.3.2", "activity": "a phosphate monoester + H2O = an alcohol + phosphate.", "evidence": [ { "id": "P24031", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P24031" } ] }, { "ec_number": "3.1.3.2", "activity": "", "evidence": [ { "id": "P24031", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P24031" } ] } ] }, { "uniprot_ac": "P24638", "gene_name": "Acp2", "activity": [ { "ec_number": "3.1.3.2", "activity": "a phosphate monoester + H2O = an alcohol + phosphate.", "evidence": [ { "id": "P24638", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P24638" } ] }, { "ec_number": "3.1.3.2", "activity": "", "evidence": [ { "id": "P24638", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P24638" } ] } ] }, { "uniprot_ac": "P24666", "gene_name": "ACP1", "activity": [ { "ec_number": "3.1.3.2", "activity": "a phosphate monoester + H2O = an alcohol + phosphate.", "evidence": [ { "id": "P24666", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P24666" } ] }, { "ec_number": "3.1.3.48", "activity": "H2O + O-phospho-L-tyrosyl-[protein] = L-tyrosyl-[protein] + phosphate.", "evidence": [ { "id": "P24666", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P24666" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "P24666", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P24666" } ] } ] }, { "uniprot_ac": "P24822", "gene_name": "Iap", "activity": [ { "ec_number": "3.1.3.1", "activity": "a phosphate monoester + H2O = an alcohol + phosphate.", "evidence": [ { "id": "P24822", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P24822" } ] }, { "ec_number": "3.1.3.1", "activity": "", "evidence": [ { "id": "P24822", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P24822" } ] } ] }, { "uniprot_ac": "P24823", "gene_name": "Alpg", "activity": [ { "ec_number": "3.1.3.1", "activity": "a phosphate monoester + H2O = an alcohol + phosphate.", "evidence": [ { "id": "P24823", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P24823" } ] }, { "ec_number": "3.1.3.1", "activity": "", "evidence": [ { "id": "P24823", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P24823" } ] } ] }, { "uniprot_ac": "P29288", "gene_name": "Acp5", "activity": [ { "ec_number": "3.1.3.2", "activity": "a phosphate monoester + H2O = an alcohol + phosphate.", "evidence": [ { "id": "P29288", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P29288" } ] }, { "ec_number": "3.1.3.2", "activity": "", "evidence": [ { "id": "P29288", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P29288" } ] } ] }, { "uniprot_ac": "P35842", "gene_name": "PHO11", "activity": [ { "ec_number": "3.1.3.2", "activity": "a phosphate monoester + H2O = an alcohol + phosphate.", "evidence": [ { "id": "P35842", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P35842" } ] }, { "ec_number": "3.1.3.2", "activity": "", "evidence": [ { "id": "P35842", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P35842" } ] } ] }, { "uniprot_ac": "P38693", "gene_name": "PHO12", "activity": [ { "ec_number": "3.1.3.2", "activity": "a phosphate monoester + H2O = an alcohol + phosphate.", "evidence": [ { "id": "P38693", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P38693" } ] }, { "ec_number": "3.1.3.2", "activity": "", "evidence": [ { "id": "P38693", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P38693" } ] } ] }, { "uniprot_ac": "P40347", "gene_name": "LTP1", "activity": [ { "ec_number": "3.1.3.2", "activity": "a phosphate monoester + H2O = an alcohol + phosphate.", "evidence": [ { "id": "P40347", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P40347" } ] }, { "ec_number": "3.1.3.48", "activity": "H2O + O-phospho-L-tyrosyl-[protein] = L-tyrosyl-[protein] + phosphate.", "evidence": [ { "id": "P40347", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P40347" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "P40347", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P40347" } ] } ] }, { "uniprot_ac": "P41498", "gene_name": "Acp1", "activity": [ { "ec_number": "3.1.3.2", "activity": "a phosphate monoester + H2O = an alcohol + phosphate.", "evidence": [ { "id": "P41498", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P41498" } ] }, { "ec_number": "3.1.3.48", "activity": "H2O + O-phospho-L-tyrosyl-[protein] = L-tyrosyl-[protein] + phosphate.", "evidence": [ { "id": "P41498", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P41498" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "P41498", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P41498" } ] }, { "ec_number": "3.1.3.2", "activity": "", "evidence": [ { "id": "P41498", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P41498" } ] } ] }, { "uniprot_ac": "P51740", "gene_name": "", "activity": [ { "ec_number": "3.1.3.1", "activity": "a phosphate monoester + H2O = an alcohol + phosphate.", "evidence": [ { "id": "P51740", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51740" } ] }, { "ec_number": "3.1.3.1", "activity": "", "evidence": [ { "id": "P51740", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51740" } ] } ] }, { "uniprot_ac": "P52290", "gene_name": "DIA3", "activity": [ { "ec_number": "3.1.3.2", "activity": "a phosphate monoester + H2O = an alcohol + phosphate.", "evidence": [ { "id": "P52290", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P52290" } ] }, { "ec_number": "3.1.3.2", "activity": "", "evidence": [ { "id": "P52290", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P52290" } ] } ] }, { "uniprot_ac": "P80108", "gene_name": "GPLD1", "activity": [ { "ec_number": "3.1.4.50", "activity": "an alpha-D-GlcN-(1->6)-(1,2-diacyl-sn-glycero-3-phospho)-1D-myo-inositol + H2O = 6-(alpha-D-glucosaminyl)-1D-myo-inositol + a 1,2-diacyl-sn-glycero-3-phosphate + H(+).", "evidence": [ { "id": "P80108", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P80108" } ] }, { "ec_number": "3.1.4.50", "activity": "", "evidence": [ { "id": "P80108", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P80108" } ] } ] }, { "uniprot_ac": "P82890", "gene_name": "primo-1", "activity": [ { "ec_number": "3.1.3.2", "activity": "a phosphate monoester + H2O = an alcohol + phosphate.", "evidence": [ { "id": "P82890", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P82890" } ] }, { "ec_number": "3.1.3.48", "activity": "H2O + O-phospho-L-tyrosyl-[protein] = L-tyrosyl-[protein] + phosphate.", "evidence": [ { "id": "P82890", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P82890" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "P82890", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P82890" } ] } ] }, { "uniprot_ac": "P82891", "gene_name": "primo-2", "activity": [ { "ec_number": "3.1.3.2", "activity": "a phosphate monoester + H2O = an alcohol + phosphate.", "evidence": [ { "id": "P82891", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P82891" } ] }, { "ec_number": "3.1.3.48", "activity": "H2O + O-phospho-L-tyrosyl-[protein] = L-tyrosyl-[protein] + phosphate.", "evidence": [ { "id": "P82891", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P82891" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "P82891", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P82891" } ] } ] }, { "uniprot_ac": "Q05117", "gene_name": "Acp5", "activity": [ { "ec_number": "3.1.3.2", "activity": "a phosphate monoester + H2O = an alcohol + phosphate.", "evidence": [ { "id": "Q05117", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q05117" } ] }, { "ec_number": "3.1.3.2", "activity": "", "evidence": [ { "id": "Q05117", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q05117" } ] } ] }, { "uniprot_ac": "Q10588", "gene_name": "BST1", "activity": [ { "ec_number": "3.2.2.6", "activity": "H2O + NAD(+) = ADP-D-ribose + H(+) + nicotinamide.", "evidence": [ { "id": "Q10588", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q10588" } ] }, { "ec_number": "3.2.2.6", "activity": "", "evidence": [ { "id": "Q10588", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q10588" } ] } ] }, { "uniprot_ac": "Q13508", "gene_name": "ART3", "activity": [ { "ec_number": "2.4.2.31", "activity": "L-arginyl-[protein] + NADP(+) = H(+) + N(omega)-(2'-phospho-ADP-D-ribosyl)-L-arginyl-[protein] + nicotinamide.", "evidence": [ { "id": "Q13508", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q13508" } ] }, { "ec_number": "2.4.2.31", "activity": "", "evidence": [ { "id": "Q13508", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q13508" } ] } ] }, { "uniprot_ac": "Q24238", "gene_name": "Alp4", "activity": [ { "ec_number": "3.1.3.1", "activity": "a phosphate monoester + H2O = an alcohol + phosphate.", "evidence": [ { "id": "Q24238", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q24238" } ] }, { "ec_number": "3.1.3.1", "activity": "", "evidence": [ { "id": "Q24238", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q24238" } ] } ] }, { "uniprot_ac": "Q54BS2", "gene_name": "", "activity": [ { "ec_number": "3.1.3.2", "activity": "a phosphate monoester + H2O = an alcohol + phosphate.", "evidence": [ { "id": "Q54BS2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54BS2" } ] }, { "ec_number": "3.1.3.2", "activity": "", "evidence": [ { "id": "Q54BS2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54BS2" } ] } ] }, { "uniprot_ac": "Q54NC3", "gene_name": "", "activity": [ { "ec_number": "3.1.3.2", "activity": "a phosphate monoester + H2O = an alcohol + phosphate.", "evidence": [ { "id": "Q54NC3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54NC3" } ] }, { "ec_number": "3.1.3.2", "activity": "", "evidence": [ { "id": "Q54NC3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54NC3" } ] } ] }, { "uniprot_ac": "Q54P71", "gene_name": "", "activity": [ { "ec_number": "3.1.3.2", "activity": "a phosphate monoester + H2O = an alcohol + phosphate.", "evidence": [ { "id": "Q54P71", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54P71" } ] }, { "ec_number": "3.1.3.2", "activity": "", "evidence": [ { "id": "Q54P71", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54P71" } ] } ] }, { "uniprot_ac": "Q54P72", "gene_name": "", "activity": [ { "ec_number": "3.1.3.2", "activity": "a phosphate monoester + H2O = an alcohol + phosphate.", "evidence": [ { "id": "Q54P72", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54P72" } ] }, { "ec_number": "3.1.3.2", "activity": "", "evidence": [ { "id": "Q54P72", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54P72" } ] } ] }, { "uniprot_ac": "Q54SB4", "gene_name": "", "activity": [ { "ec_number": "3.1.3.2", "activity": "a phosphate monoester + H2O = an alcohol + phosphate.", "evidence": [ { "id": "Q54SB4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54SB4" } ] }, { "ec_number": "3.1.3.2", "activity": "", "evidence": [ { "id": "Q54SB4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54SB4" } ] } ] }, { "uniprot_ac": "Q54TC4", "gene_name": "", "activity": [ { "ec_number": "3.1.3.2", "activity": "a phosphate monoester + H2O = an alcohol + phosphate.", "evidence": [ { "id": "Q54TC4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54TC4" } ] }, { "ec_number": "3.1.3.2", "activity": "", "evidence": [ { "id": "Q54TC4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54TC4" } ] } ] }, { "uniprot_ac": "Q54Y02", "gene_name": "alp", "activity": [ { "ec_number": "3.1.3.1", "activity": "a phosphate monoester + H2O = an alcohol + phosphate.", "evidence": [ { "id": "Q54Y02", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54Y02" } ] }, { "ec_number": "3.1.3.1", "activity": "", "evidence": [ { "id": "Q54Y02", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54Y02" } ] } ] }, { "uniprot_ac": "Q558S4", "gene_name": "", "activity": [ { "ec_number": "3.1.3.2", "activity": "a phosphate monoester + H2O = an alcohol + phosphate.", "evidence": [ { "id": "Q558S4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q558S4" } ] }, { "ec_number": "3.1.3.2", "activity": "", "evidence": [ { "id": "Q558S4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q558S4" } ] } ] }, { "uniprot_ac": "Q55F12", "gene_name": "", "activity": [ { "ec_number": "3.1.3.2", "activity": "a phosphate monoester + H2O = an alcohol + phosphate.", "evidence": [ { "id": "Q55F12", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55F12" } ] }, { "ec_number": "3.1.3.2", "activity": "", "evidence": [ { "id": "Q55F12", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55F12" } ] } ] }, { "uniprot_ac": "Q55F77", "gene_name": "", "activity": [ { "ec_number": "3.1.3.2", "activity": "a phosphate monoester + H2O = an alcohol + phosphate.", "evidence": [ { "id": "Q55F77", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55F77" } ] }, { "ec_number": "3.1.3.2", "activity": "", "evidence": [ { "id": "Q55F77", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55F77" } ] } ] }, { "uniprot_ac": "Q55GW2", "gene_name": "acp1", "activity": [ { "ec_number": "3.1.3.2", "activity": "a phosphate monoester + H2O = an alcohol + phosphate.", "evidence": [ { "id": "Q55GW2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55GW2" } ] }, { "ec_number": "3.1.3.48", "activity": "H2O + O-phospho-L-tyrosyl-[protein] = L-tyrosyl-[protein] + phosphate.", "evidence": [ { "id": "Q55GW2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55GW2" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "Q55GW2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55GW2" } ] } ] }, { "uniprot_ac": "Q6ZNF0", "gene_name": "ACP7", "activity": [ { "ec_number": "3.1.3.2", "activity": "a phosphate monoester + H2O = an alcohol + phosphate.", "evidence": [ { "id": "Q6ZNF0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6ZNF0" } ] }, { "ec_number": "3.1.3.2", "activity": "", "evidence": [ { "id": "Q6ZNF0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6ZNF0" } ] } ] }, { "uniprot_ac": "Q7K3X8", "gene_name": "Alp6", "activity": [ { "ec_number": "3.1.3.1", "activity": "a phosphate monoester + H2O = an alcohol + phosphate.", "evidence": [ { "id": "Q7K3X8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7K3X8" } ] }, { "ec_number": "3.1.3.1", "activity": "", "evidence": [ { "id": "Q7K3X8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7K3X8" } ] } ] }, { "uniprot_ac": "Q7RTY9", "gene_name": "PRSS41", "activity": [ { "ec_number": "3.4.21.-", "activity": "", "evidence": [ { "id": "Q7RTY9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7RTY9" } ] } ] }, { "uniprot_ac": "Q8BP40", "gene_name": "Acp6", "activity": [ { "ec_number": "3.1.3.2", "activity": "a phosphate monoester + H2O = an alcohol + phosphate.", "evidence": [ { "id": "Q8BP40", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BP40" } ] }, { "ec_number": "3.1.3.2", "activity": "", "evidence": [ { "id": "Q8BP40", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BP40" } ] } ] }, { "uniprot_ac": "Q8BX37", "gene_name": "Acp7", "activity": [ { "ec_number": "3.1.3.2", "activity": "a phosphate monoester + H2O = an alcohol + phosphate.", "evidence": [ { "id": "Q8BX37", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BX37" } ] }, { "ec_number": "3.1.3.2", "activity": "", "evidence": [ { "id": "Q8BX37", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BX37" } ] } ] }, { "uniprot_ac": "Q8CE08", "gene_name": "Acp3", "activity": [ { "ec_number": "3.1.3.5", "activity": "a ribonucleoside 5'-phosphate + H2O = a ribonucleoside + phosphate.", "evidence": [ { "id": "Q8CE08", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8CE08" } ] }, { "ec_number": "3.1.3.2", "activity": "a phosphate monoester + H2O = an alcohol + phosphate.", "evidence": [ { "id": "Q8CE08", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8CE08" } ] }, { "ec_number": "3.1.3.48", "activity": "H2O + O-phospho-L-tyrosyl-[protein] = L-tyrosyl-[protein] + phosphate.", "evidence": [ { "id": "Q8CE08", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8CE08" } ] }, { "ec_number": "3.1.3.2", "activity": "", "evidence": [ { "id": "Q8CE08", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8CE08" } ] } ] }, { "uniprot_ac": "Q8I0P9", "gene_name": "Acph-1", "activity": [ { "ec_number": "3.1.3.2", "activity": "a phosphate monoester + H2O = an alcohol + phosphate.", "evidence": [ { "id": "Q8I0P9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8I0P9" } ] } ] }, { "uniprot_ac": "Q93070", "gene_name": "ART4", "activity": [ { "ec_number": "2.4.2.31", "activity": "L-arginyl-[protein] + NADP(+) = H(+) + N(omega)-(2'-phospho-ADP-D-ribosyl)-L-arginyl-[protein] + nicotinamide.", "evidence": [ { "id": "Q93070", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q93070" } ] }, { "ec_number": "2.4.2.31", "activity": "", "evidence": [ { "id": "Q93070", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q93070" } ] } ] }, { "uniprot_ac": "Q9BZG2", "gene_name": "ACP4", "activity": [ { "ec_number": "3.1.3.2", "activity": "a phosphate monoester + H2O = an alcohol + phosphate.", "evidence": [ { "id": "Q9BZG2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BZG2" } ] }, { "ec_number": "3.1.3.2", "activity": "", "evidence": [ { "id": "Q9BZG2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BZG2" } ] } ] }, { "uniprot_ac": "Q9D358", "gene_name": "Acp1", "activity": [ { "ec_number": "3.1.3.2", "activity": "a phosphate monoester + H2O = an alcohol + phosphate.", "evidence": [ { "id": "Q9D358", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9D358" } ] }, { "ec_number": "3.1.3.48", "activity": "H2O + O-phospho-L-tyrosyl-[protein] = L-tyrosyl-[protein] + phosphate.", "evidence": [ { "id": "Q9D358", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9D358" } ] }, { "ec_number": "3.1.3.2", "activity": "", "evidence": [ { "id": "Q9D358", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9D358" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "Q9D358", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9D358" } ] } ] }, { "uniprot_ac": "Q9NPH0", "gene_name": "ACP6", "activity": [ { "ec_number": "3.1.3.2", "activity": "a phosphate monoester + H2O = an alcohol + phosphate.", "evidence": [ { "id": "Q9NPH0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NPH0" } ] }, { "ec_number": "3.1.3.2", "activity": "", "evidence": [ { "id": "Q9NPH0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NPH0" } ] } ] }, { "uniprot_ac": "Q9VDG4", "gene_name": "Alp5", "activity": [ { "ec_number": "3.1.3.1", "activity": "a phosphate monoester + H2O = an alcohol + phosphate.", "evidence": [ { "id": "Q9VDG4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VDG4" } ] }, { "ec_number": "3.1.3.1", "activity": "", "evidence": [ { "id": "Q9VDG4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VDG4" } ] } ] }, { "uniprot_ac": "Q9VHD0", "gene_name": "phu", "activity": [ { "ec_number": "3.1.3.1", "activity": "a phosphate monoester + H2O = an alcohol + phosphate.", "evidence": [ { "id": "Q9VHD0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VHD0" } ] }, { "ec_number": "3.1.3.1", "activity": "", "evidence": [ { "id": "Q9VHD0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VHD0" } ] } ] }, { "uniprot_ac": "Q9VQ86", "gene_name": "Dmel\\CG15385", "activity": [ { "ec_number": "3.1.3.-", "activity": "", "evidence": [ { "id": "Q9VQ86", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VQ86" } ] } ] }, { "uniprot_ac": "Q9VW00", "gene_name": "Dmel\\CG9451", "activity": [ { "ec_number": "3.1.3.-", "activity": "", "evidence": [ { "id": "Q9VW00", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VW00" } ] }, { "ec_number": "3.1.3.2", "activity": "a phosphate monoester + H2O = an alcohol + phosphate.", "evidence": [ { "id": "Q9VW00", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VW00" } ] } ] }, { "uniprot_ac": "Q9W273", "gene_name": "Alp8", "activity": [ { "ec_number": "3.1.3.1", "activity": "a phosphate monoester + H2O = an alcohol + phosphate.", "evidence": [ { "id": "Q9W273", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9W273" } ] }, { "ec_number": "3.1.3.1", "activity": "", "evidence": [ { "id": "Q9W273", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9W273" } ] } ] }, { "uniprot_ac": "Q9W274", "gene_name": "Alp2", "activity": [ { "ec_number": "3.1.3.1", "activity": "a phosphate monoester + H2O = an alcohol + phosphate.", "evidence": [ { "id": "Q9W274", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9W274" } ] }, { "ec_number": "3.1.3.1", "activity": "", "evidence": [ { "id": "Q9W274", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9W274" } ] } ] }, { "uniprot_ac": "Q9W275", "gene_name": "Alp7", "activity": [ { "ec_number": "3.1.3.1", "activity": "a phosphate monoester + H2O = an alcohol + phosphate.", "evidence": [ { "id": "Q9W275", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9W275" } ] }, { "ec_number": "3.1.3.1", "activity": "", "evidence": [ { "id": "Q9W275", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9W275" } ] } ] }, { "uniprot_ac": "Q9Y6M0", "gene_name": "PRSS21", "activity": [ { "ec_number": "3.4.21.-", "activity": "", "evidence": [ { "id": "Q9Y6M0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y6M0" } ] } ] }, { "uniprot_ac": "X2JB52", "gene_name": "Dmel\\CG1637", "activity": [ { "ec_number": "3.1.3.2", "activity": "a phosphate monoester + H2O = an alcohol + phosphate.", "evidence": [ { "id": "X2JB52", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/X2JB52" } ] }, { "ec_number": "3.1.3.2", "activity": "", "evidence": [ { "id": "X2JB52", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/X2JB52" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [ 141, 268, 429 ], "o_linked_sites": [], "snv_sites": [ 141, 155, 186, 239, 270, 278, 354, 429, 442 ], "glycation_sites": [], "phosphorylation_sites": [ 111 ], "sequon_annotation_sites": [ { "start_pos": 141, "end_pos": 143 }, { "start_pos": 268, "end_pos": 270 }, { "start_pos": 429, "end_pos": 431 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 21 }, { "field": "total_sites", "count": 4 }, { "field": "n_linked_glycans", "count": 17 }, { "field": "n_linked_glycan_sites", "count": 4 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 18 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 17 }, { "field": "n_linked_glycan_sites", "count": 1 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 3 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 9 }, { "field": "total_sites", "count": 9 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 4 }, { "field": "total_sites", "count": 4 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 5 }, { "field": "total_sites", "count": 5 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 76 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }