{
"uniprot_canonical_ac": "P09917-1",
"uniprot_ac": "P09917",
"uniprot_id": "LOX5_HUMAN",
"mass": {
"chemical_mass": 77983.0,
"monoisotopic_mass": 77983.0
},
"refseq": {
"ac": "NP_000689",
"name": "polyunsaturated fatty acid 5-lipoxygenase isoform 1",
"summary": "This gene encodes a member of the lipoxygenase gene family and plays a dual role in the synthesis of leukotrienes from arachidonic acid. The encoded protein, which is expressed specifically in bone marrow-derived cells, catalyzes the conversion of arachidonic acid to 5(S)-hydroperoxy-6-trans-8,11,14-cis-eicosatetraenoic acid, and further to the allylic epoxide 5(S)-trans-7,9-trans-11,14-cis-eicosatetrenoic acid (leukotriene A4). Leukotrienes are important mediators of a number of inflammatory and allergic conditions. Mutations in the promoter region of this gene lead to a diminished response to antileukotriene drugs used in the treatment of asthma and may also be associated with atherosclerosis and several cancers. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2012].",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_000689"
},
"gene_names": [
{
"name": "ALOX5",
"resource": "UniProtKB",
"type": "recommended",
"url": "https://www.uniprot.org/uniprot/P09917",
"id": "P09917"
},
{
"name": "5-LO; 5-LOX; 5LPG; LOG5",
"resource": "RefSeq",
"type": "synonym",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_000689",
"id": "NP_000689"
},
{
"name": "ALOX5",
"resource": "RefSeq",
"type": "synonym",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_000689",
"id": "NP_000689"
},
{
"name": "LOG5",
"resource": "UniProtKB",
"type": "synonym",
"url": "https://www.uniprot.org/uniprot/P09917",
"id": "P09917"
}
],
"protein_names": [
{
"name": "Polyunsaturated fatty acid 5-lipoxygenase",
"resource": "UniProtKB",
"type": "recommended",
"url": "",
"id": "P09917"
},
{
"name": "1.13.11.-",
"resource": "UniProtKB",
"type": "synonym",
"url": "",
"id": "P09917"
},
{
"name": "1.13.11.34",
"resource": "UniProtKB",
"type": "synonym",
"url": "",
"id": "P09917"
},
{
"name": "5-LO",
"resource": "UniProtKB",
"type": "synonym",
"url": "",
"id": "P09917"
},
{
"name": "5-lipoxygenase",
"resource": "UniProtKB",
"type": "synonym",
"url": "",
"id": "P09917"
},
{
"name": "Arachidonate 5-lipoxygenase",
"resource": "UniProtKB",
"type": "synonym",
"url": "",
"id": "P09917"
},
{
"name": "arachidonic acid 5-lipoxygenase; leukotriene A4 synthase; LOX-5; polyunsaturated fatty acid 5-lipoxygenase",
"resource": "RefSeq",
"type": "synonym",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_000689",
"id": "NP_000689"
},
{
"name": "polyunsaturated fatty acid 5-lipoxygenase isoform 1",
"resource": "RefSeq",
"type": "synonym",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_000689",
"id": "NP_000689"
}
],
"function": [
{
"annotation": "ALOX5 promotes autophagy-dependent ferroptosis by activating the AMPK/mTOR pathway in melanoma.",
"evidence": [
{
"database": "RefSeq",
"id": "NP_000689",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_000689"
},
{
"database": "PubMed",
"id": "37080437",
"url": "https://glygen.org/publication/PubMed/37080437"
}
]
},
{
"annotation": "Association between a single nucleotide polymorphism of the ALOX5 gene and susceptibility to multisystem tuberculosis in a Chinese Han population.",
"evidence": [
{
"database": "RefSeq",
"id": "NP_000689",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_000689"
},
{
"database": "PubMed",
"id": "37567324",
"url": "https://glygen.org/publication/PubMed/37567324"
}
]
},
{
"annotation": "Catalyzes the oxygenation of arachidonate ((5Z,8Z,11Z,14Z)-eicosatetraenoate) to 5-hydroperoxyeicosatetraenoate (5-HPETE) followed by the dehydration to 5,6- epoxyeicosatetraenoate (Leukotriene A4/LTA4), the first two steps in the biosynthesis of leukotrienes, which are potent mediators of inflammation (PubMed:8631361, PubMed:21233389, PubMed:22516296, PubMed:24282679, PubMed:19022417, PubMed:23246375, PubMed:8615788, PubMed:24893149, PubMed:31664810). Also catalyzes the oxygenation of arachidonate into 8-hydroperoxyicosatetraenoate (8-HPETE) and 12-hydroperoxyicosatetraenoate (12-HPETE) (PubMed:23246375). Displays lipoxin synthase activity being able to convert (15S)-HETE into a conjugate tetraene (PubMed:31664810). Although arachidonate is the preferred substrate, this enzyme can also metabolize oxidized fatty acids derived from arachidonate such as (15S)-HETE, eicosapentaenoate (EPA) such as (18R)- and (18S)-HEPE or docosahexaenoate (DHA) which lead to the formation of specialized pro-resolving mediators (SPM) lipoxin and resolvins E and D respectively, therefore it participates in anti-inflammatory responses (PubMed:21206090, PubMed:31664810, PubMed:8615788, PubMed:17114001, PubMed:32404334). Oxidation of DHA directly inhibits endothelial cell proliferation and sprouting angiogenesis via peroxisome proliferator-activated receptor gamma (PPARgamma) (By similarity). It does not catalyze the oxygenation of linoleic acid and does not convert (5S)-HETE to lipoxin isomers (PubMed:31664810). In addition to inflammatory processes, it participates in dendritic cell migration, wound healing through an antioxidant mechanism based on heme oxygenase-1 (HO-1) regulation expression, monocyte adhesion to the endothelium via ITGAM expression on monocytes (By similarity). Moreover, it helps establish an adaptive humoral immunity by regulating primary resting B cells and follicular helper T cells and participates in the CD40-induced production of reactive oxygen species (ROS) after CD40 ligation in B cells through interaction with PIK3R1 that bridges ALOX5 with CD40 (PubMed:21200133). May also play a role in glucose homeostasis, regulation of insulin secretion and palmitic acid-induced insulin resistance via AMPK (By similarity). Can regulate bone mineralization and fat cell differentiation increases in induced pluripotent stem cells (By similarity).",
"evidence": [
{
"database": "UniProtKB",
"id": "P09917",
"url": "https://www.uniprot.org/uniprot/P09917#function"
},
{
"database": "PubMed",
"id": "21233389",
"url": "https://glygen.org/publication/PubMed/21233389"
},
{
"database": "PubMed",
"id": "31664810",
"url": "https://glygen.org/publication/PubMed/31664810"
},
{
"database": "PubMed",
"id": "23246375",
"url": "https://glygen.org/publication/PubMed/23246375"
},
{
"database": "PubMed",
"id": "19022417",
"url": "https://glygen.org/publication/PubMed/19022417"
},
{
"database": "PubMed",
"id": "21200133",
"url": "https://glygen.org/publication/PubMed/21200133"
},
{
"database": "PubMed",
"id": "32404334",
"url": "https://glygen.org/publication/PubMed/32404334"
},
{
"database": "PubMed",
"id": "24282679",
"url": "https://glygen.org/publication/PubMed/24282679"
},
{
"database": "PubMed",
"id": "21206090",
"url": "https://glygen.org/publication/PubMed/21206090"
},
{
"database": "UniProtKB",
"id": "P48999",
"url": "https://www.uniprot.org/uniprot/P48999#function"
},
{
"database": "PubMed",
"id": "17114001",
"url": "https://glygen.org/publication/PubMed/17114001"
},
{
"database": "PubMed",
"id": "22516296",
"url": "https://glygen.org/publication/PubMed/22516296"
},
{
"database": "PubMed",
"id": "8631361",
"url": "https://glygen.org/publication/PubMed/8631361"
},
{
"database": "PubMed",
"id": "24893149",
"url": "https://glygen.org/publication/PubMed/24893149"
},
{
"database": "PubMed",
"id": "8615788",
"url": "https://glygen.org/publication/PubMed/8615788"
}
]
},
{
"annotation": "GPR146 regulates pulmonary vascular remodeling by promoting pulmonary artery smooth muscle cell proliferation through 5-lipoxygenase.",
"evidence": [
{
"database": "RefSeq",
"id": "NP_000689",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_000689"
},
{
"database": "PubMed",
"id": "37926274",
"url": "https://glygen.org/publication/PubMed/37926274"
}
]
},
{
"annotation": "Oncogenic PIK3CA recruits myeloid-derived suppressor cells to shape the immunosuppressive tumour microenvironment in luminal breast cancer through the 5-lipoxygenase-dependent arachidonic acid pathway.",
"evidence": [
{
"database": "RefSeq",
"id": "NP_000689",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_000689"
},
{
"database": "PubMed",
"id": "37965796",
"url": "https://glygen.org/publication/PubMed/37965796"
}
]
},
{
"annotation": "Role of ALOX5 in non-small cell lung cancer: A potential therapeutic target associated with immune cell infiltration.",
"evidence": [
{
"database": "RefSeq",
"id": "NP_000689",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_000689"
},
{
"database": "PubMed",
"id": "37164914",
"url": "https://glygen.org/publication/PubMed/37164914"
}
]
},
{
"annotation": "This gene encodes a member of the lipoxygenase gene family and plays a dual role in the synthesis of leukotrienes from arachidonic acid. The encoded protein, which is expressed specifically in bone marrow-derived cells, catalyzes the conversion of arachidonic acid to 5(S)-hydroperoxy-6-trans-8,11,14-cis-eicosatetraenoic acid, and further to the allylic epoxide 5(S)-trans-7,9-trans-11,14-cis-eicosatetrenoic acid (leukotriene A4). Leukotrienes are important mediators of a number of inflammatory and allergic conditions. Mutations in the promoter region of this gene lead to a diminished response to antileukotriene drugs used in the treatment of asthma and may also be associated with atherosclerosis and several cancers. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2012].",
"evidence": [
{
"database": "RefSeq",
"id": "NP_000689",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_000689"
}
]
}
],
"disease": [],
"snv": [
{
"evidence": [
{
"id": "P09917",
"database": "BioMuta",
"url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P09917"
}
],
"glycoeffect": [],
"start_pos": 371,
"end_pos": 371,
"subjects_tested": "0",
"subjects_positive": "0",
"frequency": "0.0",
"sequence_org": "R",
"sequence_mut": "Q",
"comment": "Somatic mutation passed 1 out of 6 filters: num. of cancers (3).",
"chr_id": "10",
"chr_pos": "45440560",
"ref_nt": "G",
"alt_nt": "A",
"minor_allelic_frequency": "",
"site_lbl": "R371",
"disease": [
{
"disease_id": "DOID:9256",
"recommended_name": {
"id": "DOID:9256",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:9256",
"name": "colorectal cancer",
"description": "A large intestine cancer that is located_in the colon and/or located_in the rectum."
},
"synonyms": [
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer",
"description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma."
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "cancer of colorectum",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "cancer of large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "cancer of large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "cancer of the large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colon cancer, advanced, somatic",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colon cancer, somatic",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer with chromosomal instability, somatic",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer, somatic",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectum cancer",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant colorectal neoplasm",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant colorectal tumor",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant colorectal tumour",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant colorectum neoplasm",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large bowel neoplasm",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large bowel tumor",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large bowel tumour",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large intestine neoplasm",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large intestine tumor",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large intestine tumour",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of colorectum",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of the large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of the large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumor of large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumor of large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumor of the large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumor of the large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumour of large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumour of large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumour of the large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumour of the large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "CRC",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colon cancer",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "large intestine cancer",
"description": ""
},
{
"id": "MIM:114500",
"resource": "MIM",
"url": "https://www.omim.org/entry/114500",
"name": "Colorectal cancer",
"description": "Colorectal cancer"
}
]
},
{
"disease_id": "DOID:363",
"recommended_name": {
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "uterine cancer",
"description": "A female reproductive organ cancer that is located_in the uterus."
},
"synonyms": [
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "CA - cancer of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "Tumour of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "malignant neoplasm of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "malignant uterine tumor",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "neoplasm of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "uterine tumor",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "uterus neoplasm",
"description": ""
}
]
},
{
"disease_id": "DOID:1612",
"recommended_name": {
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "breast cancer",
"description": "A thoracic cancer that originates in the mammary gland."
},
"synonyms": [
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "breast tumor",
"description": ""
},
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "malignant neoplasm of breast",
"description": ""
},
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "malignant tumor of the breast",
"description": ""
},
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "mammary cancer",
"description": ""
},
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "mammary tumor",
"description": ""
},
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "primary breast cancer",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "hereditary breast carcinoma",
"description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma."
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer susceptibility, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, lobular, somatic",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, protection against, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, somatic",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "familial breast cancer",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "familial breast carcinoma",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "familial cancer of breast",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "familial cancer of the breast",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "hereditary breast cancer",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "hereditary breast carcinoma",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, familial",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, familial Male",
"description": ""
},
{
"id": "MIM:114480",
"resource": "MIM",
"url": "https://www.omim.org/entry/114480",
"name": "Breast cancer",
"description": "Breast cancer"
}
]
}
],
"keywords": [
"biomuta",
"somatic",
"cancer",
"disease"
]
}
],
"mutagenesis": [
{
"start_pos": 103,
"end_pos": 103,
"sequence_org": "W",
"sequence_mut": "A",
"comment": "Abolishes binding to COTL1. Impairs interaction with DICER; when associated with A-14 and A-76.",
"evidence": [
{
"database": "UniProtKB",
"id": "P09917",
"url": "https://www.uniprot.org/uniprot/P09917"
},
{
"database": "PubMed",
"id": "19022417",
"url": "https://glygen.org/publication/PubMed/19022417"
},
{
"database": "PubMed",
"id": "19807693",
"url": "https://glygen.org/publication/PubMed/19807693"
}
]
},
{
"start_pos": 14,
"end_pos": 14,
"sequence_org": "W",
"sequence_mut": "A",
"comment": "Impairs interaction with DICER1; when associated with A-76 and A-103.",
"evidence": [
{
"database": "UniProtKB",
"id": "P09917",
"url": "https://www.uniprot.org/uniprot/P09917"
},
{
"database": "PubMed",
"id": "19022417",
"url": "https://glygen.org/publication/PubMed/19022417"
}
]
},
{
"start_pos": 272,
"end_pos": 272,
"sequence_org": "S",
"sequence_mut": "A",
"comment": "Loss of phosphorylation site. Permits export from the nucleus.",
"evidence": [
{
"database": "UniProtKB",
"id": "P09917",
"url": "https://www.uniprot.org/uniprot/P09917"
},
{
"database": "PubMed",
"id": "18978352",
"url": "https://glygen.org/publication/PubMed/18978352"
}
]
},
{
"start_pos": 359,
"end_pos": 359,
"sequence_org": "D",
"sequence_mut": "N",
"comment": "No loss of activity.",
"evidence": [
{
"database": "UniProtKB",
"id": "P09917",
"url": "https://www.uniprot.org/uniprot/P09917"
}
]
},
{
"start_pos": 360,
"end_pos": 360,
"sequence_org": "F",
"sequence_mut": "W",
"comment": "Loss of (5S)-lipoxygenase activity; when associated with I-425 and M-426. Loss of (5S)-lipoxygenase activity; when associated with I-425; M-426 and I-604. Exhibits a major (15S)-lipoxygenase activity; when associated with I-425 and M-426. Exhibits a major (15S)-lipoxygenase activity; when associated with I-425; M-426 and I-604. Does not catalyze oxygenation of arachodonic acid to 5-HETE; when associated with I-425: M-426 and I-604. Catalyzes oxygenation of arachodonic acid to form mostly (15S)-HETE and (8S)-HETE but also 12-HETE; when associated with I-425: M-426 and I-604. Abolishes the LTA4-synthase activity; when associated with I-425: M-426 and I-604. Catalyzes oxygenation of linoleic acid to (13S)- and (9S)-HODE; when associated with I-425: M-426 and I-604. Catalyzes oxygenation of (11S)- and (11R)-deutero-linoleic acid to 9-HODE and (13S)-HODE respectively; when associated with I-425: M-426 and I-604. Catalyzes oxygenation of alpha-linolenic acid (ALA) to 13-HOTrE(n-3); when associated with I-425: M-426 and I-604. Catalyzes oxygenation of gamma-linolenic acid (GLA) to 13-HOTrE(n-6) and 10-HOTrE; when associated with I-425: M-426 and I-604. Catalyzes the oxygenation of eicosapentaenoic acid (EPA) to 12- and 15-HEPA; when associated with I-425: M-426 and I-604. Catalyzes the oxygenation of docosahexaenoic acid (DHA) to 10- and 17-HDHA; when associated with I-425: M-426 and I-604. Exhibits a lipoxin synthase activity towards (5S)-HETE as major substrates followed by (5S),(15S)-DiHETE and (15S)-HETE; when associated with I-425: M-426 and I-604.",
"evidence": [
{
"database": "UniProtKB",
"id": "P09917",
"url": "https://www.uniprot.org/uniprot/P09917"
},
{
"database": "PubMed",
"id": "31664810",
"url": "https://glygen.org/publication/PubMed/31664810"
},
{
"database": "PubMed",
"id": "23246375",
"url": "https://glygen.org/publication/PubMed/23246375"
}
]
},
{
"start_pos": 363,
"end_pos": 363,
"sequence_org": "H",
"sequence_mut": "N",
"comment": "Still some substantial activity.",
"evidence": [
{
"database": "UniProtKB",
"id": "P09917",
"url": "https://www.uniprot.org/uniprot/P09917"
},
{
"database": "PubMed",
"id": "1939225",
"url": "https://glygen.org/publication/PubMed/1939225"
}
]
},
{
"start_pos": 363,
"end_pos": 363,
"sequence_org": "H",
"sequence_mut": "S",
"comment": "Still some substantial activity.",
"evidence": [
{
"database": "UniProtKB",
"id": "P09917",
"url": "https://www.uniprot.org/uniprot/P09917"
},
{
"database": "PubMed",
"id": "1939225",
"url": "https://glygen.org/publication/PubMed/1939225"
}
]
},
{
"start_pos": 368,
"end_pos": 368,
"sequence_org": "H",
"sequence_mut": "A",
"comment": "No activity.",
"evidence": [
{
"database": "UniProtKB",
"id": "P09917",
"url": "https://www.uniprot.org/uniprot/P09917"
},
{
"database": "PubMed",
"id": "1540191",
"url": "https://glygen.org/publication/PubMed/1540191"
},
{
"database": "PubMed",
"id": "1939225",
"url": "https://glygen.org/publication/PubMed/1939225"
}
]
},
{
"start_pos": 368,
"end_pos": 368,
"sequence_org": "H",
"sequence_mut": "N",
"comment": "No activity.",
"evidence": [
{
"database": "UniProtKB",
"id": "P09917",
"url": "https://www.uniprot.org/uniprot/P09917"
},
{
"database": "PubMed",
"id": "1540191",
"url": "https://glygen.org/publication/PubMed/1540191"
},
{
"database": "PubMed",
"id": "1939225",
"url": "https://glygen.org/publication/PubMed/1939225"
}
]
},
{
"start_pos": 368,
"end_pos": 368,
"sequence_org": "H",
"sequence_mut": "S",
"comment": "No activity.",
"evidence": [
{
"database": "UniProtKB",
"id": "P09917",
"url": "https://www.uniprot.org/uniprot/P09917"
},
{
"database": "PubMed",
"id": "1540191",
"url": "https://glygen.org/publication/PubMed/1540191"
},
{
"database": "PubMed",
"id": "1939225",
"url": "https://glygen.org/publication/PubMed/1939225"
}
]
},
{
"start_pos": 373,
"end_pos": 373,
"sequence_org": "H",
"sequence_mut": "N",
"comment": "No activity.",
"evidence": [
{
"database": "UniProtKB",
"id": "P09917",
"url": "https://www.uniprot.org/uniprot/P09917"
},
{
"database": "PubMed",
"id": "1540191",
"url": "https://glygen.org/publication/PubMed/1540191"
},
{
"database": "PubMed",
"id": "1939225",
"url": "https://glygen.org/publication/PubMed/1939225"
}
]
},
{
"start_pos": 373,
"end_pos": 373,
"sequence_org": "H",
"sequence_mut": "S",
"comment": "No activity.",
"evidence": [
{
"database": "UniProtKB",
"id": "P09917",
"url": "https://www.uniprot.org/uniprot/P09917"
},
{
"database": "PubMed",
"id": "1540191",
"url": "https://glygen.org/publication/PubMed/1540191"
},
{
"database": "PubMed",
"id": "1939225",
"url": "https://glygen.org/publication/PubMed/1939225"
}
]
},
{
"start_pos": 377,
"end_pos": 377,
"sequence_org": "E",
"sequence_mut": "Q",
"comment": "No activity.",
"evidence": [
{
"database": "UniProtKB",
"id": "P09917",
"url": "https://www.uniprot.org/uniprot/P09917"
},
{
"database": "PubMed",
"id": "1540191",
"url": "https://glygen.org/publication/PubMed/1540191"
}
]
},
{
"start_pos": 391,
"end_pos": 391,
"sequence_org": "H",
"sequence_mut": "A",
"comment": "No activity.",
"evidence": [
{
"database": "UniProtKB",
"id": "P09917",
"url": "https://www.uniprot.org/uniprot/P09917"
},
{
"database": "PubMed",
"id": "1540191",
"url": "https://glygen.org/publication/PubMed/1540191"
},
{
"database": "PubMed",
"id": "1939225",
"url": "https://glygen.org/publication/PubMed/1939225"
}
]
},
{
"start_pos": 391,
"end_pos": 391,
"sequence_org": "H",
"sequence_mut": "N",
"comment": "Still some substantial activity.",
"evidence": [
{
"database": "UniProtKB",
"id": "P09917",
"url": "https://www.uniprot.org/uniprot/P09917"
},
{
"database": "PubMed",
"id": "1540191",
"url": "https://glygen.org/publication/PubMed/1540191"
},
{
"database": "PubMed",
"id": "1939225",
"url": "https://glygen.org/publication/PubMed/1939225"
}
]
},
{
"start_pos": 391,
"end_pos": 391,
"sequence_org": "H",
"sequence_mut": "S",
"comment": "Still some substantial activity.",
"evidence": [
{
"database": "UniProtKB",
"id": "P09917",
"url": "https://www.uniprot.org/uniprot/P09917"
},
{
"database": "PubMed",
"id": "1540191",
"url": "https://glygen.org/publication/PubMed/1540191"
},
{
"database": "PubMed",
"id": "1939225",
"url": "https://glygen.org/publication/PubMed/1939225"
}
]
},
{
"start_pos": 400,
"end_pos": 400,
"sequence_org": "H",
"sequence_mut": "A",
"comment": "No activity.",
"evidence": [
{
"database": "UniProtKB",
"id": "P09917",
"url": "https://www.uniprot.org/uniprot/P09917"
},
{
"database": "PubMed",
"id": "1540191",
"url": "https://glygen.org/publication/PubMed/1540191"
},
{
"database": "PubMed",
"id": "1939225",
"url": "https://glygen.org/publication/PubMed/1939225"
}
]
},
{
"start_pos": 400,
"end_pos": 400,
"sequence_org": "H",
"sequence_mut": "N",
"comment": "Still some substantial activity.",
"evidence": [
{
"database": "UniProtKB",
"id": "P09917",
"url": "https://www.uniprot.org/uniprot/P09917"
},
{
"database": "PubMed",
"id": "1540191",
"url": "https://glygen.org/publication/PubMed/1540191"
},
{
"database": "PubMed",
"id": "1939225",
"url": "https://glygen.org/publication/PubMed/1939225"
}
]
},
{
"start_pos": 400,
"end_pos": 400,
"sequence_org": "H",
"sequence_mut": "S",
"comment": "Still some substantial activity.",
"evidence": [
{
"database": "UniProtKB",
"id": "P09917",
"url": "https://www.uniprot.org/uniprot/P09917"
},
{
"database": "PubMed",
"id": "1540191",
"url": "https://glygen.org/publication/PubMed/1540191"
},
{
"database": "PubMed",
"id": "1939225",
"url": "https://glygen.org/publication/PubMed/1939225"
}
]
},
{
"start_pos": 425,
"end_pos": 425,
"sequence_org": "A",
"sequence_mut": "I",
"comment": "Loss of (5S)-lipoxygenase activity; when associated with W-360 and M-426. Loss of (5S)-lipoxygenase activity; when associated with W-360; M-426 and I-604. Exhibits a major (15S)-lipoxygenase activity; when associated with W-360 and M-426. Exhibits a major (15S)-lipoxygenase activity; when associated with W-360; M-426 and I-604. Does not catalyze oxygenation of arachodonic acid to 5-HETE; when associated with W-360; M-426 and I-604. Catalyzes oxygenation of arachodonic acid to form in majority (15S)-HETE and (8S)-HETE but also 12-HETE; when associated with W-360; M-426 and I-604. Abolishes the LTA4-synthase activity; when associated with W-360; M-426 and I-604. Catalyzes oxygenation of linoleic acid to (13S)- and (9S)-HODE; when associated with W-360; M-426 and I-604. Catalyzes oxygenation of (11S)- and (11R)-deutero-linoleic acid to 9-HODE and (13S)-HODE respectively; when associated with W-360; M-426 and I-604. Catalyzes oxygenation of alpha-linolenic acid (ALA) to 13-HOTrE(n-3); when associated with W-360; M-426 and I-604. Catalyzes oxygenation of gamma-linolenic acid (GLA) to 13-HOTrE(n-6) and 10-HOTrE; when associated with W-360; M-426 and I-604. Catalyzes the oxygenation of eicosapentaenoic acid (EPA) to 12- and 15-HEPA; when associated with W-360; M-426 and I-604. Catalyzes the oxygenation of docosahexaenoic acid (DHA) to 10- and 17-HDHA; when associated with W-360; M-426 and I-604. Exhibits a lipoxin synthase activity towards (5S)-HETE as major substrates followed by (5S),(15S)-DiHETE and (15S)-HETE; when associated with W-360; M-426 and I-604.",
"evidence": [
{
"database": "UniProtKB",
"id": "P09917",
"url": "https://www.uniprot.org/uniprot/P09917"
},
{
"database": "PubMed",
"id": "31664810",
"url": "https://glygen.org/publication/PubMed/31664810"
},
{
"database": "PubMed",
"id": "23246375",
"url": "https://glygen.org/publication/PubMed/23246375"
}
]
},
{
"start_pos": 426,
"end_pos": 426,
"sequence_org": "N",
"sequence_mut": "M",
"comment": "Loss of (5S)-lipoxygenase activity; when associated with W-360 and I-425. Loss of (5S)-lipoxygenase activity; when associated with W-360; I-425 and I-604. Exhibits a major (15S)-lipoxygenase activity; when associated with W-360 and I-425. Exhibits a major (15S)-lipoxygenase activity; when associated with W-360; I-425 and I-604. Does not catalyze oxygenation of arachodonic acid to 5-HETE; when associated with W-360; I-425 and I-604. Catalyzes oxygenation of arachodonic acid to form in majority (15S)-HETE and (8S)-HETE but also 12-HETE; when associated with W-360; I-425 and I-604. Abolishes the LTA4-synthase activity; when associated with W-360; I-425 and I-604. Catalyzes oxygenation of linoleic acid to (13S)- and (9S)-HODE; when associated with W-360; I-425 and I-604. Catalyzes oxygenation of (11S)- and (11R)-deutero-linoleic acid to 9-HODE and (13S)-HODE respectively; when associated with W-360; I-425 and I-604. Catalyzes oxygenation of alpha-linolenic acid (ALA) to 13-HOTrE(n-3); when associated with W-360; I-425 and I-604. Catalyzes oxygenation of gamma-linolenic acid (GLA) to 13-HOTrE(n-6) and 10-HOTrE; when associated with W-360; I-425 and I-604. Catalyzes the oxygenation of eicosapentaenoic acid (EPA) to 12- and 15-HEPA; when associated with W-360; I-425 and I-604. Catalyzes the oxygenation of docosahexaenoic acid (DHA) to 10- and 17-HDHA; when associated with W-360; I-425 and I-604. Exhibits a lipoxin synthase activity towards (5S)-HETE as major substrates followed by (5S),(15S)-DiHETE and (15S)-HETE; when associated with W-360; I-425 and I-604.",
"evidence": [
{
"database": "UniProtKB",
"id": "P09917",
"url": "https://www.uniprot.org/uniprot/P09917"
},
{
"database": "PubMed",
"id": "31664810",
"url": "https://glygen.org/publication/PubMed/31664810"
},
{
"database": "PubMed",
"id": "23246375",
"url": "https://glygen.org/publication/PubMed/23246375"
}
]
},
{
"start_pos": 433,
"end_pos": 433,
"sequence_org": "H",
"sequence_mut": "A",
"comment": "Almost no loss of activity.",
"evidence": [
{
"database": "UniProtKB",
"id": "P09917",
"url": "https://www.uniprot.org/uniprot/P09917"
}
]
},
{
"start_pos": 433,
"end_pos": 433,
"sequence_org": "H",
"sequence_mut": "N",
"comment": "Almost no loss of activity.",
"evidence": [
{
"database": "UniProtKB",
"id": "P09917",
"url": "https://www.uniprot.org/uniprot/P09917"
}
]
},
{
"start_pos": 524,
"end_pos": 524,
"sequence_org": "S",
"sequence_mut": "A",
"comment": "Prevents phosphorylation by PKA.",
"evidence": [
{
"database": "UniProtKB",
"id": "P09917",
"url": "https://www.uniprot.org/uniprot/P09917"
},
{
"database": "PubMed",
"id": "15280375",
"url": "https://glygen.org/publication/PubMed/15280375"
}
]
},
{
"start_pos": 551,
"end_pos": 551,
"sequence_org": "H",
"sequence_mut": "A",
"comment": "No activity.",
"evidence": [
{
"database": "UniProtKB",
"id": "P09917",
"url": "https://www.uniprot.org/uniprot/P09917"
},
{
"database": "PubMed",
"id": "1540191",
"url": "https://glygen.org/publication/PubMed/1540191"
}
]
},
{
"start_pos": 551,
"end_pos": 551,
"sequence_org": "H",
"sequence_mut": "N",
"comment": "No activity.",
"evidence": [
{
"database": "UniProtKB",
"id": "P09917",
"url": "https://www.uniprot.org/uniprot/P09917"
},
{
"database": "PubMed",
"id": "1540191",
"url": "https://glygen.org/publication/PubMed/1540191"
}
]
},
{
"start_pos": 604,
"end_pos": 604,
"sequence_org": "A",
"sequence_mut": "I",
"comment": "Loss of (5S)-lipoxygenase activity. Loss of (5S)-lipoxygenase activity; when associated with W-360; I-425 and M-426. Exhibits a major (15S)-lipoxygenase activity;when associated with W-360; I-425 and M-426. Does not catalyze oxygenation of arachodonic acid to 5-HETE; when associated with W-360; I-425 and M-426. Catalyzes oxygenation of arachodonic acid to form in majority (15S)-HETE and (8S)-HETE but also 12-HETE; when associated with W-360; I-425 and M-426. Abolishes the LTA4-synthase activity; when associated with W-360; I-425 and M-426. Catalyzes oxygenation of linoleic acid to (13S)- and (9 S)-HODE; when associated with W-360; I-425 and M-426. Catalyzes oxygenation of (11S)- and (11R)-deutero-linoleic acid to 9-HODE and (13S)-HODE respectively; when associated with W-360; I-425 and M-426. Catalyzes oxygenation of alpha-linolenic acid (ALA) to 13-HOTrE(n-3); when associated with W-360; I-425 and M-426. Catalyzes oxygenation of gamma-linolenic acid (GLA) to 13-HOTrE(n-6) and 10-HOTrE; when associated with W-360; I-425 and M-426. Catalyzes the oxygenation of eicosapentaenoic acid (EPA) to 12- and 15-HEPA; when associated with W-360; I-425 and M-426. Catalyzes the oxygenation of docosahexaenoic acid (DHA) to 10- and 17-HDHA; when associated with W-360; I-425 and M-426. Exhibits a lipoxin synthase activity towards (5S)-HETE as major substrates followed by (5S),(15S)-DiHETE and (15S)-HETE; when associated with W-360; I-425 and M-426.",
"evidence": [
{
"database": "UniProtKB",
"id": "P09917",
"url": "https://www.uniprot.org/uniprot/P09917"
},
{
"database": "PubMed",
"id": "31664810",
"url": "https://glygen.org/publication/PubMed/31664810"
},
{
"database": "PubMed",
"id": "23246375",
"url": "https://glygen.org/publication/PubMed/23246375"
}
]
},
{
"start_pos": 664,
"end_pos": 664,
"sequence_org": "S",
"sequence_mut": "A",
"comment": "Does not affect arachidonate 5-lipoxygenase activity. Does not oxygenate arachidonate typical 15-lipoxygenase substrates such as dihomo-gamma-linolenic acid and N-arachidonyl glycine.",
"evidence": [
{
"database": "UniProtKB",
"id": "P09917",
"url": "https://www.uniprot.org/uniprot/P09917"
},
{
"database": "PubMed",
"id": "22516296",
"url": "https://glygen.org/publication/PubMed/22516296"
}
]
},
{
"start_pos": 664,
"end_pos": 664,
"sequence_org": "S",
"sequence_mut": "D",
"comment": "Enhances affinity for arachidonic acid. Impairs arachidonate 5-lipoxygenase activity. Induces arachidonate 15-lipoxygenase activity. Oxygenates typical arachidonate 15-lipoxygenase substrates such as dihomo-gamma-linolenic acid and N-arachidonyl glycine. Synthesizes lipoxin A4 when incubated with a stable 5-lipoxygenase.",
"evidence": [
{
"database": "UniProtKB",
"id": "P09917",
"url": "https://www.uniprot.org/uniprot/P09917"
},
{
"database": "PubMed",
"id": "22516296",
"url": "https://glygen.org/publication/PubMed/22516296"
}
]
},
{
"start_pos": 76,
"end_pos": 76,
"sequence_org": "W",
"sequence_mut": "A",
"comment": "Impairs interaction with DICER1; when associated with A-14 and A-103.",
"evidence": [
{
"database": "UniProtKB",
"id": "P09917",
"url": "https://www.uniprot.org/uniprot/P09917"
},
{
"database": "PubMed",
"id": "19022417",
"url": "https://glygen.org/publication/PubMed/19022417"
}
]
}
],
"expression_tissue": [
{
"tissue": {
"name": "Adult mammalian kidney",
"namespace": "UBERON",
"id": "0000082",
"url": "http://purl.obolibrary.org/obo/UBERON_0000082"
},
"score": "74.13",
"present": "MEDIUM",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000012779",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000012779"
}
]
},
{
"tissue": {
"name": "Oral cavity",
"namespace": "UBERON",
"id": "0000167",
"url": "http://purl.obolibrary.org/obo/UBERON_0000167"
},
"score": "86.32",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000012779",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000012779"
}
]
},
{
"tissue": {
"name": "Stomach",
"namespace": "UBERON",
"id": "0000945",
"url": "http://purl.obolibrary.org/obo/UBERON_0000945"
},
"score": "77.44",
"present": "MEDIUM",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000012779",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000012779"
}
]
},
{
"tissue": {
"name": "Uterus",
"namespace": "UBERON",
"id": "0000995",
"url": "http://purl.obolibrary.org/obo/UBERON_0000995"
},
"score": "67.5",
"present": "MEDIUM",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000012779",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000012779"
}
]
},
{
"tissue": {
"name": "Esophagus",
"namespace": "UBERON",
"id": "0001043",
"url": "http://purl.obolibrary.org/obo/UBERON_0001043"
},
"score": "94.16",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000012779",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000012779"
}
]
},
{
"tissue": {
"name": "Rectum",
"namespace": "UBERON",
"id": "0001052",
"url": "http://purl.obolibrary.org/obo/UBERON_0001052"
},
"score": "86.69",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000012779",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000012779"
}
]
},
{
"tissue": {
"name": "Colon",
"namespace": "UBERON",
"id": "0001155",
"url": "http://purl.obolibrary.org/obo/UBERON_0001155"
},
"score": "69.78",
"present": "MEDIUM",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000012779",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000012779"
}
]
},
{
"tissue": {
"name": "Urinary bladder",
"namespace": "UBERON",
"id": "0001255",
"url": "http://purl.obolibrary.org/obo/UBERON_0001255"
},
"score": "95.37",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000012779",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000012779"
}
]
},
{
"tissue": {
"name": "Thyroid gland",
"namespace": "UBERON",
"id": "0002046",
"url": "http://purl.obolibrary.org/obo/UBERON_0002046"
},
"score": "76.64",
"present": "MEDIUM",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000012779",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000012779"
}
]
},
{
"tissue": {
"name": "Lung",
"namespace": "UBERON",
"id": "0002048",
"url": "http://purl.obolibrary.org/obo/UBERON_0002048"
},
"score": "91.18",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000012779",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000012779"
}
]
},
{
"tissue": {
"name": "Liver",
"namespace": "UBERON",
"id": "0002107",
"url": "http://purl.obolibrary.org/obo/UBERON_0002107"
},
"score": "77.72",
"present": "MEDIUM",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000012779",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000012779"
}
]
},
{
"tissue": {
"name": "Prostate gland",
"namespace": "UBERON",
"id": "0002367",
"url": "http://purl.obolibrary.org/obo/UBERON_0002367"
},
"score": "89.32",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000012779",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000012779"
}
]
},
{
"tissue": {
"name": "Thoracic mammary gland",
"namespace": "UBERON",
"id": "0005200",
"url": "http://purl.obolibrary.org/obo/UBERON_0005200"
},
"score": "89.52",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000012779",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000012779"
}
]
}
],
"expression_disease": [
{
"significant": "No",
"trend": "down",
"name": "Prostate cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:10283",
"evidence": [
{
"database": "BioXpress",
"id": "P09917",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09917"
}
],
"disease": [
{
"disease_id": "DOID:10283",
"recommended_name": {
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "prostate cancer",
"description": "A male reproductive organ cancer that is located_in the prostate."
},
"synonyms": [
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "NGP - new growth of prostate",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "hereditary prostate cancer",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "malignant tumor of the prostate",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "prostate cancer, familial",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "prostate neoplasm",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "prostatic cancer",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "prostatic neoplasm",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "tumor of the prostate",
"description": ""
},
{
"id": "MONDO:0012597",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012597",
"name": "prostate cancer, hereditary, 9",
"description": ""
},
{
"id": "MONDO:0012597",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012597",
"name": "prostate cancer, hereditary, 9",
"description": ""
},
{
"id": "MONDO:0012597",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012597",
"name": "prostate cancer, hereditary, type 9",
"description": ""
},
{
"id": "MONDO:0012597",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012597",
"name": "HPC9",
"description": ""
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "prostate cancer, hereditary, 12",
"description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene."
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "EHBP1 familial prostate cancer",
"description": ""
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "familial prostate cancer caused by mutation in EHBP1",
"description": ""
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "prostate cancer, hereditary, 12",
"description": ""
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "prostate cancer, hereditary, type 12",
"description": ""
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "HPC12",
"description": ""
},
{
"id": "MONDO:0012244",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012244",
"name": "prostate cancer, hereditary, 5",
"description": ""
},
{
"id": "MONDO:0012244",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012244",
"name": "prostate cancer, hereditary, 5",
"description": ""
},
{
"id": "MONDO:0012244",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012244",
"name": "prostate cancer, hereditary, type 5",
"description": ""
},
{
"id": "MONDO:0012244",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012244",
"name": "HPC5",
"description": ""
},
{
"id": "MONDO:0012093",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012093",
"name": "prostate cancer, hereditary, 3",
"description": ""
},
{
"id": "MONDO:0012093",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012093",
"name": "prostate cancer, hereditary, 3",
"description": ""
},
{
"id": "MONDO:0012093",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012093",
"name": "prostate cancer, hereditary, type 3",
"description": ""
},
{
"id": "MONDO:0012093",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012093",
"name": "prostate cancer, susceptibility to, 3",
"description": ""
},
{
"id": "MONDO:0012093",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012093",
"name": "HPC3",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "prostate cancer, hereditary, 4",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "prostate cancer, hereditary, 4",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "prostate cancer, hereditary, type 4",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "prostate cancer, susceptibility to, 4",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "HPC4",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "prostate cancer, hereditary, on chromosome 7",
"description": ""
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "prostate cancer, hereditary, 13",
"description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene."
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "MSMB familial prostate cancer",
"description": ""
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "familial prostate cancer caused by mutation in MSMB",
"description": ""
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "prostate cancer, hereditary, 13",
"description": ""
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "prostate cancer, hereditary, type 13",
"description": ""
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "HPC13",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "prostate cancer, hereditary, 8",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "prostate cancer, hereditary, 8",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "prostate cancer, hereditary, type 8",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "HPC8",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "predisposing for prostate cancer",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "prostate cancer, susceptibility to",
"description": ""
},
{
"id": "MONDO:0012300",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012300",
"name": "prostate cancer, hereditary, 6",
"description": ""
},
{
"id": "MONDO:0012300",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012300",
"name": "prostate cancer, hereditary, 6",
"description": ""
},
{
"id": "MONDO:0012300",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012300",
"name": "prostate cancer, hereditary, type 6",
"description": ""
},
{
"id": "MONDO:0012300",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012300",
"name": "HPC6",
"description": ""
},
{
"id": "MONDO:0012300",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012300",
"name": "prostate cancer, susceptibility to",
"description": ""
},
{
"id": "MONDO:0012620",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012620",
"name": "prostate cancer, hereditary, 10",
"description": ""
},
{
"id": "MONDO:0012620",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012620",
"name": "HPC10",
"description": ""
},
{
"id": "MONDO:0012620",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012620",
"name": "prostate cancer, hereditary, 10",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "familial prostate carcinoma",
"description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma."
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "familial prostate cancer",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "hereditary prostate cancer",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "hereditary prostate carcinoma",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, somatic",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, familial",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, hereditary",
"description": ""
},
{
"id": "MONDO:0012470",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012470",
"name": "prostate cancer, hereditary, 7",
"description": ""
},
{
"id": "MONDO:0012470",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012470",
"name": "HPC7",
"description": ""
},
{
"id": "MONDO:0012470",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012470",
"name": "prostate cancer, hereditary, 7",
"description": ""
},
{
"id": "MONDO:0012470",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012470",
"name": "prostate cancer aggressiveness",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "prostate cancer, hereditary, 1",
"description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene."
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "RNASEL familial prostate cancer",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "familial prostate cancer caused by mutation in RNASEL",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "prostate cancer 1",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "prostate cancer, hereditary, 1",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "prostate cancer, hereditary, type 1",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "HPC1",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "Prca1",
"description": ""
},
{
"id": "MONDO:0012768",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012768",
"name": "prostate cancer, hereditary, 11",
"description": ""
},
{
"id": "MONDO:0012768",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012768",
"name": "HPC11",
"description": ""
},
{
"id": "MONDO:0012768",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012768",
"name": "prostate cancer, hereditary, 11",
"description": ""
},
{
"id": "MONDO:0012769",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012769",
"name": "prostate cancer, hereditary, 14",
"description": ""
},
{
"id": "MONDO:0012769",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012769",
"name": "HPC14",
"description": ""
},
{
"id": "MONDO:0012769",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012769",
"name": "prostate cancer, hereditary, 14",
"description": ""
},
{
"id": "MONDO:0012770",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012770",
"name": "prostate cancer, hereditary, 15",
"description": ""
},
{
"id": "MONDO:0012770",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012770",
"name": "HPC15",
"description": ""
},
{
"id": "MONDO:0012770",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012770",
"name": "prostate cancer, hereditary, 15",
"description": ""
},
{
"id": "MONDO:0010257",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010257",
"name": "prostate cancer, hereditary, X-linked 1",
"description": ""
},
{
"id": "MONDO:0010257",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010257",
"name": "HPCX1",
"description": ""
},
{
"id": "MONDO:0010257",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010257",
"name": "prostate cancer, hereditary, X-linked 1",
"description": ""
},
{
"id": "MONDO:0010257",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010257",
"name": "prostate cancer susceptibility, X-linked",
"description": ""
},
{
"id": "MONDO:0010405",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010405",
"name": "prostate cancer, hereditary, X-linked 2",
"description": ""
},
{
"id": "MONDO:0010405",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010405",
"name": "HPCX2",
"description": ""
},
{
"id": "MONDO:0010405",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010405",
"name": "prostate cancer, hereditary, X-linked 2",
"description": ""
},
{
"id": "MIM:611868",
"resource": "MIM",
"url": "https://www.omim.org/entry/611868",
"name": "Prostate cancer, hereditary, 12",
"description": "Prostate cancer, hereditary, 12"
},
{
"id": "MIM:611928",
"resource": "MIM",
"url": "https://www.omim.org/entry/611928",
"name": "Prostate cancer, hereditary, 13",
"description": "Prostate cancer, hereditary, 13"
},
{
"id": "MIM:176807",
"resource": "MIM",
"url": "https://www.omim.org/entry/176807",
"name": "Prostate cancer",
"description": "Prostate cancer"
},
{
"id": "MIM:601518",
"resource": "MIM",
"url": "https://www.omim.org/entry/601518",
"name": "Prostate cancer, hereditary, 1",
"description": "Prostate cancer, hereditary, 1"
},
{
"id": "MIM:611955",
"resource": "MIM",
"url": "https://www.omim.org/entry/611955",
"name": "Prostate cancer, hereditary, 11",
"description": "Prostate cancer, hereditary, 11"
}
]
}
]
},
{
"significant": "No",
"trend": "up",
"name": "Stomach cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:10534",
"evidence": [
{
"database": "BioXpress",
"id": "P09917",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09917"
}
],
"disease": [
{
"disease_id": "DOID:10534",
"recommended_name": {
"id": "DOID:10534",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10534",
"name": "stomach cancer",
"description": "A gastrointestinal system cancer that is located_in the stomach."
},
"synonyms": [
{
"id": "DOID:10534",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10534",
"name": "gastric cancer",
"description": ""
},
{
"id": "DOID:10534",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10534",
"name": "gastric neoplasm",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer",
"description": "A primary or metastatic malignant neoplasm involving the stomach."
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric neoplasm",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "Ca lesser curvature - stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "cancer of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer risk after h. pylori infection",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer, somatic",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant gastric neoplasm",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant gastric tumor",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant gastric tumour",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant neoplasm of lesser curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant neoplasm of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant neoplasm of the stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant stomach neoplasm",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of body of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of greater curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of lesser curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of the stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of body of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of greater curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of lesser curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of the stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "stomach cancer",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "Ca body - stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "ca greater curvature of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant neoplasm of body of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer, intestinal",
"description": ""
},
{
"id": "MIM:613659",
"resource": "MIM",
"url": "https://www.omim.org/entry/613659",
"name": "Gastric cancer",
"description": "Gastric cancer"
}
]
}
]
},
{
"significant": "No",
"trend": "down",
"name": "Urinary bladder cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:11054",
"evidence": [
{
"database": "BioXpress",
"id": "P09917",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09917"
}
],
"disease": [
{
"disease_id": "DOID:11054",
"recommended_name": {
"id": "DOID:11054",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11054",
"name": "urinary bladder cancer",
"description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder."
},
"synonyms": [
{
"id": "DOID:11054",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11054",
"name": "bladder cancer",
"description": ""
},
{
"id": "DOID:11054",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11054",
"name": "tumor of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "urinary bladder cancer",
"description": "A primary or metastatic malignant neoplasm involving the bladder."
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "tumor of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "tumour of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "bladder cancer, somatic",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "cancer of urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant bladder neoplasm",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant bladder tumor",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant bladder tumour",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm of bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm of the urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm of urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm, bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm, urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumor of bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumor of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumor of the urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumor of urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumor, urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumour of bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumour of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumour of the urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumour of urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant urinary bladder neoplasm",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant urinary bladder tumor",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant urinary bladder tumour",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "urinary bladder cancer",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "urinary bladder malignant neoplasm",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "urinary bladder malignant tumor",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "urinary bladder malignant tumour",
"description": ""
},
{
"id": "MIM:109800",
"resource": "MIM",
"url": "https://www.omim.org/entry/109800",
"name": "Bladder cancer",
"description": "Bladder cancer"
}
]
}
]
},
{
"significant": "No",
"trend": "down",
"name": "Head and neck cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:11934",
"evidence": [
{
"database": "BioXpress",
"id": "P09917",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09917"
}
],
"disease": [
{
"disease_id": "DOID:11934",
"recommended_name": {
"id": "DOID:11934",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11934",
"name": "head and neck cancer",
"description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx."
},
"synonyms": [
{
"id": "DOID:11934",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11934",
"name": "head and neck neoplasm",
"description": ""
},
{
"id": "DOID:11934",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11934",
"name": "head and neck tumours",
"description": ""
},
{
"id": "DOID:11934",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11934",
"name": "head/neck neoplasm",
"description": ""
},
{
"id": "DOID:11934",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11934",
"name": "tumor of head and neck",
"description": ""
}
]
}
]
},
{
"significant": "Yes",
"trend": "down",
"name": "Lung cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:1324",
"evidence": [
{
"database": "BioXpress",
"id": "P09917",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09917"
}
],
"disease": [
{
"disease_id": "DOID:1324",
"recommended_name": {
"id": "DOID:1324",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1324",
"name": "lung cancer",
"description": "A respiratory system cancer that is located_in the lung."
},
"synonyms": [
{
"id": "MONDO:0012159",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012159",
"name": "lung cancer susceptibility 1",
"description": ""
},
{
"id": "MONDO:0012159",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012159",
"name": "LNCR1",
"description": ""
},
{
"id": "MONDO:0012159",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012159",
"name": "lung cancer susceptibility",
"description": ""
},
{
"id": "MONDO:0012159",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012159",
"name": "lung cancer susceptibility 1",
"description": ""
},
{
"id": "MONDO:0012942",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012942",
"name": "lung cancer susceptibility 3",
"description": ""
},
{
"id": "MONDO:0012942",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012942",
"name": "LNCR3",
"description": ""
},
{
"id": "MONDO:0012942",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012942",
"name": "lung cancer susceptibility 3",
"description": ""
},
{
"id": "MONDO:0012942",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012942",
"name": "adenocarcinoma of lung, susceptibility to",
"description": ""
},
{
"id": "MONDO:0012955",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012955",
"name": "lung cancer susceptibility 4",
"description": ""
},
{
"id": "MONDO:0012955",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012955",
"name": "LNCR4",
"description": ""
},
{
"id": "MONDO:0012955",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012955",
"name": "lung cancer susceptibility 4",
"description": ""
},
{
"id": "MONDO:0013631",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0013631",
"name": "lung cancer susceptibility 5",
"description": ""
},
{
"id": "MONDO:0013631",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0013631",
"name": "LNCR5",
"description": ""
},
{
"id": "MONDO:0013631",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0013631",
"name": "lung cancer susceptibility 5",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer",
"description": "A malignant neoplasm involving the lung."
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "adenocarcinoma of lung, somatic",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "cancer of lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer, protection against, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer, resistance to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer, somatic",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant lung neoplasm",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant lung tumor",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant lung tumour",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant neoplasm of lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant neoplasm of the lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant tumor of lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant tumor of the lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant tumour of lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant tumour of the lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "nonsmall cell lung cancer, somatic",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "Nonsmall cell lung cancer",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "alveolar cell carcinoma",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer, protection against",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung neoplasm",
"description": ""
},
{
"id": "MIM:211980",
"resource": "MIM",
"url": "https://www.omim.org/entry/211980",
"name": "Lung cancer",
"description": "Lung cancer"
}
]
}
]
},
{
"significant": "No",
"trend": "up",
"name": "Breast cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:1612",
"evidence": [
{
"database": "BioXpress",
"id": "P09917",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09917"
}
],
"disease": [
{
"disease_id": "DOID:1612",
"recommended_name": {
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "breast cancer",
"description": "A thoracic cancer that originates in the mammary gland."
},
"synonyms": [
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "breast tumor",
"description": ""
},
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "malignant neoplasm of breast",
"description": ""
},
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "malignant tumor of the breast",
"description": ""
},
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "mammary cancer",
"description": ""
},
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "mammary tumor",
"description": ""
},
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "primary breast cancer",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "hereditary breast carcinoma",
"description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma."
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer susceptibility, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, lobular, somatic",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, protection against, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, somatic",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "familial breast cancer",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "familial breast carcinoma",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "familial cancer of breast",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "familial cancer of the breast",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "hereditary breast cancer",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "hereditary breast carcinoma",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, familial",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, familial Male",
"description": ""
},
{
"id": "MIM:114480",
"resource": "MIM",
"url": "https://www.omim.org/entry/114480",
"name": "Breast cancer",
"description": "Breast cancer"
}
]
}
]
},
{
"significant": "Yes",
"trend": "up",
"name": "Thyroid cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:1781",
"evidence": [
{
"database": "BioXpress",
"id": "P09917",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09917"
}
],
"disease": [
{
"disease_id": "DOID:1781",
"recommended_name": {
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "thyroid cancer",
"description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage."
},
"synonyms": [
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "thyroid gland cancer",
"description": ""
},
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "Thyroid gland neoplasm",
"description": ""
},
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "malignant neoplasm of thyroid gland",
"description": ""
},
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "malignant tumour of thyroid gland",
"description": ""
},
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "neoplasm of thyroid gland",
"description": ""
},
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "thyroid neoplasm",
"description": ""
}
]
}
]
},
{
"significant": "Yes",
"trend": "up",
"name": "Kidney cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:263",
"evidence": [
{
"database": "BioXpress",
"id": "P09917",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09917"
}
],
"disease": [
{
"disease_id": "DOID:263",
"recommended_name": {
"id": "DOID:263",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:263",
"name": "kidney cancer",
"description": "A urinary system cancer that is located_in the kidney."
},
"synonyms": [
{
"id": "DOID:263",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:263",
"name": "malignant neoplasm of kidney except pelvis",
"description": ""
},
{
"id": "DOID:263",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:263",
"name": "malignant tumour of kidney",
"description": ""
},
{
"id": "DOID:263",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:263",
"name": "renal cancer",
"description": ""
}
]
}
]
},
{
"significant": "No",
"trend": "up",
"name": "Liver cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:3571",
"evidence": [
{
"database": "BioXpress",
"id": "P09917",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09917"
}
],
"disease": [
{
"disease_id": "DOID:3571",
"recommended_name": {
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "liver cancer",
"description": "A hepatobiliary system cancer that is located_in the liver."
},
"synonyms": [
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "Ca liver - primary",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "Resectable malignant neoplasm of Liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "hepatic cancer",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "hepatic neoplasm",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "malignant hepato-biliary neoplasm",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "malignant neoplasm of liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "malignant neoplasm of liver, primary",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "malignant tumor of liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "neoplasm of liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "non-resectable primary hepatic malignant neoplasm",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "primary liver cancer",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "primary malignant neoplasm of liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "resectable malignant neoplasm of the liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "malignant neoplasm of liver, not specified as primary or secondary",
"description": ""
}
]
}
]
},
{
"significant": "No",
"trend": "up",
"name": "Uterine cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:363",
"evidence": [
{
"database": "BioXpress",
"id": "P09917",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09917"
}
],
"disease": [
{
"disease_id": "DOID:363",
"recommended_name": {
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "uterine cancer",
"description": "A female reproductive organ cancer that is located_in the uterus."
},
"synonyms": [
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "CA - cancer of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "Tumour of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "malignant neoplasm of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "malignant uterine tumor",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "neoplasm of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "uterine tumor",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "uterus neoplasm",
"description": ""
}
]
}
]
},
{
"significant": "No",
"trend": "up",
"name": "Esophageal cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:5041",
"evidence": [
{
"database": "BioXpress",
"id": "P09917",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09917"
}
],
"disease": [
{
"disease_id": "DOID:5041",
"recommended_name": {
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "esophageal cancer",
"description": "A gastrointestinal system cancer that is located_in the esophagus."
},
"synonyms": [
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "Ca lower third oesophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "Ca middle third oesophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "esophagus cancer",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant neoplasm of distal third of esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant neoplasm of lower third of oesophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant neoplasm of middle third of oesophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant neoplasm of proximal third of esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant neoplasm of upper third esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant tumor of Distal Third of esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant tumor of Proximal Third of esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant tumor of abdominal esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant tumor of the middle Third of the esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal cancer",
"description": "A primary or metastatic malignant neoplasm involving the esophagus."
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "cancer of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "cancer of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal cancer",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal cancer, somatic",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal carcinoma, somatic",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal squamous cell carcinoma, somatic",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophagus cancer",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant esophageal neoplasm",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant esophageal tumor",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant esophageal tumour",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant esophagus neoplasm",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant esophagus tumor",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of the esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of the oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant oesophagus neoplasm",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant oesophagus tumour",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of the esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of the oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "oesophagus cancer",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Ca lower third esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Ca lower third oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Ca middle third esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Ca middle third oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of distal third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of distal third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of lower third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of lower third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of middle third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of middle third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of proximal third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of proximal third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of upper third esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of upper third oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of abdominal esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of distal third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of proximal third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of the middle third of the esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of abdominal oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of distal third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of proximal third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of the middle third of the oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Aerodigestive tract cancer, susceptibility to",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Escc, susceptibility to",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal squamous cell carcinoma, susceptibility to",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "gastric cardia adenocarcinoma, susceptibility to",
"description": ""
},
{
"id": "MIM:133239",
"resource": "MIM",
"url": "https://www.omim.org/entry/133239",
"name": "Esophageal cancer",
"description": "Esophageal cancer"
}
]
}
]
},
{
"significant": "No",
"trend": "up",
"name": "Colorectal cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:9256",
"evidence": [
{
"database": "BioXpress",
"id": "P09917",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09917"
}
],
"disease": [
{
"disease_id": "DOID:9256",
"recommended_name": {
"id": "DOID:9256",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:9256",
"name": "colorectal cancer",
"description": "A large intestine cancer that is located_in the colon and/or located_in the rectum."
},
"synonyms": [
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer",
"description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma."
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "cancer of colorectum",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "cancer of large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "cancer of large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "cancer of the large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colon cancer, advanced, somatic",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colon cancer, somatic",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer with chromosomal instability, somatic",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer, somatic",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectum cancer",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant colorectal neoplasm",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant colorectal tumor",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant colorectal tumour",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant colorectum neoplasm",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large bowel neoplasm",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large bowel tumor",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large bowel tumour",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large intestine neoplasm",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large intestine tumor",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large intestine tumour",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of colorectum",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of the large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of the large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumor of large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumor of large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumor of the large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumor of the large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumour of large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumour of large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumour of the large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumour of the large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "CRC",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colon cancer",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "large intestine cancer",
"description": ""
},
{
"id": "MIM:114500",
"resource": "MIM",
"url": "https://www.omim.org/entry/114500",
"name": "Colorectal cancer",
"description": "Colorectal cancer"
}
]
}
]
}
],
"species": [
{
"name": "Homo sapiens",
"taxid": 9606,
"evidence": [
{
"database": "UniProtKB",
"id": "P09917",
"url": "https://www.uniprot.org/uniprot/P09917"
}
],
"common_name": "Human"
}
],
"gene": [
{
"name": "ALOX5",
"url": "https://www.uniprot.org/uniprot/P09917",
"locus": {
"chromosome": "10",
"start_pos": 45446119,
"end_pos": 45374176,
"strand": "-",
"evidence": [
{
"database": "Ensembl Gene",
"id": "ENSG00000012779",
"url": "https://www.ensembl.org/id/ENSG00000012779"
}
]
}
}
],
"crossref": [
{
"id": "ENSG00000012779",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000012779",
"database": "Bgee",
"categories": [
"Gene Expression"
]
},
{
"id": "P09917",
"url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P09917",
"database": "BioMuta",
"categories": [
"Variation"
]
},
{
"id": "1.13.11.34",
"url": "https://www.brenda-enzymes.org/enzyme.php?ecno=1.13.11.34&UniProtAcc=P09917",
"database": "BRENDA",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "cd01753",
"url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd01753",
"database": "CDD",
"categories": [
"Protein Classification"
]
},
{
"id": "CHEMBL215",
"url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL215",
"database": "ChEMBL",
"categories": [
"Other"
]
},
{
"id": "ALOX5",
"url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=ALOX5",
"database": "GeneCards",
"categories": [
"Gene Annotation",
"Organism-specific"
]
},
{
"id": "240",
"url": "https://www.ncbi.nlm.nih.gov/gene/240",
"database": "GeneID",
"categories": [
"Genome Annotation"
]
},
{
"id": "435",
"url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=435",
"database": "HGNC",
"categories": [
"Organism-specific"
]
},
{
"id": "P09917",
"url": "https://www.ebi.ac.uk/intact/interactors/id:P09917*",
"database": "IntAct",
"categories": [
"Other"
]
},
{
"id": "IPR000907",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR000907",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "IPR001024",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR001024",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "IPR001885",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR001885",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "IPR013819",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR013819",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "IPR020833",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR020833",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "IPR020834",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR020834",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "IPR036226",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR036226",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "IPR036392",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR036392",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "IPR042062",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR042062",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "hsa:240",
"url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:240",
"database": "KEGG Pathway",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "152390",
"url": "http://www.omim.org/entry/152390",
"database": "MIM",
"categories": [
"Other"
]
},
{
"id": "NX_P09917",
"url": "https://www.nextprot.org/entry/NX_P09917",
"database": "neXtProt",
"categories": [
"Protein",
"Organism-specific"
]
},
{
"id": "WLLAKMM",
"url": "https://omabrowser.org/oma/group/WLLAKMM/",
"database": "OMA",
"categories": [
"Protein Classification"
]
},
{
"id": "999249at2759",
"url": "http://www.orthodb.org/?query=999249at2759",
"database": "OrthoDB",
"categories": [
"Protein Classification"
]
},
{
"id": "PTHR11771",
"url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11771",
"database": "PANTHER",
"categories": [
"Protein Classification"
]
},
{
"id": "PTHR11771:SF5",
"url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11771:SF5",
"database": "PANTHER",
"categories": [
"Protein Classification"
]
},
{
"id": "PTHR31718",
"url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR31718",
"database": "PANTHER",
"categories": [
"Protein Classification"
]
},
{
"id": "PTHR31718:SF60",
"url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR31718:SF60",
"database": "PANTHER",
"categories": [
"Protein Classification"
]
},
{
"id": "3O8Y",
"url": "https://www.rcsb.org/structure/3O8Y",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "3V92",
"url": "https://www.rcsb.org/structure/3V92",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "3V98",
"url": "https://www.rcsb.org/structure/3V98",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "3V99",
"url": "https://www.rcsb.org/structure/3V99",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "6N2W",
"url": "https://www.rcsb.org/structure/6N2W",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "6NCF",
"url": "https://www.rcsb.org/structure/6NCF",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "7TTJ",
"url": "https://www.rcsb.org/structure/7TTJ",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "7TTK",
"url": "https://www.rcsb.org/structure/7TTK",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "7TTL",
"url": "https://www.rcsb.org/structure/7TTL",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "PF00305",
"url": "http://pfam.xfam.org/family/PF00305",
"database": "Pfam",
"categories": [
"Protein Classification"
]
},
{
"id": "PF01477",
"url": "http://pfam.xfam.org/family/PF01477",
"database": "Pfam",
"categories": [
"Protein Classification"
]
},
{
"id": "P09917",
"url": "https://pharos.nih.gov/targets/P09917",
"database": "PHAROS",
"categories": [
"Organism-specific"
]
},
{
"id": "PR_P09917",
"url": "http://purl.obolibrary.org/obo/PR_P09917",
"database": "PRO",
"categories": [
"Protein"
]
},
{
"id": "R-HSA-2142688",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2142688",
"database": "Reactome",
"categories": [
"Protein Classification"
]
},
{
"id": "R-HSA-2142691",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2142691",
"database": "Reactome",
"categories": [
"Protein Classification"
]
},
{
"id": "R-HSA-2142700",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2142700",
"database": "Reactome",
"categories": [
"Protein Classification"
]
},
{
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807",
"database": "Reactome",
"categories": [
"Protein Classification"
]
},
{
"id": "R-HSA-6798695",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6798695",
"database": "Reactome",
"categories": [
"Protein Classification"
]
},
{
"id": "R-HSA-9012546",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9012546",
"database": "Reactome",
"categories": [
"Protein Classification"
]
},
{
"id": "R-HSA-9018676",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018676",
"database": "Reactome",
"categories": [
"Protein Classification"
]
},
{
"id": "R-HSA-9018682",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018682",
"database": "Reactome",
"categories": [
"Protein Classification"
]
},
{
"id": "R-HSA-9018896",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018896",
"database": "Reactome",
"categories": [
"Protein Classification"
]
},
{
"id": "R-HSA-9020265",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9020265",
"database": "Reactome",
"categories": [
"Protein Classification"
]
},
{
"id": "R-HSA-9023661",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9023661",
"database": "Reactome",
"categories": [
"Protein Classification"
]
},
{
"id": "R-HSA-9026286",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9026286",
"database": "Reactome",
"categories": [
"Protein Classification"
]
},
{
"id": "R-HSA-9026290",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9026290",
"database": "Reactome",
"categories": [
"Protein Classification"
]
},
{
"id": "R-HSA-9026403",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9026403",
"database": "Reactome",
"categories": [
"Protein Classification"
]
},
{
"id": "R-HSA-9027604",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9027604",
"database": "Reactome",
"categories": [
"Protein Classification"
]
},
{
"id": "NP_000689",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_000689",
"database": "RefSeq",
"categories": [
"Protein"
]
},
{
"id": "10428",
"url": "https://www.rhea-db.org/rhea/10428",
"database": "Rhea",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "17485",
"url": "https://www.rhea-db.org/rhea/17485",
"database": "Rhea",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "17961",
"url": "https://www.rhea-db.org/rhea/17961",
"database": "Rhea",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "32307",
"url": "https://www.rhea-db.org/rhea/32307",
"database": "Rhea",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "38675",
"url": "https://www.rhea-db.org/rhea/38675",
"database": "Rhea",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "39107",
"url": "https://www.rhea-db.org/rhea/39107",
"database": "Rhea",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "41332",
"url": "https://www.rhea-db.org/rhea/41332",
"database": "Rhea",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "48624",
"url": "https://www.rhea-db.org/rhea/48624",
"database": "Rhea",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "48860",
"url": "https://www.rhea-db.org/rhea/48860",
"database": "Rhea",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "50204",
"url": "https://www.rhea-db.org/rhea/50204",
"database": "Rhea",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "50268",
"url": "https://www.rhea-db.org/rhea/50268",
"database": "Rhea",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "50840",
"url": "https://www.rhea-db.org/rhea/50840",
"database": "Rhea",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "50844",
"url": "https://www.rhea-db.org/rhea/50844",
"database": "Rhea",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "51968",
"url": "https://www.rhea-db.org/rhea/51968",
"database": "Rhea",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "62600",
"url": "https://www.rhea-db.org/rhea/62600",
"database": "Rhea",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "62644",
"url": "https://www.rhea-db.org/rhea/62644",
"database": "Rhea",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "62648",
"url": "https://www.rhea-db.org/rhea/62648",
"database": "Rhea",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "64668",
"url": "https://www.rhea-db.org/rhea/64668",
"database": "Rhea",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "A0A087X109",
"url": "https://www.uniprot.org/uniprot/A0A087X109",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "A0A087X109-1",
"url": "https://www.uniprot.org/uniprot/A0A087X109-1",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "P09917",
"url": "https://www.uniprot.org/uniprot/P09917",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "P09917-1",
"url": "https://www.uniprot.org/uniprot/P09917-1",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "P09917-2",
"url": "https://www.uniprot.org/uniprot/P09917-2",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "P09917-3",
"url": "https://www.uniprot.org/uniprot/P09917-3",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "P09917-4",
"url": "https://www.uniprot.org/uniprot/P09917-4",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "P09917-5",
"url": "https://www.uniprot.org/uniprot/P09917-5",
"database": "UniProtKB",
"categories": [
"Protein"
]
}
],
"sequence": {
"sequence": "MPSYTVTVATGSQWFAGTDDYIYLSLVGSAGCSEKHLLDKPFYNDFERGAVDSYDVTVDEELGEIQLVRIEKRKYWLNDDWYLKYITLKTPHGDYIEFPCYRWITGDVEVVLRDGRAKLARDDQIHILKQHRRKELETRQKQYRWMEWNPGFPLSIDAKCHKDLPRDIQFDSEKGVDFVLNYSKAMENLFINRFMHMFQSSWNDFADFEKIFVKISNTISERVMNHWQEDLMFGYQFLNGCNPVLIRRCTELPEKLPVTTEMVECSLERQLSLEQEVQQGNIFIVDFELLDGIDANKTDPCTLQFLAAPICLLYKNLANKIVPIAIQLNQIPGDENPIFLPSDAKYDWLLAKIWVRSSDFHVHQTITHLLRTHLVSEVFGIAMYRQLPAVHPIFKLLVAHVRFTIAINTKAREQLICECGLFDKANATGGGGHVQMVQRAMKDLTYASLCFPEAIKARGMESKEDIPYYFYRDDGLLVWEAIRTFTAEVVDIYYEGDQVVEEDPELQDFVNDVYVYGMRGRKSSGFPKSVKSREQLSEYLTVVIFTASAQHAAVNFGQYDWCSWIPNAPPTMRAPPPTAKGVVTIEQIVDTLPDRGRSCWHLGAVWALSQFQENELFLGMYPEEHFIEKPVKEAMARFRKNLEAIVSVIAERNKKKQLPYYYLSPDRIPNSVAI",
"length": 674,
"header": "sp|P09917-1|LOX5_HUMAN Isoform 1 of Polyunsaturated fatty acid 5-lipoxygenase OS=Homo sapiens OX=9606 GN=ALOX5 PE=1 SV=2 CANONICAL=P09917-1"
},
"isoforms": [
{
"isoform_ac": "A0A087X109-1",
"url": "",
"sequence": {
"sequence": "MPSYTVTVATGSQWFAGTDDYIYLSLVGSAGCSEKHLLDKPFYNDFERGAVDSYDVTVDEELGEIQLVRIEKRKYWLNDDWYLKYITLKTPHGDYIEFPCYRWITGDVEVVLRDGREMDGVEPWLPLEHRCQMPQGFTP",
"length": 139,
"header": "tr|A0A087X109-1|LOX5_HUMAN Computationally mapped isoform of Polyunsaturated fatty acid 5-lipoxygenase OS=Homo sapiens OX=9606 GN=ALOX5 PE=1 SV=1 CANONICAL=P09917-1"
},
"locus": {
"chromosome": "HSCHR10_1_CTG2",
"start_pos": 253087,
"end_pos": 215111,
"strand": "-",
"evidence": [
{
"database": "Ensembl Transcript",
"id": "ENST00000622238.1",
"url": "https://www.ensembl.org/id/ENST00000622238.1"
},
{
"database": "Ensembl Peptide",
"id": "ENSP00000479452.1",
"url": "https://www.ensembl.org/id/ENSP00000479452.1"
}
]
}
},
{
"isoform_ac": "P09917-1",
"url": "",
"sequence": {
"sequence": "MPSYTVTVATGSQWFAGTDDYIYLSLVGSAGCSEKHLLDKPFYNDFERGAVDSYDVTVDEELGEIQLVRIEKRKYWLNDDWYLKYITLKTPHGDYIEFPCYRWITGDVEVVLRDGRAKLARDDQIHILKQHRRKELETRQKQYRWMEWNPGFPLSIDAKCHKDLPRDIQFDSEKGVDFVLNYSKAMENLFINRFMHMFQSSWNDFADFEKIFVKISNTISERVMNHWQEDLMFGYQFLNGCNPVLIRRCTELPEKLPVTTEMVECSLERQLSLEQEVQQGNIFIVDFELLDGIDANKTDPCTLQFLAAPICLLYKNLANKIVPIAIQLNQIPGDENPIFLPSDAKYDWLLAKIWVRSSDFHVHQTITHLLRTHLVSEVFGIAMYRQLPAVHPIFKLLVAHVRFTIAINTKAREQLICECGLFDKANATGGGGHVQMVQRAMKDLTYASLCFPEAIKARGMESKEDIPYYFYRDDGLLVWEAIRTFTAEVVDIYYEGDQVVEEDPELQDFVNDVYVYGMRGRKSSGFPKSVKSREQLSEYLTVVIFTASAQHAAVNFGQYDWCSWIPNAPPTMRAPPPTAKGVVTIEQIVDTLPDRGRSCWHLGAVWALSQFQENELFLGMYPEEHFIEKPVKEAMARFRKNLEAIVSVIAERNKKKQLPYYYLSPDRIPNSVAI",
"length": 674,
"header": "sp|P09917-1|LOX5_HUMAN Isoform 1 of Polyunsaturated fatty acid 5-lipoxygenase OS=Homo sapiens OX=9606 GN=ALOX5 PE=1 SV=2 CANONICAL=P09917-1"
},
"locus": {
"chromosome": "10",
"start_pos": 45445684,
"end_pos": 45374280,
"strand": "-",
"evidence": [
{
"database": "Ensembl Transcript",
"id": "ENST00000374391.7",
"url": "https://www.ensembl.org/id/ENST00000374391.7"
},
{
"database": "Ensembl Peptide",
"id": "ENSP00000363512.2",
"url": "https://www.ensembl.org/id/ENSP00000363512.2"
}
]
}
},
{
"isoform_ac": "P09917-2",
"url": "",
"sequence": {
"sequence": "MPSYTVTVATGSQWFAGTDDYIYLSLVGSAGCSEKHLLDKPFYNDFERGAVDSYDVTVDEELGEIQLVRIEKRKYWLNDDWYLKYITLKTPHGDYIEFPCYRWITGDVEVVLRDGRAKLARDDQIHILKQHRRKELETRQKQYRWMEWNPGFPLSIDAKCHKDLPRDIQFDSEKGVDFVLNYSKAMENLFINRFMHMFQSSWNDFADFEKIFVKISNTISERVMNHWQEDLMFGYQFLNGCNPVLIRRCTELPEKLPVTTEMVECSLERQLSLEQEVQQGNIFIVDFELLDGIDANKTDPCTLQFLAAPICLLYKNLANKIVPIAIQLNQIPGDENPIFLPSDAKYDWLLAKIWVRSSDFHVHQTITHLLRTHLVSEVFGIAMYRQLPAVHPIFKLLVAHVRFTIAINTKAREQLICECGLFDKANATGGGGHVQMVQRAMKDLTYASLCFPEAIKARGMESKEDIPYYFYRDDGLLVWEAIRTFTAEVVDIYYEGDQVVEEDPELQDFVNDVYVYGMRGRKSSGFPKSVKSREQLSEYLTVVIFTASAQHAAVNFGQLFLGMYPEEHFIEKPVKEAMARFRKNLEAIVSVIAERNKKKQLPYYYLSPDRIPNSVAI",
"length": 617,
"header": "sp|P09917-2|LOX5_HUMAN Isoform 2 of Polyunsaturated fatty acid 5-lipoxygenase OS=Homo sapiens OX=9606 GN=ALOX5 PE=1 SV=2 CANONICAL=P09917-1"
},
"locus": {
"chromosome": "10",
"start_pos": 45445684,
"end_pos": 45374280,
"strand": "-",
"evidence": [
{
"database": "Ensembl Transcript",
"id": "ENST00000542434.5",
"url": "https://www.ensembl.org/id/ENST00000542434.5"
},
{
"database": "Ensembl Peptide",
"id": "ENSP00000437634.1",
"url": "https://www.ensembl.org/id/ENSP00000437634.1"
}
]
}
},
{
"isoform_ac": "P09917-3",
"url": "",
"sequence": {
"sequence": "MPSYTVTVATGSQWFAGTDDYIYLSLVGSAGCSEKHLLDKPFYNDFERGAVDSYDVTVDEELGEIQLVRIEKRKYWLNDDWYLKYITLKTPHGDYIEFPCYRWITGDVEVVLRDGRAKLARDDQIHILKQHRRKELETRQKQYRWMEWNPGFPLSIDAKCHKDLPRDIQFDSEKGVDFVLNYSKAMENLFINRFMHMFQSSWNDFADFEKIFVKISNTISERVMNHWQEDLMFGYQFLNGCNPVLIRRCTELPEKLPVTTEMVECSLERQLSLEQEVQQGNIFIVDFELLDGIDANKTDPCTLQFLAAPICLLYKNLANKIVPIAIQLNQIPGDENPIFLPSDAKYDWLLAKIWVRSSDFHVHQTITHLLRTHLVSEVFGIAMYRQLPAVHPIFKLLVAHVRFTIAINTKAREQLICECGLFDKARGMESKEDIPYYFYRDDGLLVWEAIRTFTAEVVDIYYEGDQVVEEDPELQDFVNDVYVYGMRGRKSSGFPKSVKSREQLSEYLTVVIFTASAQHAAVNFGQYDWCSWIPNAPPTMRAPPPTAKGVVTIEQIVDTLPDRGRSCWHLGAVWALSQFQENELFLGMYPEEHFIEKPVKEAMARFRKNLEAIVSVIAERNKKKQLPYYYLSPDRIPNSVAI",
"length": 642,
"header": "sp|P09917-3|LOX5_HUMAN Isoform 3 of Polyunsaturated fatty acid 5-lipoxygenase OS=Homo sapiens OX=9606 GN=ALOX5 PE=1 SV=2 CANONICAL=P09917-1"
},
"locus": {}
},
{
"isoform_ac": "P09917-4",
"url": "",
"sequence": {
"sequence": "MPSYTVTVATGSQWFAGTDDYIYLSLVGSAGCSEKHLLDKPFYNDFERGAVDSYDVTVDEELGEIQLVRIEKRKYWLNDDWYLKYITLKTPHGDYIEFPCYRWITGDVEVVLRDGRAKLARDDQIHILKQHRRKELETRQKQYRWMEWNPGFPLSIDAKCHKDLPRDIQFDSEKGVDFVLNYSKAMENLFINRFMHMFQSSWNDFADFEKIFVKISNTISERVMNHWQEDLMFGYQFLNGCNPVLIRRCTELPEKLPVTTEMVECSLERQLSLEQEVQQGNIFIVDFELLDGIDANKTDPCTLQFLAAPICLLYKNLANKIVPIAIQLNQIPGDENPIFLPSDAKYDWLLAKIWVRSSDFHVHQTITHLLRTHLVSEVFGIAMYRQLPAVHPIFKLLVAHVRFTIAINTKAREQLICECGLFDKVHGRGGRHLLRGRPGGGGGPGAAGLRERCLRVRHAGPQVLRLPQVGQEPGAAVGVPDRGDLHRLRPARRGQLRPAVPGHVPRRAFYREACEGSHGPIPQEPRGHCQRDC",
"length": 533,
"header": "sp|P09917-4|LOX5_HUMAN Isoform 4 of Polyunsaturated fatty acid 5-lipoxygenase OS=Homo sapiens OX=9606 GN=ALOX5 PE=1 SV=2 CANONICAL=P09917-1"
},
"locus": {}
},
{
"isoform_ac": "P09917-5",
"url": "",
"sequence": {
"sequence": "MPSYTVTVATGSQWFAGTDDYIYLSLVGSAGCSEKHLLDKPFYNDFERGAVDSYDVTVDEELGEIQLVRIEKRKYWLNDDWYLKYITLKTPHGDYIEFPCYRWITGDVEVVLRDGRAKLARDDQIHILKQHRRKELETRQKQYRWMEWNPGFPLSIDAKCHKDLPRDIQFDSEKGVDFVLNYSKAMENLFINRFMHMFQSSWNDFADFEKIFVKISNTISERVMNHWQEDLMFGYQFLNGCNPVLIRRCTELPEKLPVTTEMVECSLERQLSLEQEVQQGNIFIVDFELLDGIDANKTDPCTLQFLAAPICLLYKNLANKIVPIAIQLNQIPGDENPIFLPSDAKYDWLLAKIWVRSSDFHVHQTITHLLRTHLVSEVFGIAMYRQLPAVHPIFKLLVAHVRFTIAINTKAREQLICECGLFDKANATGGGGHVQMVQRAMKDLTYASLCFPEAIKARGMESKEDIPYYFYRDDGLLVWEAIRT",
"length": 484,
"header": "sp|P09917-5|LOX5_HUMAN Isoform 5 of Polyunsaturated fatty acid 5-lipoxygenase OS=Homo sapiens OX=9606 GN=ALOX5 PE=1 SV=2 CANONICAL=P09917-1"
},
"locus": {}
}
],
"glycosylation": [],
"phosphorylation": [
{
"start_pos": 271,
"end_pos": 271,
"kinase_uniprot_canonical_ac": "",
"kinase_gene_name": "",
"residue": "Leu",
"comment": "",
"evidence": [
{
"database": "IntAct",
"id": "P09917",
"url": "https://www.ebi.ac.uk/intact/interactors/id:P09917*"
},
{
"database": "iPTMnet",
"id": "P09917",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09917"
},
{
"database": "PubMed",
"id": "24860872",
"url": "https://glygen.org/publication/PubMed/24860872"
}
],
"site_lbl": "Leu271"
},
{
"start_pos": 272,
"end_pos": 272,
"kinase_uniprot_canonical_ac": "P27361-1",
"kinase_gene_name": "MAPK3",
"residue": "Ser",
"comment": "",
"evidence": [
{
"database": "iPTMnet",
"id": "P09917",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09917"
},
{
"database": "PubMed",
"id": "12670876",
"url": "https://glygen.org/publication/PubMed/12670876"
}
],
"site_lbl": "Ser272"
},
{
"start_pos": 272,
"end_pos": 272,
"kinase_uniprot_canonical_ac": "P28482-1",
"kinase_gene_name": "MAPK1",
"residue": "Ser",
"comment": "",
"evidence": [
{
"database": "iPTMnet",
"id": "P09917",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09917"
},
{
"database": "PubMed",
"id": "12670876",
"url": "https://glygen.org/publication/PubMed/12670876"
}
],
"site_lbl": "Ser272"
},
{
"start_pos": 272,
"end_pos": 272,
"kinase_uniprot_canonical_ac": "P49137-1",
"kinase_gene_name": "MAPKAPK2",
"residue": "Ser",
"comment": "",
"evidence": [
{
"database": "iPTMnet",
"id": "P09917",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09917"
},
{
"database": "PubMed",
"id": "10779545",
"url": "https://glygen.org/publication/PubMed/10779545"
},
{
"database": "PubMed",
"id": "11844797",
"url": "https://glygen.org/publication/PubMed/11844797"
},
{
"database": "phospho.ELM",
"id": "P09917",
"url": "http://phospho.elm.eu.org/byAccession/P09917.html"
}
],
"site_lbl": "Ser272"
},
{
"start_pos": 272,
"end_pos": 272,
"kinase_uniprot_canonical_ac": "Q9UQM7-1",
"kinase_gene_name": "CAMK2A",
"residue": "Ser",
"comment": "",
"evidence": [
{
"database": "iPTMnet",
"id": "P09917",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09917"
},
{
"database": "PubMed",
"id": "18978352",
"url": "https://glygen.org/publication/PubMed/18978352"
}
],
"site_lbl": "Ser272"
},
{
"start_pos": 272,
"end_pos": 272,
"kinase_uniprot_canonical_ac": "",
"kinase_gene_name": "",
"residue": "Ser",
"comment": "Phosphoserine; by MAPKAPK2",
"evidence": [
{
"database": "UniProtKB",
"id": "P09917",
"url": "https://www.uniprot.org/uniprot/P09917"
},
{
"database": "iPTMnet",
"id": "P09917",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09917"
},
{
"database": "PubMed",
"id": "11844797",
"url": "https://glygen.org/publication/PubMed/11844797"
},
{
"database": "phospho.ELM",
"id": "P09917",
"url": "http://phospho.elm.eu.org/byAccession/P09917.html"
},
{
"database": "PRO",
"id": "P09917",
"url": "http://purl.obolibrary.org/obo/P09917"
},
{
"database": "PubMed",
"id": "18978352",
"url": "https://glygen.org/publication/PubMed/18978352"
}
],
"site_lbl": "Ser272"
},
{
"start_pos": 42,
"end_pos": 42,
"kinase_uniprot_canonical_ac": "",
"kinase_gene_name": "",
"residue": "Phe",
"comment": "",
"evidence": [
{
"database": "IntAct",
"id": "P09917",
"url": "https://www.ebi.ac.uk/intact/interactors/id:P09917*"
},
{
"database": "iPTMnet",
"id": "P09917",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09917"
},
{
"database": "PubMed",
"id": "24860872",
"url": "https://glygen.org/publication/PubMed/24860872"
}
],
"site_lbl": "Phe42"
},
{
"start_pos": 445,
"end_pos": 445,
"kinase_uniprot_canonical_ac": "",
"kinase_gene_name": "",
"residue": "Thr",
"comment": "",
"evidence": [
{
"database": "IntAct",
"id": "P09917",
"url": "https://www.ebi.ac.uk/intact/interactors/id:P09917*"
},
{
"database": "iPTMnet",
"id": "P09917",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09917"
},
{
"database": "PubMed",
"id": "24860872",
"url": "https://glygen.org/publication/PubMed/24860872"
}
],
"site_lbl": "Thr445"
},
{
"start_pos": 523,
"end_pos": 523,
"kinase_uniprot_canonical_ac": "",
"kinase_gene_name": "",
"residue": "Ser",
"comment": "",
"evidence": [
{
"database": "IntAct",
"id": "P09917",
"url": "https://www.ebi.ac.uk/intact/interactors/id:P09917*"
},
{
"database": "iPTMnet",
"id": "P09917",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09917"
},
{
"database": "PubMed",
"id": "24860872",
"url": "https://glygen.org/publication/PubMed/24860872"
},
{
"database": "PubMed",
"id": "15280375",
"url": "https://glygen.org/publication/PubMed/15280375"
},
{
"database": "PubMed",
"id": "16230355",
"url": "https://glygen.org/publication/PubMed/16230355"
},
{
"database": "PubMed",
"id": "26210919",
"url": "https://glygen.org/publication/PubMed/26210919"
}
],
"site_lbl": "Ser523"
},
{
"start_pos": 524,
"end_pos": 524,
"kinase_uniprot_canonical_ac": "",
"kinase_gene_name": "",
"residue": "Ser",
"comment": "Phosphoserine; by PKA",
"evidence": [
{
"database": "UniProtKB",
"id": "P09917",
"url": "https://www.uniprot.org/uniprot/P09917"
},
{
"database": "phospho.ELM",
"id": "P09917",
"url": "http://phospho.elm.eu.org/byAccession/P09917.html"
},
{
"database": "iPTMnet",
"id": "P09917",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09917"
},
{
"database": "PubMed",
"id": "15280375",
"url": "https://glygen.org/publication/PubMed/15280375"
},
{
"database": "PubMed",
"id": "16230355",
"url": "https://glygen.org/publication/PubMed/16230355"
},
{
"database": "PubMed",
"id": "26210919",
"url": "https://glygen.org/publication/PubMed/26210919"
}
],
"site_lbl": "Ser524"
},
{
"start_pos": 53,
"end_pos": 53,
"kinase_uniprot_canonical_ac": "",
"kinase_gene_name": "",
"residue": "Ser",
"comment": "",
"evidence": [
{
"database": "IntAct",
"id": "P09917",
"url": "https://www.ebi.ac.uk/intact/interactors/id:P09917*"
},
{
"database": "iPTMnet",
"id": "P09917",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09917"
},
{
"database": "PubMed",
"id": "24860872",
"url": "https://glygen.org/publication/PubMed/24860872"
}
],
"site_lbl": "Ser53"
},
{
"start_pos": 664,
"end_pos": 664,
"kinase_uniprot_canonical_ac": "P27361-1",
"kinase_gene_name": "MAPK3",
"residue": "Ser",
"comment": "",
"evidence": [
{
"database": "iPTMnet",
"id": "P09917",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09917"
},
{
"database": "PubMed",
"id": "12205041",
"url": "https://glygen.org/publication/PubMed/12205041"
},
{
"database": "PubMed",
"id": "12670876",
"url": "https://glygen.org/publication/PubMed/12670876"
}
],
"site_lbl": "Ser664"
},
{
"start_pos": 664,
"end_pos": 664,
"kinase_uniprot_canonical_ac": "P28482-1",
"kinase_gene_name": "MAPK1",
"residue": "Ser",
"comment": "",
"evidence": [
{
"database": "iPTMnet",
"id": "P09917",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09917"
},
{
"database": "PubMed",
"id": "12205041",
"url": "https://glygen.org/publication/PubMed/12205041"
},
{
"database": "PubMed",
"id": "12670876",
"url": "https://glygen.org/publication/PubMed/12670876"
}
],
"site_lbl": "Ser664"
},
{
"start_pos": 94,
"end_pos": 94,
"kinase_uniprot_canonical_ac": "",
"kinase_gene_name": "",
"residue": "Asp",
"comment": "",
"evidence": [
{
"database": "IntAct",
"id": "P09917",
"url": "https://www.ebi.ac.uk/intact/interactors/id:P09917*"
},
{
"database": "iPTMnet",
"id": "P09917",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09917"
},
{
"database": "PubMed",
"id": "24860872",
"url": "https://glygen.org/publication/PubMed/24860872"
}
],
"site_lbl": "Asp94"
}
],
"glycation": [],
"keywords": [
"enzyme"
],
"publication": [
{
"title": "Constitutive activation of Stat3 signaling confers resistance to apoptosis in human U266 myeloma cells.",
"journal": "Immunity",
"date": "1999",
"authors": "Catlett-Falcone R, Landowski TH, Oshiro MM, Turkson J, Levitzki A, Savino R, Ciliberto G, Moscinski L, Fernandez-Luna JL, Nunez G, Dalton WS, Jove R",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "10023775",
"url": "https://glygen.org/publication/PubMed/10023775"
}
]
},
{
"title": "Interleukin-18 binding protein: a novel modulator of the Th1 cytokine response.",
"journal": "Immunity",
"date": "1999",
"authors": "Novick D, Kim SH, Fantuzzi G, Reznikov LL, Dinarello CA, Rubinstein M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9012546",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9012546"
}
],
"reference": [
{
"type": "PubMed",
"id": "10023777",
"url": "https://glygen.org/publication/PubMed/10023777"
}
]
},
{
"title": "Characterization of a leukotriene C4 export mechanism in human platelets: possible involvement of multidrug resistance-associated protein 1.",
"journal": "Journal of lipid research",
"date": "1999",
"authors": "Sjolinder M, Tornhamre S, Claesson HE, Hydman J, Lindgren J",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2142691",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2142691"
}
],
"reference": [
{
"type": "PubMed",
"id": "10064732",
"url": "https://glygen.org/publication/PubMed/10064732"
}
]
},
{
"title": "Crystal structure of the interleukin-4/receptor alpha chain complex reveals a mosaic binding interface.",
"journal": "Cell",
"date": "1999",
"authors": "Hage T, Sebald W, Reinemer P",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "10219247",
"url": "https://glygen.org/publication/PubMed/10219247"
}
]
},
{
"title": "Regulation of the germline immunoglobulin Cgamma1 promoter by CD40 ligand and IL-4: dual role for tandem NF-kappaB binding sites.",
"journal": "Molecular immunology",
"date": "1999",
"authors": "Warren WD, Roberts KL, Linehan LA, Berton MT",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "10369418",
"url": "https://glygen.org/publication/PubMed/10369418"
}
]
},
{
"title": "Functional synergism of STAT6 with either NF-kappa B or PU.1 to mediate IL-4-induced activation of IgE germline gene transcription.",
"journal": "Journal of immunology (Baltimore, Md. : 1950)",
"date": "1999",
"authors": "Stutz AM, Woisetschlager M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "10510379",
"url": "https://glygen.org/publication/PubMed/10510379"
}
]
},
{
"title": "Cellular glutathione peroxidase as a predominant scavenger of hydroperoxyeicosatetraenoic acids in rabbit alveolar macrophages.",
"journal": "Biological & pharmaceutical bulletin",
"date": "1999",
"authors": "Chiba N, Imai H, Narashima K, Arai M, Oshima G, Kunimoto M, Nakagawa Y",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2142688",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2142688"
}
],
"reference": [
{
"type": "PubMed",
"id": "10549853",
"url": "https://glygen.org/publication/PubMed/10549853"
}
]
},
{
"title": "Activation of eotaxin gene transcription by NF-kappa B and STAT6 in human airway epithelial cells.",
"journal": "Journal of immunology (Baltimore, Md. : 1950)",
"date": "1999",
"authors": "Matsukura S, Stellato C, Plitt JR, Bickel C, Miura K, Georas SN, Casolaro V, Schleimer RP",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "10586089",
"url": "https://glygen.org/publication/PubMed/10586089"
}
]
},
{
"title": "5-lipoxygenase is phosphorylated by p38 kinase-dependent MAPKAP kinases.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "2000",
"authors": "Werz O, Klemm J, Samuelsson B, Radmark O",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2142691",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2142691"
},
{
"database": "iPTMnet",
"id": "P09917-1",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09917-1"
}
],
"reference": [
{
"type": "PubMed",
"id": "10779545",
"url": "https://glygen.org/publication/PubMed/10779545"
}
]
},
{
"title": "Oxidoreductases in lipoxin A4 metabolic inactivation: a novel role for 15-onoprostaglandin 13-reductase/leukotriene B4 12-hydroxydehydrogenase in inflammation.",
"journal": "The Journal of biological chemistry",
"date": "2000",
"authors": "Clish CB, Levy BD, Chiang N, Tai HH, Serhan CN",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2142700",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2142700"
}
],
"reference": [
{
"type": "PubMed",
"id": "10837478",
"url": "https://glygen.org/publication/PubMed/10837478"
}
]
},
{
"title": "Signal transducer and activator of transcription 3 activates CCAAT enhancer-binding protein delta gene transcription in G0 growth-arrested mouse mammary epithelial cells and in involuting mouse mammary gland.",
"journal": "The Journal of biological chemistry",
"date": "2000",
"authors": "Hutt JA, O'Rourke JP, DeWille J",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "10867011",
"url": "https://glygen.org/publication/PubMed/10867011"
}
]
},
{
"title": "Characterization of IL-4 and IL-13 signals dependent on the human IL-13 receptor alpha chain 1: redundancy of requirement of tyrosine residue for STAT3 activation.",
"journal": "International immunology",
"date": "2000",
"authors": "Umeshita-Suyama R, Sugimoto R, Akaiwa M, Arima K, Yu B, Wada M, Kuwano M, Nakajima K, Hamasaki N, Izuhara K",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "11058569",
"url": "https://glygen.org/publication/PubMed/11058569"
}
]
},
{
"title": "A stat-responsive element in the promoter of the episialin/MUC1 gene is involved in its overexpression in carcinoma cells.",
"journal": "The Journal of biological chemistry",
"date": "2001",
"authors": "Gaemers IC, Vos HL, Volders HH, van der Valk SW, Hilkens J",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "11084045",
"url": "https://glygen.org/publication/PubMed/11084045"
}
]
},
{
"title": "Direct regulation of pituitary proopiomelanocortin by STAT3 provides a novel mechanism for immuno-neuroendocrine interfacing.",
"journal": "The Journal of clinical investigation",
"date": "2000",
"authors": "Bousquet C, Zatelli MC, Melmed S",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "11104795",
"url": "https://glygen.org/publication/PubMed/11104795"
}
]
},
{
"title": "Evidence for the presence of phospholipid hydroperoxide glutathione peroxidase in human platelets: implications for its involvement in the regulatory network of the 12-lipoxygenase pathway of arachidonic acid metabolism.",
"journal": "The Biochemical journal",
"date": "2001",
"authors": "Sutherland M, Shankaranarayanan P, Schewe T, Nigam S",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2142688",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2142688"
}
],
"reference": [
{
"type": "PubMed",
"id": "11115402",
"url": "https://glygen.org/publication/PubMed/11115402"
}
]
},
{
"title": "Suppression of signal transducer and activator of transcription 3-dependent B lymphocyte terminal differentiation by BCL-6.",
"journal": "The Journal of experimental medicine",
"date": "2000",
"authors": "Reljic R, Wagner SD, Peakman LJ, Fearon DT",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "11120780",
"url": "https://glygen.org/publication/PubMed/11120780"
}
]
},
{
"title": "Thrombin regulates vascular smooth muscle cell growth and heat shock proteins via the JAK-STAT pathway.",
"journal": "The Journal of biological chemistry",
"date": "2001",
"authors": "Madamanchi NR, Li S, Patterson C, Runge MS",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "11278437",
"url": "https://glygen.org/publication/PubMed/11278437"
}
]
},
{
"title": "Co-operative effect of c-Src tyrosine kinase and Stat3 in activation of hepatocyte growth factor expression in mammary carcinoma cells.",
"journal": "The Journal of biological chemistry",
"date": "2001",
"authors": "Hung W, Elliott B",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "11278729",
"url": "https://glygen.org/publication/PubMed/11278729"
}
]
},
{
"title": "c-Jun and c-Fos cooperate with STAT3 in IL-6-induced transactivation of the IL-6 respone element (IRE).",
"journal": "Cytokine",
"date": "2001",
"authors": "Schuringa JJ, Timmer H, Luttickhuizen D, Vellenga E, Kruijer W",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "11356008",
"url": "https://glygen.org/publication/PubMed/11356008"
}
]
},
{
"title": "Stat3-mediated Myc expression is required for Src transformation and PDGF-induced mitogenesis.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "2001",
"authors": "Bowman T, Broome MA, Sinibaldi D, Wharton W, Pledger WJ, Sedivy JM, Irby R, Yeatman T, Courtneidge SA, Jove R",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "11404481",
"url": "https://glygen.org/publication/PubMed/11404481"
}
]
},
{
"title": "Cooperation between STAT3 and c-jun suppresses Fas transcription.",
"journal": "Molecular cell",
"date": "2001",
"authors": "Ivanov VN, Bhoumik A, Krasilnikov M, Raz R, Owen-Schaub LB, Levy D, Horvath CM, Ronai Z",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "11463377",
"url": "https://glygen.org/publication/PubMed/11463377"
}
]
},
{
"title": "Arachidonic acid promotes phosphorylation of 5-lipoxygenase at Ser-271 by MAPK-activated protein kinase 2 (MK2).",
"journal": "The Journal of biological chemistry",
"date": "2002",
"authors": "Werz O, Szellas D, Steinhilber D, Radmark O",
"evidence": [
{
"database": "UniProtKB",
"id": "P09917",
"url": "https://www.uniprot.org/uniprot/P09917"
},
{
"database": "Reactome",
"id": "R-HSA-2142691",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2142691"
},
{
"database": "iPTMnet",
"id": "P09917-1",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09917-1"
}
],
"reference": [
{
"type": "PubMed",
"id": "11844797",
"url": "https://glygen.org/publication/PubMed/11844797"
}
]
},
{
"title": "Constitutive Stat3 activity up-regulates VEGF expression and tumor angiogenesis.",
"journal": "Oncogene",
"date": "2002",
"authors": "Niu G, Wright KL, Huang M, Song L, Haura E, Turkson J, Zhang S, Wang T, Sinibaldi D, Coppola D, Heller R, Ellis LM, Karras J, Bromberg J, Pardoll D, Jove R, Yu H",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "11960372",
"url": "https://glygen.org/publication/PubMed/11960372"
}
]
},
{
"title": "Extracellular signal-regulated kinases phosphorylate 5-lipoxygenase and stimulate 5-lipoxygenase product formation in leukocytes.",
"journal": "FASEB journal : official publication of the Federation of American Societies for Experimental Biology",
"date": "2002",
"authors": "Werz O, Burkert E, Fischer L, Szellas D, Dishart D, Samuelsson B, Radmark O, Steinhilber D",
"evidence": [
{
"database": "iPTMnet",
"id": "P09917",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09917"
}
],
"reference": [
{
"type": "PubMed",
"id": "12205041",
"url": "https://glygen.org/publication/PubMed/12205041"
}
]
},
{
"title": "IL-13 signal transduction in human monocytes: phosphorylation of receptor components, association with Jaks, and phosphorylation/activation of Stats.",
"journal": "Journal of leukocyte biology",
"date": "2002",
"authors": "Roy B, Bhattacharjee A, Xu B, Ford D, Maizel AL, Cathcart MK",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "12223527",
"url": "https://glygen.org/publication/PubMed/12223527"
}
]
},
{
"title": "Expression of the suppressor of cytokine signaling-5 (SOCS5) negatively regulates IL-4-dependent STAT6 activation and Th2 differentiation.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "2002",
"authors": "Seki Y, Hayashi K, Matsumoto A, Seki N, Tsukada J, Ransom J, Naka T, Kishimoto T, Yoshimura A, Kubo M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "12242343",
"url": "https://glygen.org/publication/PubMed/12242343"
}
]
},
{
"title": "Resolvins: a family of bioactive products of omega-3 fatty acid transformation circuits initiated by aspirin treatment that counter proinflammation signals.",
"journal": "The Journal of experimental medicine",
"date": "2002",
"authors": "Serhan CN, Hong S, Gronert K, Colgan SP, Devchand PR, Mirick G, Moussignac RL",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9020265",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9020265"
}
],
"reference": [
{
"type": "PubMed",
"id": "12391014",
"url": "https://glygen.org/publication/PubMed/12391014"
}
]
},
{
"title": "Independent and cooperative activation of chromosomal c-fos promoter by STAT3.",
"journal": "The Journal of biological chemistry",
"date": "2003",
"authors": "Yang E, Lerner L, Besser D, Darnell JE Jr",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "12600988",
"url": "https://glygen.org/publication/PubMed/12600988"
}
]
},
{
"title": "Phosphorylation- and stimulus-dependent inhibition of cellular 5-lipoxygenase activity by nonredox-type inhibitors.",
"journal": "FASEB journal : official publication of the Federation of American Societies for Experimental Biology",
"date": "2003-05",
"authors": "Fischer Lutz, Szellas Dagmar, R\u00e5dmark Olof, Steinhilber Dieter, Werz Oliver",
"evidence": [
{
"database": "iPTMnet",
"id": "P09917",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09917"
}
],
"reference": [
{
"type": "PubMed",
"id": "12670876",
"url": "https://glygen.org/publication/PubMed/12670876"
}
]
},
{
"title": "STATs dimerize in the absence of phosphorylation.",
"journal": "The Journal of biological chemistry",
"date": "2003",
"authors": "Braunstein J, Brutsaert S, Olson R, Schindler C",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "12832402",
"url": "https://glygen.org/publication/PubMed/12832402"
}
]
},
{
"title": "5-Lipoxygenase inhibitors for the treatment of inflammatory bowel disease.",
"journal": "Agents and actions",
"date": "1992",
"authors": "Rask-Madsen J, Bukhave K, Laursen LS, Lauritsen K",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2142691",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2142691"
}
],
"reference": [
{
"type": "PubMed",
"id": "1359745",
"url": "https://glygen.org/publication/PubMed/1359745"
}
]
},
{
"title": "IL-4 and IL-13 induce SOCS-1 gene expression in A549 cells by three functional STAT6-binding motifs located upstream of the transcription initiation site.",
"journal": "Journal of immunology (Baltimore, Md. : 1950)",
"date": "2003",
"authors": "Hebenstreit D, Luft P, Schmiedlechner A, Regl G, Frischauf AM, Aberger F, Duschl A, Horejs-Hoeck J",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "14634100",
"url": "https://glygen.org/publication/PubMed/14634100"
}
]
},
{
"title": "Stat3 enhances vimentin gene expression by binding to the antisilencer element and interacting with the repressor protein, ZBP-89.",
"journal": "Oncogene",
"date": "2004",
"authors": "Wu Y, Diab I, Zhang X, Izmailova ES, Zehner ZE",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "14712222",
"url": "https://glygen.org/publication/PubMed/14712222"
}
]
},
{
"title": "Stat3 activation regulates the expression of matrix metalloproteinase-2 and tumor invasion and metastasis.",
"journal": "Oncogene",
"date": "2004",
"authors": "Xie TX, Wei D, Liu M, Gao AC, Ali-Osman F, Sawaya R, Huang S",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "15116091",
"url": "https://glygen.org/publication/PubMed/15116091"
}
]
},
{
"title": "STAT-1 is activated by IL-4 and IL-13 in multiple cell types.",
"journal": "Molecular immunology",
"date": "2004",
"authors": "Wang IM, Lin H, Goldman SJ, Kobayashi M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "15261459",
"url": "https://glygen.org/publication/PubMed/15261459"
}
]
},
{
"title": "Protein kinase A inhibits leukotriene synthesis by phosphorylation of 5-lipoxygenase on serine 523.",
"journal": "The Journal of biological chemistry",
"date": "2004",
"authors": "Luo M, Jones SM, Phare SM, Coffey MJ, Peters-Golden M, Brock TG",
"evidence": [
{
"database": "UniProtKB",
"id": "P09917",
"url": "https://www.uniprot.org/uniprot/P09917"
},
{
"database": "iPTMnet",
"id": "P09917",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09917"
}
],
"reference": [
{
"type": "PubMed",
"id": "15280375",
"url": "https://glygen.org/publication/PubMed/15280375"
}
]
},
{
"title": "Arachidonate lipoxygenase (ALOX) and cyclooxygenase (COX) polymorphisms and colon cancer risk.",
"journal": "Carcinogenesis",
"date": "2004",
"authors": "Goodman JE, Bowman ED, Chanock SJ, Alberg AJ, Harris CC",
"evidence": [
{
"database": "UniProtKB",
"id": "P09917",
"url": "https://www.uniprot.org/uniprot/P09917"
}
],
"reference": [
{
"type": "PubMed",
"id": "15308583",
"url": "https://glygen.org/publication/PubMed/15308583"
}
]
},
{
"title": "Mutagenesis studies on the amino acid residues involved in the iron-binding and the activity of human 5-lipoxygenase.",
"journal": "Biochemical and biophysical research communications",
"date": "1992",
"authors": "Ishii S, Noguchi M, Miyano M, Matsumoto T, Noma M",
"evidence": [
{
"database": "UniProtKB",
"id": "P09917",
"url": "https://www.uniprot.org/uniprot/P09917"
}
],
"reference": [
{
"type": "PubMed",
"id": "1540191",
"url": "https://glygen.org/publication/PubMed/1540191"
}
]
},
{
"title": "STAT6 transcription factor binding sites with mismatches within the canonical 5'-TTC...GAA-3' motif involved in regulation of delta- and mu-opioid receptors.",
"journal": "Journal of neurochemistry",
"date": "2004",
"authors": "Borner C, Woltje M, Hollt V, Kraus J",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "15584925",
"url": "https://glygen.org/publication/PubMed/15584925"
}
]
},
{
"title": "Zileuton, an oral 5-lipoxygenase inhibitor, directly reduces sebum production.",
"journal": "Dermatology (Basel, Switzerland)",
"date": "2005",
"authors": "Zouboulis ChC, Saborowski A, Boschnakow A",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2142691",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2142691"
}
],
"reference": [
{
"type": "PubMed",
"id": "15604543",
"url": "https://glygen.org/publication/PubMed/15604543"
}
]
},
{
"title": "Human paraoxonases (PON1, PON2, and PON3) are lactonases with overlapping and distinct substrate specificities.",
"journal": "Journal of lipid research",
"date": "2005",
"authors": "Draganov DI, Teiber JF, Speelman A, Osawa Y, Sunahara R, La Du BN",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2142688",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2142688"
}
],
"reference": [
{
"type": "PubMed",
"id": "15772423",
"url": "https://glygen.org/publication/PubMed/15772423"
}
]
},
{
"title": "Aberrant Stat3 signaling by interleukin-4 in malignant glioma cells: involvement of IL-13Ralpha2.",
"journal": "Cancer research",
"date": "2005",
"authors": "Rahaman SO, Vogelbaum MA, Haque SJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "15805299",
"url": "https://glygen.org/publication/PubMed/15805299"
}
]
},
{
"title": "Gene expression alterations of human peripheral blood monocytes induced by medium-term treatment with the TH2-cytokines interleukin-4 and -13.",
"journal": "Cytokine",
"date": "2005",
"authors": "Chaitidis P, O'Donnell V, Kuban RJ, Bermudez-Fajardo A, Ungethuem U, Kuhn H",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "15869882",
"url": "https://glygen.org/publication/PubMed/15869882"
}
]
},
{
"title": "Nuclear interaction of EGFR and STAT3 in the activation of the iNOS/NO pathway.",
"journal": "Cancer cell",
"date": "2005",
"authors": "Lo HW, Hsu SC, Ali-Seyed M, Gunduz M, Xia W, Wei Y, Bartholomeusz G, Shih JY, Hung MC",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "15950906",
"url": "https://glygen.org/publication/PubMed/15950906"
}
]
},
{
"title": "Targeting Stat3 blocks both HIF-1 and VEGF expression induced by multiple oncogenic growth signaling pathways.",
"journal": "Oncogene",
"date": "2005",
"authors": "Xu Q, Briggs J, Park S, Niu G, Kortylewski M, Zhang S, Gritsko T, Turkson J, Kay H, Semenza GL, Cheng JQ, Jove R, Yu H",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "16007214",
"url": "https://glygen.org/publication/PubMed/16007214"
}
]
},
{
"title": "STAT3-mediated transcription of Bcl-2, Mcl-1 and c-IAP2 prevents apoptosis in polyamine-depleted cells.",
"journal": "The Biochemical journal",
"date": "2005",
"authors": "Bhattacharya S, Ray RM, Johnson LR",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "16048438",
"url": "https://glygen.org/publication/PubMed/16048438"
}
]
},
{
"title": "Role of Stat3 in regulating p53 expression and function.",
"journal": "Molecular and cellular biology",
"date": "2005",
"authors": "Niu G, Wright KL, Ma Y, Wright GM, Huang M, Irby R, Briggs J, Karras J, Cress WD, Pardoll D, Jove R, Chen J, Yu H",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "16107692",
"url": "https://glygen.org/publication/PubMed/16107692"
}
]
},
{
"title": "Requirement of STAT3 activation for maximal collagenase-1 (MMP-1) induction by epidermal growth factor and malignant characteristics in T24 bladder cancer cells.",
"journal": "Oncogene",
"date": "2006",
"authors": "Itoh M, Murata T, Suzuki T, Shindoh M, Nakajima K, Imai K, Yoshida K",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "16205632",
"url": "https://glygen.org/publication/PubMed/16205632"
}
]
},
{
"title": "Phosphorylation by protein kinase a inhibits nuclear import of 5-lipoxygenase.",
"journal": "The Journal of biological chemistry",
"date": "2005",
"authors": "Luo M, Jones SM, Flamand N, Aronoff DM, Peters-Golden M, Brock TG",
"evidence": [
{
"database": "iPTMnet",
"id": "P09917",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09917"
}
],
"reference": [
{
"type": "PubMed",
"id": "16230355",
"url": "https://glygen.org/publication/PubMed/16230355"
}
]
},
{
"title": "Essential role of STAT3 in cytokine-driven NF-kappaB-mediated serum amyloid A gene expression.",
"journal": "Genes to cells : devoted to molecular & cellular mechanisms",
"date": "2005",
"authors": "Hagihara K, Nishikawa T, Sugamata Y, Song J, Isobe T, Taga T, Yoshizaki K",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "16236134",
"url": "https://glygen.org/publication/PubMed/16236134"
}
]
},
{
"title": "Arachidonic acid regulates the translocation of 5-lipoxygenase to the nuclear membranes in human neutrophils.",
"journal": "J. Biol. Chem.",
"date": "2006",
"authors": "Flamand Nicolas, Lefebvre Julie, Surette Marc E, Picard Serge, Borgeat Pierre",
"evidence": [
{
"database": "UniProtKB",
"id": "P09917",
"url": "https://www.uniprot.org/uniprot/P09917"
}
],
"reference": [
{
"type": "PubMed",
"id": "16275640",
"url": "https://glygen.org/publication/PubMed/16275640"
}
]
},
{
"title": "Persistent activation of stat3 signaling induces survivin gene expression and confers resistance to apoptosis in human breast cancer cells.",
"journal": "Clinical cancer research : an official journal of the American Association for Cancer Research",
"date": "2006",
"authors": "Gritsko T, Williams A, Turkson J, Kaneko S, Bowman T, Huang M, Nam S, Eweis I, Diaz N, Sullivan D, Yoder S, Enkemann S, Eschrich S, Lee JH, Beam CA, Cheng J, Minton S, Muro-Cacho CA, Jove R",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "16397018",
"url": "https://glygen.org/publication/PubMed/16397018"
}
]
},
{
"title": "SOCS1: a potent and multifaceted regulator of cytokines and cell-mediated inflammation.",
"journal": "Tissue antigens",
"date": "2006",
"authors": "Davey GM, Heath WR, Starr R",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "16451196",
"url": "https://glygen.org/publication/PubMed/16451196"
}
]
},
{
"title": "Cyclin D1 is transcriptionally regulated by and required for transformation by activated signal transducer and activator of transcription 3.",
"journal": "Cancer research",
"date": "2006",
"authors": "Leslie K, Lang C, Devgan G, Azare J, Berishaj M, Gerald W, Kim YB, Paz K, Darnell JE, Albanese C, Sakamaki T, Pestell R, Bromberg J",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "16510571",
"url": "https://glygen.org/publication/PubMed/16510571"
}
]
},
{
"title": "Signaling mechanisms, interaction partners, and target genes of STAT6.",
"journal": "Cytokine & growth factor reviews",
"date": "2006",
"authors": "Hebenstreit D, Wirnsberger G, Horejs-Hoeck J, Duschl A",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "16540365",
"url": "https://glygen.org/publication/PubMed/16540365"
}
]
},
{
"title": "Loss of SOCS3 in T helper cells resulted in reduced immune responses and hyperproduction of interleukin 10 and transforming growth factor-beta 1.",
"journal": "The Journal of experimental medicine",
"date": "2006",
"authors": "Kinjyo I, Inoue H, Hamano S, Fukuyama S, Yoshimura T, Koga K, Takaki H, Himeno K, Takaesu G, Kobayashi T, Yoshimura A",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "16606674",
"url": "https://glygen.org/publication/PubMed/16606674"
}
]
},
{
"title": "Metabolic inactivation of resolvin E1 and stabilization of its anti-inflammatory actions.",
"journal": "The Journal of biological chemistry",
"date": "2006",
"authors": "Arita M, Oh SF, Chonan T, Hong S, Elangovan S, Sun YP, Uddin J, Petasis NA, Serhan CN",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9018896",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018896"
}
],
"reference": [
{
"type": "PubMed",
"id": "16757471",
"url": "https://glygen.org/publication/PubMed/16757471"
}
]
},
{
"title": "Efficacy and tolerability of olsalazine (dipentum) in the treatment of patients with ulcerative colitis--results of a field study.",
"journal": "Hepato-gastroenterology",
"date": "2006",
"authors": "Singer MV, Schmausser H, Schonfeld G",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2142691",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2142691"
}
],
"reference": [
{
"type": "PubMed",
"id": "16795963",
"url": "https://glygen.org/publication/PubMed/16795963"
}
]
},
{
"title": "Resolvin E2: identification and anti-inflammatory actions: pivotal role of human 5-lipoxygenase in resolvin E series biosynthesis.",
"journal": "Chemistry & biology",
"date": "2006",
"authors": "Tjonahen E, Oh SF, Siegelman J, Elangovan S, Percarpio KB, Hong S, Arita M, Serhan CN",
"evidence": [
{
"database": "UniProtKB",
"id": "P09917",
"url": "https://www.uniprot.org/uniprot/P09917"
},
{
"database": "Reactome",
"id": "R-HSA-9018896",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018896"
}
],
"reference": [
{
"type": "PubMed",
"id": "17114001",
"url": "https://glygen.org/publication/PubMed/17114001"
}
]
},
{
"title": "Resolvin D1 and its aspirin-triggered 17R epimer. Stereochemical assignments, anti-inflammatory properties, and enzymatic inactivation.",
"journal": "The Journal of biological chemistry",
"date": "2007",
"authors": "Sun YP, Oh SF, Uddin J, Yang R, Gotlinger K, Campbell E, Colgan SP, Petasis NA, Serhan CN",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9020265",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9020265"
}
],
"reference": [
{
"type": "PubMed",
"id": "17244615",
"url": "https://glygen.org/publication/PubMed/17244615"
}
]
},
{
"title": "Diverse effects of Stat1 on the regulation of hsp90alpha gene under heat shock.",
"journal": "Journal of cellular biochemistry",
"date": "2007",
"authors": "Chen XS, Zhang Y, Wang JS, Li XY, Cheng XK, Zhang Y, Wu NH, Shen YF",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "17427945",
"url": "https://glygen.org/publication/PubMed/17427945"
}
]
},
{
"title": "IL-13 induces expression of CD36 in human monocytes through PPARgamma activation.",
"journal": "European journal of immunology",
"date": "2007",
"authors": "Berry A, Balard P, Coste A, Olagnier D, Lagane C, Authier H, Benoit-Vical F, Lepert JC, Seguela JP, Magnaval JF, Chambon P, Metzger D, Desvergne B, Wahli W, Auwerx J, Pipy B",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "17458857",
"url": "https://glygen.org/publication/PubMed/17458857"
}
]
},
{
"title": "Enzymes and receptors of prostaglandin pathways with arachidonic acid-derived versus eicosapentaenoic acid-derived substrates and products.",
"journal": "The Journal of biological chemistry",
"date": "2007",
"authors": "Wada M, DeLong CJ, Hong YH, Rieke CJ, Song I, Sidhu RS, Yuan C, Warnock M, Schmaier AH, Yokoyama C, Smyth EM, Wilson SJ, FitzGerald GA, Garavito RM, Sui de X, Regan JW, Smith WL",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9027604",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9027604"
}
],
"reference": [
{
"type": "PubMed",
"id": "17519235",
"url": "https://glygen.org/publication/PubMed/17519235"
}
]
},
{
"title": "Fra-1 and Stat3 synergistically regulate activation of human MMP-9 gene.",
"journal": "Molecular immunology",
"date": "2008",
"authors": "Song Y, Qian L, Song S, Chen L, Zhang Y, Yuan G, Zhang H, Xia Q, Hu M, Yu M, Shi M, Jiang Z, Guo N",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "17572495",
"url": "https://glygen.org/publication/PubMed/17572495"
}
]
},
{
"title": "Eoxins are proinflammatory arachidonic acid metabolites produced via the 15-lipoxygenase-1 pathway in human eosinophils and mast cells.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "2008",
"authors": "Feltenmark S, Gautam N, Brunnstrom A, Griffiths W, Backman L, Edenius C, Lindbom L, Bjorkholm M, Claesson HE",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2142691",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2142691"
}
],
"reference": [
{
"type": "PubMed",
"id": "18184802",
"url": "https://glygen.org/publication/PubMed/18184802"
}
]
},
{
"title": "Molecular and structural basis of cytokine receptor pleiotropy in the interleukin-4/13 system.",
"journal": "Cell",
"date": "2008",
"authors": "LaPorte SL, Juo ZS, Vaclavikova J, Colf LA, Qi X, Heller NM, Keegan AD, Garcia KC",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "18243101",
"url": "https://glygen.org/publication/PubMed/18243101"
}
]
},
{
"title": "Resolvin E1 metabolome in local inactivation during inflammation-resolution.",
"journal": "Journal of immunology (Baltimore, Md. : 1950)",
"date": "2008",
"authors": "Hong S, Porter TF, Lu Y, Oh SF, Pillai PS, Serhan CN",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9018896",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018896"
}
],
"reference": [
{
"type": "PubMed",
"id": "18292578",
"url": "https://glygen.org/publication/PubMed/18292578"
}
]
},
{
"title": "Twist is transcriptionally induced by activation of STAT3 and mediates STAT3 oncogenic function.",
"journal": "The Journal of biological chemistry",
"date": "2008",
"authors": "Cheng GZ, Zhang WZ, Sun M, Wang Q, Coppola D, Mansour M, Xu LM, Costanzo C, Cheng JQ, Wang LH",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "18353781",
"url": "https://glygen.org/publication/PubMed/18353781"
}
]
},
{
"title": "Regulation of Sox2 by STAT3 initiates commitment to the neural precursor cell fate.",
"journal": "Stem cells and development",
"date": "2008",
"authors": "Foshay KM, Gallicano GI",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "18447642",
"url": "https://glygen.org/publication/PubMed/18447642"
}
]
},
{
"title": "5-lipoxygenase inhibitory activity of zileuton.",
"journal": "The Journal of pharmacology and experimental therapeutics",
"date": "1991",
"authors": "Carter GW, Young PR, Albert DH, Bouska J, Dyer R, Bell RL, Summers JB, Brooks DW",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2142691",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2142691"
}
],
"reference": [
{
"type": "PubMed",
"id": "1848634",
"url": "https://glygen.org/publication/PubMed/1848634"
}
]
},
{
"title": "Signal transducer and activator of transcription 3 is required for hypoxia-inducible factor-1alpha RNA expression in both tumor cells and tumor-associated myeloid cells.",
"journal": "Molecular cancer research : MCR",
"date": "2008",
"authors": "Niu G, Briggs J, Deng J, Ma Y, Lee H, Kortylewski M, Kujawski M, Kay H, Cress WD, Jove R, Yu H",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "18644974",
"url": "https://glygen.org/publication/PubMed/18644974"
}
]
},
{
"title": "Hodgkin Reed-Sternberg cells express 15-lipoxygenase-1 and are putative producers of eoxins in vivo: novel insight into the inflammatory features of classical Hodgkin lymphoma.",
"journal": "The FEBS journal",
"date": "2008",
"authors": "Claesson HE, Griffiths WJ, Brunnstrom A, Schain F, Andersson E, Feltenmark S, Johnson HA, Porwit A, Sjoberg J, Bjorkholm M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2142691",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2142691"
}
],
"reference": [
{
"type": "PubMed",
"id": "18647347",
"url": "https://glygen.org/publication/PubMed/18647347"
}
]
},
{
"title": "Phosphorylation of serine 271 on 5-lipoxygenase and its role in nuclear export.",
"journal": "The Journal of biological chemistry",
"date": "2009",
"authors": "Flamand N, Luo M, Peters-Golden M, Brock TG",
"evidence": [
{
"database": "UniProtKB",
"id": "P09917",
"url": "https://www.uniprot.org/uniprot/P09917"
},
{
"database": "iPTMnet",
"id": "P09917",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09917"
}
],
"reference": [
{
"type": "PubMed",
"id": "18978352",
"url": "https://glygen.org/publication/PubMed/18978352"
}
]
},
{
"title": "Human Dicer C-terminus functions as a 5-lipoxygenase binding domain.",
"journal": "Biochimica et biophysica acta",
"date": "2009",
"authors": "Dincbas-Renqvist V, Pepin G, Rakonjac M, Plante I, Ouellet DL, Hermansson A, Goulet I, Doucet J, Samuelsson B, Radmark O, Provost P",
"evidence": [
{
"database": "UniProtKB",
"id": "P09917",
"url": "https://www.uniprot.org/uniprot/P09917"
}
],
"reference": [
{
"type": "PubMed",
"id": "19022417",
"url": "https://glygen.org/publication/PubMed/19022417"
}
]
},
{
"title": "Paraoxonases (PON1, PON2, PON3) analyses in vitro and in vivo in relation to cardiovascular diseases.",
"journal": "Methods in molecular biology (Clifton, N.J.)",
"date": "2008",
"authors": "Aviram M, Rosenblat M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2142688",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2142688"
}
],
"reference": [
{
"type": "PubMed",
"id": "19082953",
"url": "https://glygen.org/publication/PubMed/19082953"
}
]
},
{
"title": "Maresins: novel macrophage mediators with potent antiinflammatory and proresolving actions.",
"journal": "The Journal of experimental medicine",
"date": "2009",
"authors": "Serhan CN, Yang R, Martinod K, Kasuga K, Pillai PS, Porter TF, Oh SF, Spite M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9018682",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018682"
}
],
"reference": [
{
"type": "PubMed",
"id": "19103881",
"url": "https://glygen.org/publication/PubMed/19103881"
}
]
},
{
"title": "Mechanism of interferon-gamma mediated down-regulation of interleukin-10 gene expression.",
"journal": "Molecular immunology",
"date": "2009",
"authors": "Schaefer A, Unterberger C, Frankenberger M, Lohrum M, Staples KJ, Werner T, Stunnenberg H, Ziegler-Heitbrock L",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "19124156",
"url": "https://glygen.org/publication/PubMed/19124156"
}
]
},
{
"title": "Regulation of the IL-23 and IL-12 balance by Stat3 signaling in the tumor microenvironment.",
"journal": "Cancer cell",
"date": "2009",
"authors": "Kortylewski M, Xin H, Kujawski M, Lee H, Liu Y, Harris T, Drake C, Pardoll D, Yu H",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "19185846",
"url": "https://glygen.org/publication/PubMed/19185846"
}
]
},
{
"title": "Distinct parts of leukotriene C(4) synthase interact with 5-lipoxygenase and 5-lipoxygenase activating protein.",
"journal": "Biochem. Biophys. Res. Commun.",
"date": "2009",
"authors": "Strid T, Svartz J, Franck N, Hallin E, Ingelsson B, Soderstrom M, Hammarstrom S",
"evidence": [
{
"database": "UniProtKB",
"id": "P09917",
"url": "https://www.uniprot.org/uniprot/P09917"
}
],
"reference": [
{
"type": "PubMed",
"id": "19233132",
"url": "https://glygen.org/publication/PubMed/19233132"
}
]
},
{
"title": "Evaluation of the role of conserved His and Met residues among lipoxygenases by site-directed mutagenesis of recombinant human 5-lipoxygenase.",
"journal": "The Journal of biological chemistry",
"date": "1991",
"authors": "Nguyen T, Falgueyret JP, Abramovitz M, Riendeau D",
"evidence": [
{
"database": "UniProtKB",
"id": "P09917",
"url": "https://www.uniprot.org/uniprot/P09917"
}
],
"reference": [
{
"type": "PubMed",
"id": "1939225",
"url": "https://glygen.org/publication/PubMed/1939225"
}
]
},
{
"title": "The RhoU/Wrch1 Rho GTPase gene is a common transcriptional target of both the gp130/STAT3 and Wnt-1 pathways.",
"journal": "The Biochemical journal",
"date": "2009",
"authors": "Schiavone D, Dewilde S, Vallania F, Turkson J, Di Cunto F, Poli V",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "19397496",
"url": "https://glygen.org/publication/PubMed/19397496"
}
]
},
{
"title": "Balsalazide: a novel 5-aminosalicylate prodrug for the treatment of active ulcerative colitis.",
"journal": "Expert opinion on drug metabolism & toxicology",
"date": "2009",
"authors": "Wiggins JB, Rajapakse R",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2142691",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2142691"
}
],
"reference": [
{
"type": "PubMed",
"id": "19743890",
"url": "https://glygen.org/publication/PubMed/19743890"
}
]
},
{
"title": "Coactosin-like protein functions as a stabilizing chaperone for 5-lipoxygenase: role of tryptophan 102.",
"journal": "The Biochemical journal",
"date": "2009",
"authors": "Esser J, Rakonjac M, Hofmann B, Fischer L, Provost P, Schneider G, Steinhilber D, Samuelsson B, Radmark O",
"evidence": [
{
"database": "UniProtKB",
"id": "P09917",
"url": "https://www.uniprot.org/uniprot/P09917"
}
],
"reference": [
{
"type": "PubMed",
"id": "19807693",
"url": "https://glygen.org/publication/PubMed/19807693"
}
]
},
{
"title": "Resolvin D2 is a potent regulator of leukocytes and controls microbial sepsis.",
"journal": "Nature",
"date": "2009",
"authors": "Spite M, Norling LV, Summers L, Yang R, Cooper D, Petasis NA, Flower RJ, Perretti M, Serhan CN",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9020265",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9020265"
}
],
"reference": [
{
"type": "PubMed",
"id": "19865173",
"url": "https://glygen.org/publication/PubMed/19865173"
}
]
},
{
"title": "Cyclooxygenase-2 generates anti-inflammatory mediators from omega-3 fatty acids.",
"journal": "Nature chemical biology",
"date": "2010",
"authors": "Groeger AL, Cipollina C, Cole MP, Woodcock SR, Bonacci G, Rudolph TK, Rudolph V, Freeman BA, Schopfer FJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9027604",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9027604"
}
],
"reference": [
{
"type": "PubMed",
"id": "20436486",
"url": "https://glygen.org/publication/PubMed/20436486"
}
]
},
{
"title": "Zileuton, a new efficient and safe systemic anti-acne drug.",
"journal": "Dermato-endocrinology",
"date": "2009",
"authors": "Zouboulis CC",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2142691",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2142691"
}
],
"reference": [
{
"type": "PubMed",
"id": "20436887",
"url": "https://glygen.org/publication/PubMed/20436887"
}
]
},
{
"title": "Diverse targets of the transcription factor STAT3 contribute to T cell pathogenicity and homeostasis.",
"journal": "Immunity",
"date": "2010",
"authors": "Durant L, Watford WT, Ramos HL, Laurence A, Vahedi G, Wei L, Takahashi H, Sun HW, Kanno Y, Powrie F, O'Shea JJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "20493732",
"url": "https://glygen.org/publication/PubMed/20493732"
}
]
},
{
"title": "Novel 5-lipoxygenase isoforms affect the biosynthesis of 5-lipoxygenase products.",
"journal": "FASEB J.",
"date": "2011",
"authors": "Boudreau Luc H, Bertin Jonathan, Robichaud Philippe P, Laflamme Mark, Ouellette Rodney J, Flamand Nicolas, Surette Marc E",
"evidence": [
{
"database": "UniProtKB",
"id": "P09917",
"url": "https://www.uniprot.org/uniprot/P09917"
}
],
"reference": [
{
"type": "PubMed",
"id": "21098726",
"url": "https://glygen.org/publication/PubMed/21098726"
}
]
},
{
"title": "STAT3-induced S1PR1 expression is crucial for persistent STAT3 activation in tumors.",
"journal": "Nature medicine",
"date": "2010",
"authors": "Lee H, Deng J, Kujawski M, Yang C, Liu Y, Herrmann A, Kortylewski M, Horne D, Somlo G, Forman S, Jove R, Yu H",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "21102457",
"url": "https://glygen.org/publication/PubMed/21102457"
}
]
},
{
"title": "Ligation of CD40 receptor in human B lymphocytes triggers the 5-lipoxygenase pathway to produce reactive oxygen species and activate p38 MAPK.",
"journal": "Experimental & molecular medicine",
"date": "2011-02-28",
"authors": "Ha Yun Jung, Seul Hee Jung, Lee Jong Ran",
"evidence": [
{
"database": "UniProtKB",
"id": "P09917",
"url": "https://www.uniprot.org/uniprot/P09917"
}
],
"reference": [
{
"type": "PubMed",
"id": "21200133",
"url": "https://glygen.org/publication/PubMed/21200133"
}
]
},
{
"title": "Pro-resolving actions and stereoselective biosynthesis of 18S E-series resolvins in human leukocytes and murine inflammation.",
"journal": "The Journal of clinical investigation",
"date": "2011",
"authors": "Oh SF, Pillai PS, Recchiuti A, Yang R, Serhan CN",
"evidence": [
{
"database": "UniProtKB",
"id": "P09917",
"url": "https://www.uniprot.org/uniprot/P09917"
},
{
"database": "Reactome",
"id": "R-HSA-9018896",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018896"
}
],
"reference": [
{
"type": "PubMed",
"id": "21206090",
"url": "https://glygen.org/publication/PubMed/21206090"
}
]
},
{
"title": "The structure of human 5-lipoxygenase.",
"journal": "Science (New York, N.Y.)",
"date": "2011",
"authors": "Gilbert NC, Bartlett SG, Waight MT, Neau DB, Boeglin WE, Brash AR, Newcomer ME",
"evidence": [
{
"database": "UniProtKB",
"id": "P09917",
"url": "https://www.uniprot.org/uniprot/P09917"
}
],
"reference": [
{
"type": "PubMed",
"id": "21233389",
"url": "https://glygen.org/publication/PubMed/21233389"
}
]
},
{
"title": "alphaMbeta(2) integrin activation prevents alternative activation of human and murine macrophages and impedes foam cell formation.",
"journal": "Circulation research",
"date": "2011",
"authors": "Yakubenko VP, Bhattacharjee A, Pluskota E, Cathcart MK",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "21252155",
"url": "https://glygen.org/publication/PubMed/21252155"
}
]
},
{
"title": "Gamma-glutamyl compounds: substrate specificity of gamma-glutamyl transpeptidase enzymes.",
"journal": "Analytical biochemistry",
"date": "2011",
"authors": "Wickham S, West MB, Cook PF, Hanigan MH",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2142691",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2142691"
}
],
"reference": [
{
"type": "PubMed",
"id": "21447318",
"url": "https://glygen.org/publication/PubMed/21447318"
}
]
},
{
"title": "Lipoxin formation during human neutrophil-platelet interactions. Evidence for the transformation of leukotriene A4 by platelet 12-lipoxygenase in vitro.",
"journal": "The Journal of clinical investigation",
"date": "1990",
"authors": "Serhan CN, Sheppard KA",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2142700",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2142700"
}
],
"reference": [
{
"type": "PubMed",
"id": "2155925",
"url": "https://glygen.org/publication/PubMed/2155925"
}
]
},
{
"title": "TRIM8 regulates Nanog via Hsp90beta-mediated nuclear translocation of STAT3 in embryonic stem cells.",
"journal": "Biochimica et biophysica acta",
"date": "2011",
"authors": "Okumura F, Okumura AJ, Matsumoto M, Nakayama KI, Hatakeyama S",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "21689689",
"url": "https://glygen.org/publication/PubMed/21689689"
}
]
},
{
"title": "STAT3 protein promotes T-cell survival and inhibits interleukin-2 production through up-regulation of Class O Forkhead transcription factors.",
"journal": "The Journal of biological chemistry",
"date": "2011",
"authors": "Oh HM, Yu CR, Golestaneh N, Amadi-Obi A, Lee YS, Eseonu A, Mahdi RM, Egwuagu CE",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "21730069",
"url": "https://glygen.org/publication/PubMed/21730069"
}
]
},
{
"title": "Signal transducers and activators of transcription 3 (STAT3) directly regulates cytokine-induced fascin expression and is required for breast cancer cell migration.",
"journal": "The Journal of biological chemistry",
"date": "2011",
"authors": "Snyder M, Huang XY, Zhang JJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "21937440",
"url": "https://glygen.org/publication/PubMed/21937440"
}
]
},
{
"title": "Cytokine induction of tumor necrosis factor receptor 2 is mediated by STAT3 in colon cancer cells.",
"journal": "Molecular cancer research : MCR",
"date": "2011",
"authors": "Hamilton KE, Simmons JG, Ding S, Van Landeghem L, Lund PK",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "21994466",
"url": "https://glygen.org/publication/PubMed/21994466"
}
]
},
{
"title": "Necdin, a negative growth regulator, is a novel STAT3 target gene down-regulated in human cancer.",
"journal": "PloS one",
"date": "2011",
"authors": "Haviland R, Eschrich S, Bloom G, Ma Y, Minton S, Jove R, Cress WD",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "22046235",
"url": "https://glygen.org/publication/PubMed/22046235"
}
]
},
{
"title": "Roles of STAT3 and ZEB1 proteins in E-cadherin down-regulation and human colorectal cancer epithelial-mesenchymal transition.",
"journal": "The Journal of biological chemistry",
"date": "2012",
"authors": "Xiong H, Hong J, Du W, Lin YW, Ren LL, Wang YC, Su WY, Wang JL, Cui Y, Wang ZH, Fang JY",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "22205702",
"url": "https://glygen.org/publication/PubMed/22205702"
}
]
},
{
"title": "Identification and structure determination of novel anti-inflammatory mediator resolvin E3, 17,18-dihydroxyeicosapentaenoic acid.",
"journal": "The Journal of biological chemistry",
"date": "2012",
"authors": "Isobe Y, Arita M, Matsueda S, Iwamoto R, Fujihara T, Nakanishi H, Taguchi R, Masuda K, Sasaki K, Urabe D, Inoue M, Arai H",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9023661",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9023661"
}
],
"reference": [
{
"type": "PubMed",
"id": "22275352",
"url": "https://glygen.org/publication/PubMed/22275352"
}
]
},
{
"title": "The Jak/STAT pathway.",
"journal": "Cold Spring Harbor perspectives in biology",
"date": "2012",
"authors": "Harrison DA",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "22383755",
"url": "https://glygen.org/publication/PubMed/22383755"
}
]
},
{
"title": "Resolvin E2 formation and impact in inflammation resolution.",
"journal": "Journal of immunology (Baltimore, Md. : 1950)",
"date": "2012",
"authors": "Oh SF, Dona M, Fredman G, Krishnamoorthy S, Irimia D, Serhan CN",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9018896",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018896"
}
],
"reference": [
{
"type": "PubMed",
"id": "22450811",
"url": "https://glygen.org/publication/PubMed/22450811"
}
]
},
{
"title": "Characterization of the human 5-lipoxygenase gene promoter.",
"journal": "Proc. Natl. Acad. Sci. U.S.A.",
"date": "1990",
"authors": "Hoshiko S, R\u00e5dmark O, Samuelsson B",
"evidence": [
{
"database": "UniProtKB",
"id": "P09917",
"url": "https://www.uniprot.org/uniprot/P09917"
}
],
"reference": [
{
"type": "PubMed",
"id": "2251250",
"url": "https://glygen.org/publication/PubMed/2251250"
}
]
},
{
"title": "Conversion of human 5-lipoxygenase to a 15-lipoxygenase by a point mutation to mimic phosphorylation at Serine-663.",
"journal": "FASEB journal : official publication of the Federation of American Societies for Experimental Biology",
"date": "2012",
"authors": "Gilbert NC, Rui Z, Neau DB, Waight MT, Bartlett SG, Boeglin WE, Brash AR, Newcomer ME",
"evidence": [
{
"database": "UniProtKB",
"id": "P09917",
"url": "https://www.uniprot.org/uniprot/P09917"
}
],
"reference": [
{
"type": "PubMed",
"id": "22516296",
"url": "https://glygen.org/publication/PubMed/22516296"
}
]
},
{
"title": "STAT1 gene expression is enhanced by nuclear EGFR and HER2 via cooperation with STAT3.",
"journal": "Molecular carcinogenesis",
"date": "2013",
"authors": "Han W, Carpenter RL, Cao X, Lo HW",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "22693070",
"url": "https://glygen.org/publication/PubMed/22693070"
}
]
},
{
"title": "Interleukin-10-induced neutrophil gelatinase-associated lipocalin production in macrophages with consequences for tumor growth.",
"journal": "Molecular and cellular biology",
"date": "2012",
"authors": "Jung M, Weigert A, Tausendschon M, Mora J, Oren B, Sola A, Hotter G, Muta T, Brune B",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "22851691",
"url": "https://glygen.org/publication/PubMed/22851691"
}
]
},
{
"title": "Oral 5-aminosalicylic acid for induction of remission in ulcerative colitis.",
"journal": "The Cochrane database of systematic reviews",
"date": "2012",
"authors": "Feagan BG, Macdonald JK",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2142691",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2142691"
}
],
"reference": [
{
"type": "PubMed",
"id": "23076889",
"url": "https://glygen.org/publication/PubMed/23076889"
}
]
},
{
"title": "STAT1 activation by venous malformations mutant Tie2-R849W antagonizes VEGF-A-mediated angiogenic response partly via reduced bFGF production.",
"journal": "Angiogenesis",
"date": "2013",
"authors": "Huang YH, Wu MP, Pan SC, Su WC, Chen YW, Wu LW",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "23086340",
"url": "https://glygen.org/publication/PubMed/23086340"
}
]
},
{
"title": "IL-4 and IL-13 employ discrete signaling pathways for target gene expression in alternatively activated monocytes/macrophages.",
"journal": "Free radical biology & medicine",
"date": "2013",
"authors": "Bhattacharjee A, Shukla M, Yakubenko VP, Mulya A, Kundu S, Cathcart MK",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "23124025",
"url": "https://glygen.org/publication/PubMed/23124025"
}
]
},
{
"title": "STAT3 is involved in esophageal carcinogenesis through regulation of Oct-1.",
"journal": "Carcinogenesis",
"date": "2013",
"authors": "Wang Z, Zhu S, Shen M, Liu J, Wang M, Li C, Wang Y, Deng A, Mei Q",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "23172665",
"url": "https://glygen.org/publication/PubMed/23172665"
}
]
},
{
"title": "Conversion of pro-inflammatory murine Alox5 into an anti-inflammatory 15S-lipoxygenating enzyme by multiple mutations of sequence determinants.",
"journal": "Archives of biochemistry and biophysics",
"date": "2013",
"authors": "Hofheinz K, Kakularam KR, Adel S, Anton M, Polymarasetty A, Reddanna P, Kuhn H, Horn T",
"evidence": [
{
"database": "UniProtKB",
"id": "P09917",
"url": "https://www.uniprot.org/uniprot/P09917"
}
],
"reference": [
{
"type": "PubMed",
"id": "23246375",
"url": "https://glygen.org/publication/PubMed/23246375"
}
]
},
{
"title": "Stereochemical assignment and anti-inflammatory properties of the omega-3 lipid mediator resolvin E3.",
"journal": "Journal of biochemistry",
"date": "2013",
"authors": "Isobe Y, Arita M, Iwamoto R, Urabe D, Todoroki H, Masuda K, Inoue M, Arai H",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9023661",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9023661"
}
],
"reference": [
{
"type": "PubMed",
"id": "23293324",
"url": "https://glygen.org/publication/PubMed/23293324"
}
]
},
{
"title": "Resolvin D3 and aspirin-triggered resolvin D3 are potent immunoresolvents.",
"journal": "Chemistry & biology",
"date": "2013",
"authors": "Dalli J, Winkler JW, Colas RA, Arnardottir H, Cheng CY, Chiang N, Petasis NA, Serhan CN",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9018676",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018676"
}
],
"reference": [
{
"type": "PubMed",
"id": "23438748",
"url": "https://glygen.org/publication/PubMed/23438748"
}
]
},
{
"title": "Mutant B-RAF-Mcl-1 survival signaling depends on the STAT3 transcription factor.",
"journal": "Oncogene",
"date": "2014",
"authors": "Becker TM, Boyd SC, Mijatov B, Gowrishankar K, Snoyman S, Pupo GM, Scolyer RA, Mann GJ, Kefford RF, Zhang XD, Rizos H",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "23455323",
"url": "https://glygen.org/publication/PubMed/23455323"
}
]
},
{
"title": "Tissue inhibitor of metalloproteinase 1 is preferentially expressed in Th1 and Th17 T-helper cell subsets and is a direct STAT target gene.",
"journal": "PloS one",
"date": "2013",
"authors": "Adamson A, Ghoreschi K, Rittler M, Chen Q, Sun HW, Vahedi G, Kanno Y, Stetler-Stevenson WG, O'Shea JJ, Laurence A",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "23555662",
"url": "https://glygen.org/publication/PubMed/23555662"
}
]
},
{
"title": "Proteome profiling of human neutrophil granule subsets, secretory vesicles, and cell membrane: correlation with transcriptome profiling of neutrophil precursors.",
"journal": "Journal of leukocyte biology",
"date": "2013",
"authors": "Rorvig S, Ostergaard O, Heegaard NH, Borregaard N",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6798695",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6798695"
}
],
"reference": [
{
"type": "PubMed",
"id": "23650620",
"url": "https://glygen.org/publication/PubMed/23650620"
}
]
},
{
"title": "Novel n-3 immunoresolvents: structures and actions.",
"journal": "Scientific reports",
"date": "2013",
"authors": "Dalli J, Colas RA, Serhan CN",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9026286",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9026286"
}
],
"reference": [
{
"type": "PubMed",
"id": "23736886",
"url": "https://glygen.org/publication/PubMed/23736886"
}
]
},
{
"title": "STAT3 regulates MMP3 in heme-induced endothelial cell apoptosis.",
"journal": "PloS one",
"date": "2013",
"authors": "Liu M, Wilson NO, Hibbert JM, Stiles JK",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "23967200",
"url": "https://glygen.org/publication/PubMed/23967200"
}
]
},
{
"title": "The signal transducers Stat1 and Stat3 and their novel target Jmjd3 drive the expression of inflammatory genes in microglia.",
"journal": "Journal of molecular medicine (Berlin, Germany)",
"date": "2014",
"authors": "Przanowski P, Dabrowski M, Ellert-Miklaszewska A, Kloss M, Mieczkowski J, Kaza B, Ronowicz A, Hu F, Piotrowski A, Kettenmann H, Komorowski J, Kaminska B",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "24097101",
"url": "https://glygen.org/publication/PubMed/24097101"
}
]
},
{
"title": "Functional characterization of genetic enzyme variations in human lipoxygenases.",
"journal": "Redox biology",
"date": "2013",
"authors": "Horn T, Reddy Kakularam K, Anton M, Richter C, Reddanna P, Kuhn H",
"evidence": [
{
"database": "UniProtKB",
"id": "P09917",
"url": "https://www.uniprot.org/uniprot/P09917"
}
],
"reference": [
{
"type": "PubMed",
"id": "24282679",
"url": "https://glygen.org/publication/PubMed/24282679"
}
]
},
{
"title": "Total synthesis of the lipid mediator PD1n-3 DPA: configurational assignments and anti-inflammatory and pro-resolving actions.",
"journal": "Journal of natural products",
"date": "2014",
"authors": "Aursnes M, Tungen JE, Vik A, Colas R, Cheng CY, Dalli J, Serhan CN, Hansen TV",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9026286",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9026286"
}
],
"reference": [
{
"type": "PubMed",
"id": "24576195",
"url": "https://glygen.org/publication/PubMed/24576195"
}
]
},
{
"title": "Generation and dietary modulation of anti-inflammatory electrophilic omega-3 fatty acid derivatives.",
"journal": "PloS one",
"date": "2014",
"authors": "Cipollina C, Salvatore SR, Muldoon MF, Freeman BA, Schopfer FJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9027604",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9027604"
}
],
"reference": [
{
"type": "PubMed",
"id": "24736647",
"url": "https://glygen.org/publication/PubMed/24736647"
}
]
},
{
"title": "STAT3 Target Genes Relevant to Human Cancers.",
"journal": "Cancers",
"date": "2014",
"authors": "Carpenter RL, Lo HW",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "24743777",
"url": "https://glygen.org/publication/PubMed/24743777"
}
]
},
{
"title": "Analysis of 5-lipoxygenase phosphorylation on molecular level by MALDI-MS.",
"journal": "The FEBS journal",
"date": "2014",
"authors": "Markoutsa S, Surun D, Karas M, Hofmann B, Steinhilber D, Sorg BL",
"evidence": [
{
"database": "iPTMnet",
"id": "P09917",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09917"
}
],
"reference": [
{
"type": "PubMed",
"id": "24860872",
"url": "https://glygen.org/publication/PubMed/24860872"
}
]
},
{
"title": "ATP allosterically activates the human 5-lipoxygenase molecular mechanism of arachidonic acid and 5(S)-hydroperoxy-6(E),8(Z),11(Z),14(Z)-eicosatetraenoic acid.",
"journal": "Biochemistry",
"date": "2014-07-15",
"authors": "Smyrniotis Christopher J, Barbour Shannon R, Xia Zexin, Hixon Mark S, Holman Theodore R",
"evidence": [
{
"database": "UniProtKB",
"id": "P09917",
"url": "https://www.uniprot.org/uniprot/P09917"
}
],
"reference": [
{
"type": "PubMed",
"id": "24893149",
"url": "https://glygen.org/publication/PubMed/24893149"
}
]
},
{
"title": "Maresin biosynthesis and identification of maresin 2, a new anti-inflammatory and pro-resolving mediator from human macrophages.",
"journal": "PloS one",
"date": "2014",
"authors": "Deng B, Wang CW, Arnardottir HH, Li Y, Cheng CY, Dalli J, Serhan CN",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9018682",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018682"
}
],
"reference": [
{
"type": "PubMed",
"id": "25036362",
"url": "https://glygen.org/publication/PubMed/25036362"
}
]
},
{
"title": "Liver is the major source of elevated serum lipocalin-2 levels after bacterial infection or partial hepatectomy: a critical role for IL-6/STAT3.",
"journal": "Hepatology (Baltimore, Md.)",
"date": "2015",
"authors": "Xu MJ, Feng D, Wu H, Wang H, Chan Y, Kolls J, Borregaard N, Porse B, Berger T, Mak TW, Cowland JB, Kong X, Gao B",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "25234944",
"url": "https://glygen.org/publication/PubMed/25234944"
}
]
},
{
"title": "Molecular cloning and amino acid sequence of human 5-lipoxygenase.",
"journal": "Adv. Prostaglandin Thromboxane Leukotriene Res.",
"date": "1989",
"authors": "Matsumoto T, Funk C D, R\u00e5dmark O, H\u00f6\u00f6g J O, J\u00f6rnvall H, Samuelsson B",
"evidence": [
{
"database": "UniProtKB",
"id": "P09917",
"url": "https://www.uniprot.org/uniprot/P09917"
}
],
"reference": [
{
"type": "PubMed",
"id": "2526519",
"url": "https://glygen.org/publication/PubMed/2526519"
}
]
},
{
"title": "Characterization of the human 5-lipoxygenase gene.",
"journal": "Proc. Natl. Acad. Sci. U.S.A.",
"date": "1989",
"authors": "Funk CD, Hoshiko S, Matsumoto T, Rdmark O, Samuelsson B",
"evidence": [
{
"database": "UniProtKB",
"id": "P09917",
"url": "https://www.uniprot.org/uniprot/P09917"
}
],
"reference": [
{
"type": "PubMed",
"id": "2565035",
"url": "https://glygen.org/publication/PubMed/2565035"
}
]
},
{
"title": "Phosphorylation of serine 523 on 5-lipoxygenase in human B lymphocytes.",
"journal": "Prostaglandins, leukotrienes, and essential fatty acids",
"date": "2015",
"authors": "Mahshid Y, Markoutsa S, Dincbas-Renqvist V, Surun D, Christensson B, Sander B, Bjorkholm M, Sorg BL, Radmark O, Claesson HE",
"evidence": [
{
"database": "UniProtKB",
"id": "P09917",
"url": "https://www.uniprot.org/uniprot/P09917"
},
{
"database": "iPTMnet",
"id": "P09917",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09917"
}
],
"reference": [
{
"type": "PubMed",
"id": "26210919",
"url": "https://glygen.org/publication/PubMed/26210919"
}
]
},
{
"title": "Elucidation of novel 13-series resolvins that increase with atorvastatin and clear infections.",
"journal": "Nature medicine",
"date": "2015",
"authors": "Dalli J, Chiang N, Serhan CN",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9026403",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9026403"
}
],
"reference": [
{
"type": "PubMed",
"id": "26236990",
"url": "https://glygen.org/publication/PubMed/26236990"
}
]
},
{
"title": "Resolvin D4 stereoassignment and its novel actions in host protection and bacterial clearance.",
"journal": "Scientific reports",
"date": "2016",
"authors": "Winkler JW, Orr SK, Dalli J, Cheng CY, Sanger JM, Chiang N, Petasis NA, Serhan CN",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9018676",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018676"
}
],
"reference": [
{
"type": "PubMed",
"id": "26743932",
"url": "https://glygen.org/publication/PubMed/26743932"
}
]
},
{
"title": "Maximum Time of the Effect of Antileukotriene - Zileuton in Treatment of Patients with Bronchial Asthma.",
"journal": "Acta informatica medica : AIM : journal of the Society for Medical Informatics of Bosnia & Herzegovina : casopis Drustva za medicinsku informatiku BiH",
"date": "2016",
"authors": "Morina N, Bocari G, Iljazi A, Hyseini K, Halac G",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2142691",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2142691"
}
],
"reference": [
{
"type": "PubMed",
"id": "27046942",
"url": "https://glygen.org/publication/PubMed/27046942"
}
]
},
{
"title": "The identification of a distinct export step following the biosynthesis of leukotriene C4 by human eosinophils.",
"journal": "The Journal of biological chemistry",
"date": "1989",
"authors": "Lam BK, Owen WF Jr, Austen KF, Soberman RJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2142691",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2142691"
}
],
"reference": [
{
"type": "PubMed",
"id": "2753893",
"url": "https://glygen.org/publication/PubMed/2753893"
}
]
},
{
"title": "Purification and characterization of human microsomal dipeptidase.",
"journal": "Journal of biochemistry",
"date": "1989",
"authors": "Adachi H, Kubota I, Okamura N, Iwata H, Tsujimoto M, Nakazato H, Nishihara T, Noguchi T",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2142691",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2142691"
}
],
"reference": [
{
"type": "PubMed",
"id": "2768222",
"url": "https://glygen.org/publication/PubMed/2768222"
}
]
},
{
"title": "Synthesis of 13(R)-Hydroxy-7Z,10Z,13R,14E,16Z,19Z Docosapentaenoic Acid (13R-HDPA) and Its Biosynthetic Conversion to the 13-Series Resolvins.",
"journal": "Journal of natural products",
"date": "2016",
"authors": "Primdahl KG, Aursnes M, Walker ME, Colas RA, Serhan CN, Dalli J, Hansen TV, Vik A",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9026403",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9026403"
}
],
"reference": [
{
"type": "PubMed",
"id": "27704804",
"url": "https://glygen.org/publication/PubMed/27704804"
}
]
},
{
"title": "Molecular cloning and amino acid sequence of human 5-lipoxygenase.",
"journal": "Proc. Natl. Acad. Sci. U.S.A.",
"date": "1988",
"authors": "Matsumoto T, Funk CD, Radmark O, Hoog JO, Jornvall H, Samuelsson B",
"evidence": [
{
"database": "UniProtKB",
"id": "P09917",
"url": "https://www.uniprot.org/uniprot/P09917"
}
],
"reference": [
{
"type": "PubMed",
"id": "2829172",
"url": "https://glygen.org/publication/PubMed/2829172"
}
]
},
{
"title": "The identification and formation of 20-aldehyde leukotriene B4.",
"journal": "The Journal of biological chemistry",
"date": "1988",
"authors": "Soberman RJ, Sutyak JP, Okita RT, Wendelborn DF, Roberts LJ 2nd, Austen KF",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2142691",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2142691"
}
],
"reference": [
{
"type": "PubMed",
"id": "2836406",
"url": "https://glygen.org/publication/PubMed/2836406"
}
]
},
{
"title": "Recent advances in the chemistry and biology of anti-inflammatory and specialized pro-resolving mediators biosynthesized from n-3 docosapentaenoic acid.",
"journal": "Bioorganic & medicinal chemistry letters",
"date": "2017",
"authors": "Vik A, Dalli J, Hansen TV",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9026290",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9026290"
}
],
"reference": [
{
"type": "PubMed",
"id": "28408222",
"url": "https://glygen.org/publication/PubMed/28408222"
}
]
},
{
"title": "Clinical pharmacokinetics of sulphasalazine, its metabolites and other prodrugs of 5-aminosalicylic acid.",
"journal": "Clinical pharmacokinetics",
"date": "1985",
"authors": "Klotz U",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2142691",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2142691"
}
],
"reference": [
{
"type": "PubMed",
"id": "2864155",
"url": "https://glygen.org/publication/PubMed/2864155"
}
]
},
{
"title": "Modulation of human colonic arachidonic acid metabolism by sulfasalazine.",
"journal": "Digestive diseases and sciences",
"date": "1985",
"authors": "Hawkey CJ, Boughton-Smith NK, Whittle BJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2142691",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2142691"
}
],
"reference": [
{
"type": "PubMed",
"id": "2866075",
"url": "https://glygen.org/publication/PubMed/2866075"
}
]
},
{
"title": "Pharmacological and biochemical actions of sulphasalazine.",
"journal": "Drugs",
"date": "1986",
"authors": "Hoult JR",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2142691",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2142691"
}
],
"reference": [
{
"type": "PubMed",
"id": "2877850",
"url": "https://glygen.org/publication/PubMed/2877850"
}
]
},
{
"title": "Inhibition of 5-lipoxygenase pathway of arachidonic acid metabolism in human neutrophils by sulfasalazine and 5-aminosalicylic acid.",
"journal": "Digestive diseases and sciences",
"date": "1987",
"authors": "Nielsen OH, Bukhave K, Elmgreen J, Ahnfelt-Ronne I",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2142691",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2142691"
}
],
"reference": [
{
"type": "PubMed",
"id": "2882965",
"url": "https://glygen.org/publication/PubMed/2882965"
}
]
},
{
"title": "Stereocontrolled synthesis and investigation of the biosynthetic transformations of 16(S),17(S)-epoxy-PDn-3 DPA.",
"journal": "Organic & biomolecular chemistry",
"date": "2017",
"authors": "Primdahl KG, Tungen JE, De Souza PRS, Colas RA, Dalli J, Hansen TV, Vik A",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9018676",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018676"
}
],
"reference": [
{
"type": "PubMed",
"id": "28980694",
"url": "https://glygen.org/publication/PubMed/28980694"
}
]
},
{
"title": "Recent advances in the search for novel 5-lipoxygenase inhibitors for the treatment of asthma.",
"journal": "European journal of medicinal chemistry",
"date": "2018",
"authors": "Bruno F, Spaziano G, Liparulo A, Roviezzo F, Nabavi SM, Sureda A, Filosa R, D'Agostino B",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2142691",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2142691"
}
],
"reference": [
{
"type": "PubMed",
"id": "29133059",
"url": "https://glygen.org/publication/PubMed/29133059"
}
]
},
{
"title": "Enzymatic hydration of leukotriene A4. Purification and characterization of a novel epoxide hydrolase from human erythrocytes.",
"journal": "The Journal of biological chemistry",
"date": "1985",
"authors": "McGee J, Fitzpatrick F",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2142691",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2142691"
}
],
"reference": [
{
"type": "PubMed",
"id": "2995393",
"url": "https://glygen.org/publication/PubMed/2995393"
}
]
},
{
"title": "Single protein from human leukocytes possesses 5-lipoxygenase and leukotriene A4 synthase activities.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "1986",
"authors": "Rouzer CA, Matsumoto T, Samuelsson B",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2142688",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2142688"
}
],
"reference": [
{
"type": "PubMed",
"id": "3006030",
"url": "https://glygen.org/publication/PubMed/3006030"
}
]
},
{
"title": "Meclofenamate sodium is an inhibitor of both the 5-lipoxygenase and cyclooxygenase pathways of the arachidonic acid cascade in vitro.",
"journal": "Prostaglandins, leukotrienes, and medicine",
"date": "1986",
"authors": "Boctor AM, Eickholt M, Pugsley TA",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2142691",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2142691"
}
],
"reference": [
{
"type": "PubMed",
"id": "3020588",
"url": "https://glygen.org/publication/PubMed/3020588"
}
]
},
{
"title": "Role of prostaglandins in ulcerative colitis. Enhanced production during active disease and inhibition by sulfasalazine.",
"journal": "Gastroenterology",
"date": "1978",
"authors": "Sharon P, Ligumsky M, Rachmilewitz D, Zor U",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2142691",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2142691"
}
],
"reference": [
{
"type": "PubMed",
"id": "30669",
"url": "https://glygen.org/publication/PubMed/30669"
}
]
},
{
"title": "Reversible, calcium-dependent membrane association of human leukocyte 5-lipoxygenase.",
"journal": "Proc. Natl. Acad. Sci. U.S.A.",
"date": "1987",
"authors": "Rouzer CA, Samuelsson B",
"evidence": [
{
"database": "UniProtKB",
"id": "P09917",
"url": "https://www.uniprot.org/uniprot/P09917"
},
{
"database": "Reactome",
"id": "R-HSA-2142688",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2142688"
}
],
"reference": [
{
"type": "PubMed",
"id": "3118366",
"url": "https://glygen.org/publication/PubMed/3118366"
}
]
},
{
"title": "Characterization of cloned human leukocyte 5-lipoxygenase expressed in mammalian cells.",
"journal": "The Journal of biological chemistry",
"date": "1988",
"authors": "Rouzer CA, Rands E, Kargman S, Jones RE, Register RB, Dixon RA",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2142688",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2142688"
}
],
"reference": [
{
"type": "PubMed",
"id": "3164719",
"url": "https://glygen.org/publication/PubMed/3164719"
}
]
},
{
"title": "Mutations of Triad Determinants Changes the Substrate Alignment at the Catalytic Center of Human ALOX5.",
"journal": "ACS chemical biology",
"date": "2019",
"authors": "Ivanov I, Golovanov AB, Ferretti C, Canyelles-Nino M, Heydeck D, Stehling S, Lluch JM, Gonzalez-Lafont A, Kuhn H",
"evidence": [
{
"database": "UniProtKB",
"id": "P09917",
"url": "https://www.uniprot.org/uniprot/P09917"
}
],
"reference": [
{
"type": "PubMed",
"id": "31664810",
"url": "https://glygen.org/publication/PubMed/31664810"
}
]
},
{
"title": "15-Lipoxygenase-1 biosynthesis of 7S,14S-diHDHA implicates 15-lipoxygenase-2 in biosynthesis of resolvin D5.",
"journal": "Journal of lipid research",
"date": "2020-07",
"authors": "Perry Steven C, Kalyanaraman Chakrapani, Tourdot Benjamin E, Conrad William S, Akinkugbe Oluwayomi, Freedman John Cody, Holinstat Michael, Jacobson Matthew P, Holman Theodore R",
"evidence": [
{
"database": "UniProtKB",
"id": "P09917",
"url": "https://www.uniprot.org/uniprot/P09917"
}
],
"reference": [
{
"type": "PubMed",
"id": "32404334",
"url": "https://glygen.org/publication/PubMed/32404334"
}
]
},
{
"title": "Cloning of the cDNA for human 5-lipoxygenase.",
"journal": "Proc. Natl. Acad. Sci. U.S.A.",
"date": "1988",
"authors": "Dixon R A, Jones R E, Diehl R E, Bennett C D, Kargman S, Rouzer C A",
"evidence": [
{
"database": "UniProtKB",
"id": "P09917",
"url": "https://www.uniprot.org/uniprot/P09917"
}
],
"reference": [
{
"type": "PubMed",
"id": "3422434",
"url": "https://glygen.org/publication/PubMed/3422434"
}
]
},
{
"title": "Release and functional characterization of the leukotriene D4-metabolizing enzyme (dipeptidase) from human polymorphonuclear leucocytes.",
"journal": "Scandinavian journal of immunology",
"date": "1987",
"authors": "Raulf M, Konig W, Koller M, Stuning M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2142691",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2142691"
}
],
"reference": [
{
"type": "PubMed",
"id": "3563417",
"url": "https://glygen.org/publication/PubMed/3563417"
}
]
},
{
"title": "Lipoxin synthesis by arachidonate 5-lipoxygenase purified from porcine leukocytes.",
"journal": "Biochemical and biophysical research communications",
"date": "1987",
"authors": "Ueda N, Yamamoto S, Fitzsimmons BJ, Rokach J",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2142700",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2142700"
}
],
"reference": [
{
"type": "PubMed",
"id": "3579953",
"url": "https://glygen.org/publication/PubMed/3579953"
}
]
},
{
"title": "ALOX5 Promotes Autophagy-dependent Ferroptosis by Activating the AMPK/mTOR Pathway in Melanoma.",
"journal": "Biochemical pharmacology",
"date": "2023-04-18",
"authors": "Wang Min, Zeng Guang, Xiong Bingrui, Zhu Xiaobin, Guo Jia, Chen Danyang, Zhang Shanshan, Luo Min, Guo Liang, Cai Lin",
"evidence": [
{
"database": "RefSeq",
"id": "NP_000689",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_000689"
}
],
"reference": [
{
"type": "PubMed",
"id": "37080437",
"url": "https://glygen.org/publication/PubMed/37080437"
}
]
},
{
"title": "Role of ALOX5 in non-small cell lung cancer: A potential therapeutic target associated with immune cell infiltration.",
"journal": "Zhong nan da xue xue bao. Yi xue ban = Journal of Central South University. Medical sciences",
"date": "2023-03-28",
"authors": "Zhao Qianqian, Sun Zhi, Pan Yuemei, Jing Qi, Li Wei, Wang Chuanxi",
"evidence": [
{
"database": "RefSeq",
"id": "NP_000689",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_000689"
}
],
"reference": [
{
"type": "PubMed",
"id": "37164914",
"url": "https://glygen.org/publication/PubMed/37164914"
}
]
},
{
"title": "Association between a single nucleotide polymorphism of the ALOX5 gene and susceptibility to multisystem tuberculosis in a Chinese Han population.",
"journal": "Microbial pathogenesis",
"date": "2023-10",
"authors": "Zhang Juan, Wang Ming-Gui, He Jian-Qing",
"evidence": [
{
"database": "RefSeq",
"id": "NP_000689",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_000689"
}
],
"reference": [
{
"type": "PubMed",
"id": "37567324",
"url": "https://glygen.org/publication/PubMed/37567324"
}
]
},
{
"title": "Evidence for a 5(6)-epoxytetraene intermediate in the biosynthesis of lipoxins in human leukocytes. Conversion into lipoxin A by cytosolic epoxide hydrolase.",
"journal": "FEBS letters",
"date": "1986",
"authors": "Puustinen T, Webber SE, Nicolaou KC, Haeggstrom J, Serhan CN, Samuelsson B",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2142700",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2142700"
}
],
"reference": [
{
"type": "PubMed",
"id": "3770188",
"url": "https://glygen.org/publication/PubMed/3770188"
}
]
},
{
"title": "GPR146 regulates pulmonary vascular remodeling by promoting pulmonary artery smooth muscle cell proliferation through 5-lipoxygenase.",
"journal": "European journal of pharmacology",
"date": "2023-12-15",
"authors": "Huang Jie, Xie Yongpeng, Chen Bing, Xia Yu, Jiang Yanjiao, Sun Zengxian, Liu Yun",
"evidence": [
{
"database": "RefSeq",
"id": "NP_000689",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_000689"
}
],
"reference": [
{
"type": "PubMed",
"id": "37926274",
"url": "https://glygen.org/publication/PubMed/37926274"
}
]
},
{
"title": "Oncogenic PIK3CA recruits myeloid-derived suppressor cells to shape the immunosuppressive tumour microenvironment in luminal breast cancer through the 5-lipoxygenase-dependent arachidonic acid pathway.",
"journal": "Clinical and translational medicine",
"date": "2023-11",
"authors": "Li Xingchen, Chen Guidong, Wang Fanchen, Guo Xiaojing, Zhang Rui, Liu Pengpeng, Dong Li, Yu Wenwen, Wang Huan, Wang Hailong, Yu Jinpu",
"evidence": [
{
"database": "RefSeq",
"id": "NP_000689",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_000689"
}
],
"reference": [
{
"type": "PubMed",
"id": "37965796",
"url": "https://glygen.org/publication/PubMed/37965796"
}
]
},
{
"title": "Olsalazine in active ulcerative colitis.",
"journal": "British medical journal (Clinical research ed.)",
"date": "1985",
"authors": "Selby WS, Barr GD, Ireland A, Mason CH, Jewell DP",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2142691",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2142691"
}
],
"reference": [
{
"type": "PubMed",
"id": "3933675",
"url": "https://glygen.org/publication/PubMed/3933675"
}
]
},
{
"title": "Lipoxins: novel series of biologically active compounds formed from arachidonic acid in human leukocytes.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "1984",
"authors": "Serhan CN, Hamberg M, Samuelsson B",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2142700",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2142700"
}
],
"reference": [
{
"type": "PubMed",
"id": "6089195",
"url": "https://glygen.org/publication/PubMed/6089195"
}
]
},
{
"title": "Interconversion of leukotrienes catalyzed by purified gamma-glutamyl transpeptidase: concomitant formation of leukotriene D4 and gamma-glutamyl amino acids.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "1982",
"authors": "Anderson ME, Allison RD, Meister A",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2142691",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2142691"
}
],
"reference": [
{
"type": "PubMed",
"id": "6122208",
"url": "https://glygen.org/publication/PubMed/6122208"
}
]
},
{
"title": "Conversion of leukotriene D4 to leukotriene E4 by a dipeptidase released from the specific granule of human polymorphonuclear leucocytes.",
"journal": "Immunology",
"date": "1983",
"authors": "Lee CW, Lewis RA, Corey EJ, Austen KF",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2142691",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2142691"
}
],
"reference": [
{
"type": "PubMed",
"id": "6293969",
"url": "https://glygen.org/publication/PubMed/6293969"
}
]
},
{
"title": "Trihydroxytetraenes: a novel series of compounds formed from arachidonic acid in human leukocytes.",
"journal": "Biochemical and biophysical research communications",
"date": "1984",
"authors": "Serhan CN, Hamberg M, Samuelsson B",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2142700",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2142700"
}
],
"reference": [
{
"type": "PubMed",
"id": "6422933",
"url": "https://glygen.org/publication/PubMed/6422933"
}
]
},
{
"title": "Leukotriene A4 hydrolase in human leukocytes. Purification and properties.",
"journal": "The Journal of biological chemistry",
"date": "1984",
"authors": "Radmark O, Shimizu T, Jornvall H, Samuelsson B",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2142691",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2142691"
}
],
"reference": [
{
"type": "PubMed",
"id": "6490615",
"url": "https://glygen.org/publication/PubMed/6490615"
}
]
},
{
"title": "Role of glutathione peroxidase and hexose monophosphate shunt in the platelet lipoxygenase pathway.",
"journal": "The Journal of biological chemistry",
"date": "1982",
"authors": "Bryant RW, Simon TC, Bailey JM",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2142688",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2142688"
}
],
"reference": [
{
"type": "PubMed",
"id": "6816802",
"url": "https://glygen.org/publication/PubMed/6816802"
}
]
},
{
"title": "Interferon activation of the transcription factor Stat91 involves dimerization through SH2-phosphotyrosyl peptide interactions.",
"journal": "Cell",
"date": "1994",
"authors": "Shuai K, Horvath CM, Huang LH, Qureshi SA, Cowburn D, Darnell JE Jr",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "7510216",
"url": "https://glygen.org/publication/PubMed/7510216"
}
]
},
{
"title": "Molecular cloning of APRF, a novel IFN-stimulated gene factor 3 p91-related transcription factor involved in the gp130-mediated signaling pathway.",
"journal": "Cell",
"date": "1994",
"authors": "Akira S, Nishio Y, Inoue M, Wang XJ, Wei S, Matsusaka T, Yoshida K, Sudo T, Naruto M, Kishimoto T",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "7512451",
"url": "https://glygen.org/publication/PubMed/7512451"
}
]
},
{
"title": "IL-13 selectively induces vascular cell adhesion molecule-1 expression in human endothelial cells.",
"journal": "Journal of immunology (Baltimore, Md. : 1950)",
"date": "1995",
"authors": "Bochner BS, Klunk DA, Sterbinsky SA, Coffman RL, Schleimer RP",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "7529288",
"url": "https://glygen.org/publication/PubMed/7529288"
}
]
},
{
"title": "Aspirin triggers previously undescribed bioactive eicosanoids by human endothelial cell-leukocyte interactions.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "1995",
"authors": "Claria J, Serhan CN",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2142700",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2142700"
}
],
"reference": [
{
"type": "PubMed",
"id": "7568157",
"url": "https://glygen.org/publication/PubMed/7568157"
}
]
},
{
"title": "Direct evidence of a heterotrimeric complex of human interleukin-4 with its receptors.",
"journal": "Protein science : a publication of the Protein Society",
"date": "1995",
"authors": "Hoffman RC, Castner BJ, Gerhart M, Gibson MG, Rasmussen BD, March CJ, Weatherbee J, Tsang M, Gustchina A, Schalk-Hihi C, et al.",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "7795521",
"url": "https://glygen.org/publication/PubMed/7795521"
}
]
},
{
"title": "Components of a Stat recognition code: evidence for two layers of molecular selectivity.",
"journal": "Immunity",
"date": "1995",
"authors": "Schindler U, Wu P, Rothe M, Brasseur M, McKnight SL",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "7796300",
"url": "https://glygen.org/publication/PubMed/7796300"
}
]
},
{
"title": "Transcriptional regulation of the junB promoter: analysis of STAT-mediated signal transduction.",
"journal": "Oncogene",
"date": "1995",
"authors": "Coffer P, Lutticken C, van Puijenbroek A, Klop-de Jonge M, Horn F, Kruijer W",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "7898939",
"url": "https://glygen.org/publication/PubMed/7898939"
}
]
},
{
"title": "Interleukin 13, an interleukin 4-like cytokine that acts on monocytes and B cells, but not on T cells.",
"journal": "Immunology today",
"date": "1994",
"authors": "Zurawski G, de Vries JE",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "7907877",
"url": "https://glygen.org/publication/PubMed/7907877"
}
]
},
{
"title": "5-Lipoxygenase contains a functional Src homology 3-binding motif that interacts with the Src homology 3 domain of Grb2 and cytoskeletal proteins.",
"journal": "J. Biol. Chem.",
"date": "1994",
"authors": "Lepley R A, Fitzpatrick F A",
"evidence": [
{
"database": "UniProtKB",
"id": "P09917",
"url": "https://www.uniprot.org/uniprot/P09917"
}
],
"reference": [
{
"type": "PubMed",
"id": "7929073",
"url": "https://glygen.org/publication/PubMed/7929073"
}
]
},
{
"title": "Molecular cloning and expression of human leukotriene-C4 synthase.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "1994",
"authors": "Welsch DJ, Creely DP, Hauser SD, Mathis KJ, Krivi GG, Isakson PC",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2142691",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2142691"
}
],
"reference": [
{
"type": "PubMed",
"id": "7937884",
"url": "https://glygen.org/publication/PubMed/7937884"
}
]
},
{
"title": "Expression cloning of a cDNA for human leukotriene C4 synthase, an integral membrane protein conjugating reduced glutathione to leukotriene A4.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "1994",
"authors": "Lam BK, Penrose JF, Freeman GJ, Austen KF",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2142691",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2142691"
}
],
"reference": [
{
"type": "PubMed",
"id": "8052639",
"url": "https://glygen.org/publication/PubMed/8052639"
}
]
},
{
"title": "An interleukin-4-induced transcription factor: IL-4 Stat.",
"journal": "Science (New York, N.Y.)",
"date": "1994",
"authors": "Hou J, Schindler U, Henzel WJ, Ho TC, Brasseur M, McKnight SL",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "8085155",
"url": "https://glygen.org/publication/PubMed/8085155"
}
]
},
{
"title": "5-lipoxygenase and 5-lipoxygenase-activating protein are localized in the nuclear envelope of activated human leukocytes.",
"journal": "J. Exp. Med.",
"date": "1993",
"authors": "Woods JW, Evans JF, Ethier D, Scott S, Vickers PJ, Hearn L, Heibein JA, Charleson S, Singer II",
"evidence": [
{
"database": "UniProtKB",
"id": "P09917",
"url": "https://www.uniprot.org/uniprot/P09917"
}
],
"reference": [
{
"type": "PubMed",
"id": "8245774",
"url": "https://glygen.org/publication/PubMed/8245774"
}
]
},
{
"title": "Lipoxin synthase activity of human platelet 12-lipoxygenase.",
"journal": "The Biochemical journal",
"date": "1993",
"authors": "Romano M, Chen XS, Takahashi Y, Yamamoto S, Funk CD, Serhan CN",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2142700",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2142700"
}
],
"reference": [
{
"type": "PubMed",
"id": "8250832",
"url": "https://glygen.org/publication/PubMed/8250832"
}
]
},
{
"title": "Enzymatic inactivation of leukotriene B4 by a novel enzyme found in the porcine kidney. Purification and properties of leukotriene B4 12-hydroxydehydrogenase.",
"journal": "The Journal of biological chemistry",
"date": "1993",
"authors": "Yokomizo T, Izumi T, Takahashi T, Kasama T, Kobayashi Y, Sato F, Taketani Y, Shimizu T",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2142691",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2142691"
}
],
"reference": [
{
"type": "PubMed",
"id": "8394361",
"url": "https://glygen.org/publication/PubMed/8394361"
}
]
},
{
"title": "Expression, characterization, and tissue distribution of a new cellular selenium-dependent glutathione peroxidase, GSHPx-GI.",
"journal": "The Journal of biological chemistry",
"date": "1993",
"authors": "Chu FF, Doroshow JH, Esworthy RS",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2142688",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2142688"
}
],
"reference": [
{
"type": "PubMed",
"id": "8428933",
"url": "https://glygen.org/publication/PubMed/8428933"
}
]
},
{
"title": "cDNA cloning, expression, and mutagenesis study of leukotriene B4 12-hydroxydehydrogenase.",
"journal": "The Journal of biological chemistry",
"date": "1996",
"authors": "Yokomizo T, Ogawa Y, Uozumi N, Kume K, Izumi T, Shimizu T",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2142691",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2142691"
}
],
"reference": [
{
"type": "PubMed",
"id": "8576264",
"url": "https://glygen.org/publication/PubMed/8576264"
}
]
},
{
"title": "Essential role of Stat6 in IL-4 signalling.",
"journal": "Nature",
"date": "1996",
"authors": "Takeda K, Tanaka T, Shi W, Matsumoto M, Minami M, Kashiwamura S, Nakanishi K, Yoshida N, Kishimoto T, Akira S",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "8602263",
"url": "https://glygen.org/publication/PubMed/8602263"
}
]
},
{
"title": "The suppression of 5-lipoxygenation of arachidonic acid in human polymorphonuclear leucocytes by the 15-lipoxygenase product (15S)-hydroxy-(5Z,8Z,11Z,13E)-eicosatetraenoic acid: structure-activity relationship and mechanism of action.",
"journal": "The Biochemical journal",
"date": "1996-03-15",
"authors": "Petrich K, Ludwig P, K\u00fchn H, Schewe T",
"evidence": [
{
"database": "UniProtKB",
"id": "P09917",
"url": "https://www.uniprot.org/uniprot/P09917"
}
],
"reference": [
{
"type": "PubMed",
"id": "8615788",
"url": "https://glygen.org/publication/PubMed/8615788"
}
]
},
{
"title": "STAT3 participates in transcriptional activation of the C-reactive protein gene by interleukin-6.",
"journal": "The Journal of biological chemistry",
"date": "1996",
"authors": "Zhang D, Sun M, Samols D, Kushner I",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "8621622",
"url": "https://glygen.org/publication/PubMed/8621622"
}
]
},
{
"title": "Oxidative inactivation of human 5-lipoxygenase in phosphatidylcholine vesicles.",
"journal": "European journal of biochemistry",
"date": "1996-01-15",
"authors": "De Carolis E, Denis D, Riendeau D",
"evidence": [
{
"database": "UniProtKB",
"id": "P09917",
"url": "https://www.uniprot.org/uniprot/P09917"
}
],
"reference": [
{
"type": "PubMed",
"id": "8631361",
"url": "https://glygen.org/publication/PubMed/8631361"
}
]
},
{
"title": "Cloning and characterization of a specific interleukin (IL)-13 binding protein structurally related to the IL-5 receptor alpha chain.",
"journal": "The Journal of biological chemistry",
"date": "1996",
"authors": "Caput D, Laurent P, Kaghad M, Lelias JM, Lefort S, Vita N, Ferrara P",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "8663118",
"url": "https://glygen.org/publication/PubMed/8663118"
}
]
},
{
"title": "The lipopolysaccharide-binding protein is a secretory class 1 acute-phase protein whose gene is transcriptionally activated by APRF/STAT/3 and other cytokine-inducible nuclear proteins.",
"journal": "Molecular and cellular biology",
"date": "1996",
"authors": "Schumann RR, Kirschning CJ, Unbehaun A, Aberle HP, Knope HP, Lamping N, Ulevitch RJ, Herrmann F",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "8668165",
"url": "https://glygen.org/publication/PubMed/8668165"
}
]
},
{
"title": "Targeting of proteins to granule subsets is determined by timing and not by sorting: The specific granule protein NGAL is localized to azurophil granules when expressed in HL-60 cells.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "1996",
"authors": "Le Cabec V, Cowland JB, Calafat J, Borregaard N",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6798695",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6798695"
}
],
"reference": [
{
"type": "PubMed",
"id": "8692836",
"url": "https://glygen.org/publication/PubMed/8692836"
}
]
},
{
"title": "Global and local determinants for the kinetics of interleukin-4/interleukin-4 receptor alpha chain interaction. A biosensor study employing recombinant interleukin-4-binding protein.",
"journal": "European journal of biochemistry",
"date": "1996",
"authors": "Shen BJ, Hage T, Sebald W",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "8797861",
"url": "https://glygen.org/publication/PubMed/8797861"
}
]
},
{
"title": "Requirements for interleukin-4-induced gene expression and functional characterization of Stat6.",
"journal": "Molecular and cellular biology",
"date": "1996",
"authors": "Mikita T, Campbell D, Wu P, Williamson K, Schindler U",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "8816495",
"url": "https://glygen.org/publication/PubMed/8816495"
}
]
},
{
"title": "Formation of a 5-oxo metabolite of 5,8,11,14,17-eicosapentaenoic acid and its effects on human neutrophils and eosinophils.",
"journal": "Journal of lipid research",
"date": "1995",
"authors": "Powell WS, Gravel S, Gravelle F",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9027604",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9027604"
}
],
"reference": [
{
"type": "PubMed",
"id": "8847485",
"url": "https://glygen.org/publication/PubMed/8847485"
}
]
},
{
"title": "Cloning of the human IL-13R alpha1 chain and reconstitution with the IL4R alpha of a functional IL-4/IL-13 receptor complex.",
"journal": "FEBS letters",
"date": "1997",
"authors": "Miloux B, Laurent P, Bonnin O, Lupker J, Caput D, Vita N, Ferrara P",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "9013879",
"url": "https://glygen.org/publication/PubMed/9013879"
}
]
},
{
"title": "Purification and characterization of the human interleukin-18 receptor.",
"journal": "The Journal of biological chemistry",
"date": "1997",
"authors": "Torigoe K, Ushio S, Okura T, Kobayashi S, Taniai M, Kunikata T, Murakami T, Sanou O, Kojima H, Fujii M, Ohta T, Ikeda M, Ikegami H, Kurimoto M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9012546",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9012546"
}
],
"reference": [
{
"type": "PubMed",
"id": "9325300",
"url": "https://glygen.org/publication/PubMed/9325300"
}
]
},
{
"title": "Purification, cDNA cloning and expression of 15-oxoprostaglandin 13-reductase from pig lung.",
"journal": "The Biochemical journal",
"date": "1998",
"authors": "Ensor CM, Zhang H, Tai HH",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2142691",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2142691"
}
],
"reference": [
{
"type": "PubMed",
"id": "9461497",
"url": "https://glygen.org/publication/PubMed/9461497"
}
]
},
{
"title": "Mutational analysis of the STAT6 SH2 domain.",
"journal": "The Journal of biological chemistry",
"date": "1998",
"authors": "Mikita T, Daniel C, Wu P, Schindler U",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "9651359",
"url": "https://glygen.org/publication/PubMed/9651359"
}
]
},
{
"title": "The role of IL-13 and its receptor in allergy and inflammatory responses.",
"journal": "The Journal of allergy and clinical immunology",
"date": "1998",
"authors": "de Vries JE",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "9723655",
"url": "https://glygen.org/publication/PubMed/9723655"
}
]
},
{
"title": "Interferon-gamma-induced factor binding to the interleukin-4-responsive element of CD23b promoter in human tonsillar mononuclear cells: role in transient up-regulation of the interleukin-4-induced CD23b mRNA.",
"journal": "Molecular immunology",
"date": "1998",
"authors": "Park HJ, So EY, Lee CE",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "9736340",
"url": "https://glygen.org/publication/PubMed/9736340"
}
]
},
{
"title": "Cloning of a novel receptor subunit, AcPL, required for interleukin-18 signaling.",
"journal": "The Journal of biological chemistry",
"date": "1998",
"authors": "Born TL, Thomassen E, Bird TA, Sims JE",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9012546",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9012546"
}
],
"reference": [
{
"type": "PubMed",
"id": "9792649",
"url": "https://glygen.org/publication/PubMed/9792649"
}
]
},
{
"title": "Induction of 15-lipoxygenase expression by IL-13 requires tyrosine phosphorylation of Jak2 and Tyk2 in human monocytes.",
"journal": "The Journal of biological chemistry",
"date": "1998",
"authors": "Roy B, Cathcart MK",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "9822675",
"url": "https://glygen.org/publication/PubMed/9822675"
}
]
},
{
"title": "STAT3 is required for the gp130-mediated full activation of the c-myc gene.",
"journal": "The Journal of experimental medicine",
"date": "1999",
"authors": "Kiuchi N, Nakajima K, Ichiba M, Fukada T, Narimatsu M, Mizuno K, Hibi M, Hirano T",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "9874564",
"url": "https://glygen.org/publication/PubMed/9874564"
}
]
}
],
"pathway": [
{
"id": "hsa:240",
"name": "",
"url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:240",
"resource": "KEGG Pathway"
},
{
"id": "R-HSA-2142688",
"name": "Synthesis of 5-eicosatetraenoic acids",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2142688",
"resource": "Reactome",
"description": "Synthesis of 5-eicosatetraenoic acids"
},
{
"id": "R-HSA-2142691",
"name": "Synthesis of Leukotrienes (LT) and Eoxins (EX)",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2142691",
"resource": "Reactome",
"description": "Synthesis of Leukotrienes (LT) and Eoxins (EX)"
},
{
"id": "R-HSA-2142700",
"name": "Synthesis of Lipoxins (LX)",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2142700",
"resource": "Reactome",
"description": "Synthesis of Lipoxins (LX)"
},
{
"id": "R-HSA-6785807",
"name": "Interleukin-4 and Interleukin-13 signaling",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807",
"resource": "Reactome",
"description": "Interleukin-4 and Interleukin-13 signaling"
},
{
"id": "R-HSA-6798695",
"name": "Neutrophil degranulation",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6798695",
"resource": "Reactome",
"description": "Neutrophil degranulation"
},
{
"id": "R-HSA-9012546",
"name": "Interleukin-18 signaling",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9012546",
"resource": "Reactome",
"description": "Interleukin-18 signaling"
},
{
"id": "R-HSA-9018676",
"name": "Biosynthesis of D-series resolvins",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018676",
"resource": "Reactome",
"description": "Biosynthesis of D-series resolvins"
},
{
"id": "R-HSA-9018682",
"name": "Biosynthesis of maresins",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018682",
"resource": "Reactome",
"description": "Biosynthesis of maresins"
},
{
"id": "R-HSA-9018896",
"name": "Biosynthesis of E-series 18(S)-resolvins",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018896",
"resource": "Reactome",
"description": "Biosynthesis of E-series 18(S)-resolvins"
},
{
"id": "R-HSA-9020265",
"name": "Biosynthesis of aspirin-triggered D-series resolvins",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9020265",
"resource": "Reactome",
"description": "Biosynthesis of aspirin-triggered D-series resolvins"
},
{
"id": "R-HSA-9023661",
"name": "Biosynthesis of E-series 18(R)-resolvins",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9023661",
"resource": "Reactome",
"description": "Biosynthesis of E-series 18(R)-resolvins"
},
{
"id": "R-HSA-9026286",
"name": "Biosynthesis of DPAn-3-derived protectins and resolvins",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9026286",
"resource": "Reactome",
"description": "Biosynthesis of DPAn-3-derived protectins and resolvins"
},
{
"id": "R-HSA-9026290",
"name": "Biosynthesis of DPAn-3-derived maresins",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9026290",
"resource": "Reactome",
"description": "Biosynthesis of DPAn-3-derived maresins"
},
{
"id": "R-HSA-9026403",
"name": "Biosynthesis of DPAn-3-derived 13-series resolvins",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9026403",
"resource": "Reactome",
"description": "Biosynthesis of DPAn-3-derived 13-series resolvins"
},
{
"id": "R-HSA-9027604",
"name": "Biosynthesis of electrophilic -3 PUFA oxo-derivatives",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9027604",
"resource": "Reactome",
"description": "Biosynthesis of electrophilic \u03c9-3 PUFA oxo-derivatives"
}
],
"orthologs": [
{
"uniprot_canonical_ac": "P12527-1",
"protein_name": "Polyunsaturated fatty acid 5-lipoxygenase",
"gene_name": "Alox5",
"tax_id": 10116,
"organism": "Rattus norvegicus",
"sequence": {
"sequence": "MPSYTVTVATGSQWFAGTDDYIYLSLIGSAGCSEKHLLDKAFYNDFERGGRDSYDVTVDEELGEIYLVKIEKRKYRLHDDWYLKYITLKTPHDYIEFPCYRWITGEGEIVLRDGCAKLARDDQIHILKQHRRKELETRQKQYRWMEWNPGFPLSIDAKCHKDLPRDIQFDSEKGVDFVLNYSKAMENLFINRFMHMFQSSWHDFADFEKIFVKISNTISERVKNHWQEDLMFGYQFLNGCNPVLIKRCTELPKKLPVTTEMVECSLERQLSLEQEVQEGNIFIVDYELLDGIDANKTDPCTHQFLAAPICLLYKNLANKIVPIAIQLNQTPGEKNPIFLPTDSKYDWLLAKIWVRSSDFHIHQTITHLLRTHLVSEVFGIAMYRQLPAVHPLFKLLVAHVRFTIAINTKAREQLNCEYGLFDKANATGGGGHVQMVQRAVQDLTYSSLCFPEAIKARGMDNTEDIPYYFYRDDGLLVWEAIQSFTTEVVSIYYEDDQVVEEDQELQDFVKDVYVYGMRGRKASGFPKSIKSREKLSEYLTVVIFTASAQHAAVNFGQYDWCSWIPNAPPTMRAPPPTAKGVVTIEQIVDTLPDRGRSCWHLGAVWALSQFQENELFLGMYPEEHFIEKPVKEAMIRFRKNLEAIVSVIAERNKNKKLPYYYLSPDRIPNSVAI",
"length": 673
},
"evidence": [
{
"id": "45929381",
"url": "http://www.informatics.jax.org/homology/45929381",
"database": "MGI"
}
],
"common_name": "Rat"
},
{
"uniprot_canonical_ac": "P48999-1",
"protein_name": "Polyunsaturated fatty acid 5-lipoxygenase",
"gene_name": "Alox5",
"tax_id": 10090,
"organism": "Mus musculus",
"sequence": {
"sequence": "MPSYTVTVATGSQWFAGTDDYIYLSLIGSAGCSEKHLLDKAFYNDFERGAVDSYDVTVDEELGEIYLVKIEKRKYWLHDDWYLKYITLKTPHGDYIEFPCYRWITGEGEIVLRDGRAKLARDDQIHILKQHRRKELEARQKQYRWMEWNPGFPLSIDAKCHKDLPRDIQFDSEKGVDFVLNYSKAMENLFINRFMHMFQSSWHDFADFEKIFVKISNTISERVKNHWQEDLMFGYQFLNGCNPVLIKRCTALPPKLPVTTEMVECSLERQLSLEQEVQEGNIFIVDYELLDGIDANKTDPCTHQFLAAPICLLYKNLANKIVPIAIQLNQTPGESNPIFLPTDSKYDWLLAKIWVRSSDFHVHQTITHLLRTHLVSEVFGIAMYRQLPAVHPLFKLLVAHVRFTIAINTKAREQLICEYGLFDKANATGGGGHVQMVQRAVQDLTYSSLCFPEAIKARGMDSTEDIPFYFYRDDGLLVWEAIQSFTMEVVSIYYENDQVVEEDQELQDFVKDVYVYGMRGKKASGFPKSIKSREKLSEYLTVVIFTASAQHAAVNFGQYDWCSWIPNAPPTMRAPPPTAKGVVTIEQIVDTLPDRGRSCWHLGAVWALSQFQENELFLGMYPEEHFIEKPVKEAMIRFRKNLEAIVSVIAERNKNKKLPYYYLSPDRIPNSVAI",
"length": 674
},
"evidence": [
{
"id": "45929381",
"url": "http://www.informatics.jax.org/homology/45929381",
"database": "MGI"
},
{
"id": "P09917",
"url": "https://omabrowser.org/oma/group/P09917/",
"database": "OMA"
}
],
"common_name": "Mouse"
}
],
"go_annotation": {
"categories": [
{
"name": "Molecular Function",
"total": 6,
"go_terms": [
{
"name": "iron ion binding",
"id": "GO:0005506",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005506",
"evidence": [
{
"database": "UniProtKB",
"id": "P09917",
"url": "https://www.uniprot.org/uniprot/P09917"
}
],
"pmid": ""
},
{
"name": "oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen",
"id": "GO:0016702",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016702",
"evidence": [
{
"database": "UniProtKB",
"id": "P09917",
"url": "https://www.uniprot.org/uniprot/P09917"
}
],
"pmid": ""
},
{
"name": "hydrolase activity",
"id": "GO:0016787",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016787",
"evidence": [
{
"database": "UniProtKB",
"id": "P09917",
"url": "https://www.uniprot.org/uniprot/P09917"
}
],
"pmid": ""
},
{
"name": "arachidonate 12(S)-lipoxygenase activity",
"id": "GO:0004052",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004052",
"evidence": [
{
"database": "UniProtKB",
"id": "P09917",
"url": "https://www.uniprot.org/uniprot/P09917"
}
],
"pmid": ""
},
{
"name": "arachidonate 8(S)-lipoxygenase activity",
"id": "GO:0036403",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0036403",
"evidence": [
{
"database": "UniProtKB",
"id": "P09917",
"url": "https://www.uniprot.org/uniprot/P09917"
}
],
"pmid": ""
},
{
"name": "arachidonate 5-lipoxygenase activity",
"id": "GO:0004051",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004051",
"evidence": [
{
"database": "UniProtKB",
"id": "P09917",
"url": "https://www.uniprot.org/uniprot/P09917"
}
],
"pmid": ""
}
]
},
{
"name": "Biological Process",
"total": 32,
"go_terms": [
{
"name": "lipid oxidation",
"id": "GO:0034440",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034440",
"evidence": [
{
"database": "UniProtKB",
"id": "P09917",
"url": "https://www.uniprot.org/uniprot/P09917"
}
],
"pmid": ""
},
{
"name": "negative regulation of vascular wound healing",
"id": "GO:0061044",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0061044",
"evidence": [
{
"database": "UniProtKB",
"id": "P09917",
"url": "https://www.uniprot.org/uniprot/P09917"
}
],
"pmid": ""
},
{
"name": "lipoxin biosynthetic process",
"id": "GO:2001301",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:2001301",
"evidence": [
{
"database": "UniProtKB",
"id": "P09917",
"url": "https://www.uniprot.org/uniprot/P09917"
}
],
"pmid": ""
},
{
"name": "linoleic acid metabolic process",
"id": "GO:0043651",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043651",
"evidence": [
{
"database": "UniProtKB",
"id": "P09917",
"url": "https://www.uniprot.org/uniprot/P09917"
}
],
"pmid": ""
},
{
"name": "negative regulation of inflammatory response",
"id": "GO:0050728",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050728",
"evidence": [
{
"database": "UniProtKB",
"id": "P09917",
"url": "https://www.uniprot.org/uniprot/P09917"
}
],
"pmid": ""
},
{
"name": "leukocyte migration involved in inflammatory response",
"id": "GO:0002523",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002523",
"evidence": [
{
"database": "UniProtKB",
"id": "P09917",
"url": "https://www.uniprot.org/uniprot/P09917"
}
],
"pmid": ""
},
{
"name": "glucose homeostasis",
"id": "GO:0042593",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042593",
"evidence": [
{
"database": "UniProtKB",
"id": "P09917",
"url": "https://www.uniprot.org/uniprot/P09917"
}
],
"pmid": ""
},
{
"name": "regulation of insulin secretion",
"id": "GO:0050796",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050796",
"evidence": [
{
"database": "UniProtKB",
"id": "P09917",
"url": "https://www.uniprot.org/uniprot/P09917"
}
],
"pmid": ""
},
{
"name": "negative regulation of endothelial cell proliferation",
"id": "GO:0001937",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001937",
"evidence": [
{
"database": "UniProtKB",
"id": "P09917",
"url": "https://www.uniprot.org/uniprot/P09917"
}
],
"pmid": ""
},
{
"name": "regulation of inflammatory response",
"id": "GO:0050727",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050727",
"evidence": [
{
"database": "UniProtKB",
"id": "P09917",
"url": "https://www.uniprot.org/uniprot/P09917"
}
],
"pmid": ""
},
{
"name": "negative regulation of angiogenesis",
"id": "GO:0016525",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016525",
"evidence": [
{
"database": "UniProtKB",
"id": "P09917",
"url": "https://www.uniprot.org/uniprot/P09917"
}
],
"pmid": ""
},
{
"name": "positive regulation of bone mineralization",
"id": "GO:0030501",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030501",
"evidence": [
{
"database": "UniProtKB",
"id": "P09917",
"url": "https://www.uniprot.org/uniprot/P09917"
}
],
"pmid": ""
},
{
"name": "negative regulation of wound healing",
"id": "GO:0061045",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0061045",
"evidence": [
{
"database": "UniProtKB",
"id": "P09917",
"url": "https://www.uniprot.org/uniprot/P09917"
}
],
"pmid": ""
},
{
"name": "leukotriene metabolic process",
"id": "GO:0006691",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006691",
"evidence": [
{
"database": "UniProtKB",
"id": "P09917",
"url": "https://www.uniprot.org/uniprot/P09917"
}
],
"pmid": ""
},
{
"name": "leukotriene biosynthetic process",
"id": "GO:0019370",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019370",
"evidence": [
{
"database": "UniProtKB",
"id": "P09917",
"url": "https://www.uniprot.org/uniprot/P09917"
}
],
"pmid": ""
},
{
"name": "lipoxygenase pathway",
"id": "GO:0019372",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019372",
"evidence": [
{
"database": "UniProtKB",
"id": "P09917",
"url": "https://www.uniprot.org/uniprot/P09917"
}
],
"pmid": ""
},
{
"name": "humoral immune response",
"id": "GO:0006959",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006959",
"evidence": [
{
"database": "UniProtKB",
"id": "P09917",
"url": "https://www.uniprot.org/uniprot/P09917"
}
],
"pmid": ""
},
{
"name": "regulation of reactive oxygen species biosynthetic process",
"id": "GO:1903426",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:1903426",
"evidence": [
{
"database": "UniProtKB",
"id": "P09917",
"url": "https://www.uniprot.org/uniprot/P09917"
}
],
"pmid": ""
},
{
"name": "regulation of cellular response to oxidative stress",
"id": "GO:1900407",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:1900407",
"evidence": [
{
"database": "UniProtKB",
"id": "P09917",
"url": "https://www.uniprot.org/uniprot/P09917"
}
],
"pmid": ""
},
{
"name": "long-chain fatty acid biosynthetic process",
"id": "GO:0042759",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042759",
"evidence": [
{
"database": "UniProtKB",
"id": "P09917",
"url": "https://www.uniprot.org/uniprot/P09917"
}
],
"pmid": ""
},
{
"name": "arachidonic acid metabolic process",
"id": "GO:0019369",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019369",
"evidence": [
{
"database": "UniProtKB",
"id": "P09917",
"url": "https://www.uniprot.org/uniprot/P09917"
}
],
"pmid": ""
},
{
"name": "regulation of fat cell differentiation",
"id": "GO:0045598",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045598",
"evidence": [
{
"database": "UniProtKB",
"id": "P09917",
"url": "https://www.uniprot.org/uniprot/P09917"
}
],
"pmid": ""
},
{
"name": "regulation of cytokine production involved in inflammatory response",
"id": "GO:1900015",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:1900015",
"evidence": [
{
"database": "UniProtKB",
"id": "P09917",
"url": "https://www.uniprot.org/uniprot/P09917"
}
],
"pmid": ""
},
{
"name": "dendritic cell migration",
"id": "GO:0036336",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0036336",
"evidence": [
{
"database": "UniProtKB",
"id": "P09917",
"url": "https://www.uniprot.org/uniprot/P09917"
}
],
"pmid": ""
},
{
"name": "hepoxilin biosynthetic process",
"id": "GO:0051122",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051122",
"evidence": [
{
"database": "UniProtKB",
"id": "P09917",
"url": "https://www.uniprot.org/uniprot/P09917"
}
],
"pmid": ""
},
{
"name": "leukotriene production involved in inflammatory response",
"id": "GO:0002540",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002540",
"evidence": [
{
"database": "UniProtKB",
"id": "P09917",
"url": "https://www.uniprot.org/uniprot/P09917"
}
],
"pmid": ""
},
{
"name": "negative regulation of response to endoplasmic reticulum stress",
"id": "GO:1903573",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:1903573",
"evidence": [
{
"database": "UniProtKB",
"id": "P09917",
"url": "https://www.uniprot.org/uniprot/P09917"
}
],
"pmid": ""
},
{
"name": "leukocyte chemotaxis involved in inflammatory response",
"id": "GO:0002232",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002232",
"evidence": [
{
"database": "UniProtKB",
"id": "P09917",
"url": "https://www.uniprot.org/uniprot/P09917"
}
],
"pmid": ""
},
{
"name": "negative regulation of sprouting angiogenesis",
"id": "GO:1903671",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:1903671",
"evidence": [
{
"database": "UniProtKB",
"id": "P09917",
"url": "https://www.uniprot.org/uniprot/P09917"
}
],
"pmid": ""
},
{
"name": "positive regulation of leukocyte adhesion to arterial endothelial cell",
"id": "GO:1904999",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:1904999",
"evidence": [
{
"database": "UniProtKB",
"id": "P09917",
"url": "https://www.uniprot.org/uniprot/P09917"
}
],
"pmid": ""
},
{
"name": "regulation of inflammatory response to wounding",
"id": "GO:0106014",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0106014",
"evidence": [
{
"database": "UniProtKB",
"id": "P09917",
"url": "https://www.uniprot.org/uniprot/P09917"
}
],
"pmid": ""
},
{
"name": "leukotriene A4 biosynthetic process",
"id": "GO:1901753",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:1901753",
"evidence": [
{
"database": "UniProtKB",
"id": "P09917",
"url": "https://www.uniprot.org/uniprot/P09917"
}
],
"pmid": ""
}
]
},
{
"name": "Cellular Component",
"total": 11,
"go_terms": [
{
"name": "extracellular region",
"id": "GO:0005576",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576",
"evidence": [
{
"database": "UniProtKB",
"id": "P09917",
"url": "https://www.uniprot.org/uniprot/P09917"
}
],
"pmid": ""
},
{
"name": "extracellular space",
"id": "GO:0005615",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005615",
"evidence": [
{
"database": "UniProtKB",
"id": "P09917",
"url": "https://www.uniprot.org/uniprot/P09917"
}
],
"pmid": ""
},
{
"name": "nuclear envelope",
"id": "GO:0005635",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005635",
"evidence": [
{
"database": "UniProtKB",
"id": "P09917",
"url": "https://www.uniprot.org/uniprot/P09917"
}
],
"pmid": ""
},
{
"name": "nuclear envelope lumen",
"id": "GO:0005641",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005641",
"evidence": [
{
"database": "UniProtKB",
"id": "P09917",
"url": "https://www.uniprot.org/uniprot/P09917"
}
],
"pmid": ""
},
{
"name": "nucleoplasm",
"id": "GO:0005654",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654",
"evidence": [
{
"database": "UniProtKB",
"id": "P09917",
"url": "https://www.uniprot.org/uniprot/P09917"
}
],
"pmid": ""
},
{
"name": "cytosol",
"id": "GO:0005829",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829",
"evidence": [
{
"database": "UniProtKB",
"id": "P09917",
"url": "https://www.uniprot.org/uniprot/P09917"
}
],
"pmid": ""
},
{
"name": "nuclear membrane",
"id": "GO:0031965",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031965",
"evidence": [
{
"database": "UniProtKB",
"id": "P09917",
"url": "https://www.uniprot.org/uniprot/P09917"
}
],
"pmid": ""
},
{
"name": "secretory granule lumen",
"id": "GO:0034774",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034774",
"evidence": [
{
"database": "UniProtKB",
"id": "P09917",
"url": "https://www.uniprot.org/uniprot/P09917"
}
],
"pmid": ""
},
{
"name": "perinuclear region of cytoplasm",
"id": "GO:0048471",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048471",
"evidence": [
{
"database": "UniProtKB",
"id": "P09917",
"url": "https://www.uniprot.org/uniprot/P09917"
}
],
"pmid": ""
},
{
"name": "ficolin-1-rich granule lumen",
"id": "GO:1904813",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:1904813",
"evidence": [
{
"database": "UniProtKB",
"id": "P09917",
"url": "https://www.uniprot.org/uniprot/P09917"
}
],
"pmid": ""
},
{
"name": "nuclear matrix",
"id": "GO:0016363",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016363",
"evidence": [
{
"database": "UniProtKB",
"id": "P09917",
"url": "https://www.uniprot.org/uniprot/P09917"
}
],
"pmid": ""
}
]
}
]
},
"pro_annotation": [],
"site_annotation": [
{
"start_pos": 181,
"end_pos": 183,
"annotation": "n_glycosylation_sequon"
},
{
"start_pos": 296,
"end_pos": 298,
"annotation": "n_glycosylation_sequon"
},
{
"start_pos": 426,
"end_pos": 428,
"annotation": "n_glycosylation_sequon"
}
],
"ptm_annotation": [
{
"annotation": "Serine phosphorylation by MAPKAPK2 is stimulated by arachidonic acid (PubMed:11844797, PubMed:18978352). Phosphorylation on Ser-524 by PKA has an inhibitory effect (PubMed:15280375). Phosphorylation on Ser-272 prevents export from the nucleus (PubMed:11844797, PubMed:18978352). Phosphorylation at Ser-524 is stimulated by 8-bromo-3',5'-cyclic AMP or prostaglandin E2 (PubMed:26210919).",
"evidence": [
{
"database": "UniProtKB",
"id": "P09917",
"url": "https://www.uniprot.org/uniprot/P09917"
},
{
"database": "PubMed",
"id": "26210919",
"url": "https://glygen.org/publication/PubMed/26210919"
},
{
"database": "PubMed",
"id": "15280375",
"url": "https://glygen.org/publication/PubMed/15280375"
},
{
"database": "PubMed",
"id": "18978352",
"url": "https://glygen.org/publication/PubMed/18978352"
},
{
"database": "PubMed",
"id": "11844797",
"url": "https://glygen.org/publication/PubMed/11844797"
}
]
}
],
"interactions": [],
"reactions": [
{
"id": "10428",
"name": "",
"equation": "(5Z,8Z,11Z,14Z)-eicosatetraenoate + O2 = (12S)-hydroperoxy-(5Z,8Z,10E,14Z)-eicosatetraenoate",
"summary": "",
"cellular_location": "",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"Q02759-1",
"F1LQ70-1",
"D3ZQF9-1",
"P12527-1",
"P18054-1",
"P16050-1",
"P09917-1",
"P55249-1",
"P39655-1",
"P39654-1",
"P48999-1"
],
"evidence": [
{
"id": "10428",
"database": "Rhea",
"url": "https://www.rhea-db.org/rhea/10428"
}
]
},
{
"id": "17485",
"name": "",
"equation": "(5Z,8Z,11Z,14Z)-eicosatetraenoate + O2 = (5S)-hydroperoxy-(6E,8Z,11Z,14Z)-eicosatetraenoate",
"summary": "",
"cellular_location": "",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P12527-1",
"P09917-1",
"P48999-1"
],
"evidence": [
{
"id": "17485",
"database": "Rhea",
"url": "https://www.rhea-db.org/rhea/17485"
}
]
},
{
"id": "17961",
"name": "",
"equation": "(5S)-hydroperoxy-(6E,8Z,11Z,14Z)-eicosatetraenoate = H2O + leukotriene A4",
"summary": "",
"cellular_location": "",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P12527-1",
"P09917-1",
"P48999-1"
],
"evidence": [
{
"id": "17961",
"database": "Rhea",
"url": "https://www.rhea-db.org/rhea/17961"
}
]
},
{
"id": "32307",
"name": "",
"equation": "(5Z,8Z,11Z,14Z)-eicosatetraenoate + O2 = H2O + leukotriene A4",
"summary": "",
"cellular_location": "",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P12527-1",
"P09917-1",
"P48999-1"
],
"evidence": [
{
"id": "32307",
"database": "Rhea",
"url": "https://www.rhea-db.org/rhea/32307"
}
]
},
{
"id": "38675",
"name": "",
"equation": "(5Z,8Z,11Z,14Z)-eicosatetraenoate + O2 = (8S)-hydroperoxy-(5Z,9E,11Z,14Z)-eicosatetraenoate",
"summary": "",
"cellular_location": "",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P12527-1",
"P09917-1",
"O35936-1",
"P48999-1"
],
"evidence": [
{
"id": "38675",
"database": "Rhea",
"url": "https://www.rhea-db.org/rhea/38675"
}
]
},
{
"id": "39107",
"name": "",
"equation": "(5S)-hydroperoxy-(18S)-hydroxy-(6E,8Z,11Z,14Z,16E)-eicosapentaenoate = (5S,6S)-epoxy-(18S)-hydroxy-(7E,9E,11Z,14Z,16E)-eicosapentaenoate + H2O",
"summary": "",
"cellular_location": "",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P12527-1",
"P09917-1",
"P48999-1"
],
"evidence": [
{
"id": "39107",
"database": "Rhea",
"url": "https://www.rhea-db.org/rhea/39107"
}
]
},
{
"id": "41332",
"name": "",
"equation": "(4Z,7Z,10Z,13Z,16Z,19Z)-docosahexaenoate + O2 = (14S)-hydroperoxy-(4Z,7Z,10Z,12E,16Z,19Z)-docosahexaenoate",
"summary": "",
"cellular_location": "",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"F1LQ70-1",
"Q02759-1",
"P12527-1",
"D3ZQF9-1",
"P18054-1",
"P16050-1",
"P09917-1",
"P39655-1",
"P55249-1",
"P39654-1",
"P48999-1"
],
"evidence": [
{
"id": "41332",
"database": "Rhea",
"url": "https://www.rhea-db.org/rhea/41332"
}
]
},
{
"id": "48624",
"name": "",
"equation": "(15S)-hydroxy-(5Z,8Z,11Z,13E)-eicosatetraenoate + O2 = (5S)-hydroperoxy-(15S)-hydroxy-(6E,8Z,11Z,13E)-eicosatetraenoate",
"summary": "",
"cellular_location": "",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P12527-1",
"P09917-1",
"P48999-1"
],
"evidence": [
{
"id": "48624",
"database": "Rhea",
"url": "https://www.rhea-db.org/rhea/48624"
}
]
},
{
"id": "48860",
"name": "",
"equation": "18-HEPE + O2 = (5S)-hydroperoxy-18-hydroxy-(7E,9E,11Z,14Z,16E)-eicosapentaenoate",
"summary": "",
"cellular_location": "",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P12527-1",
"P09917-1",
"P48999-1"
],
"evidence": [
{
"id": "48860",
"database": "Rhea",
"url": "https://www.rhea-db.org/rhea/48860"
}
]
},
{
"id": "50204",
"name": "",
"equation": "(18S)-hydroxy-(5Z,8Z,11Z,14Z,16E)-eicosapentaenoate + O2 = (5S)-hydroperoxy-(18S)-hydroxy-(6E,8Z,11Z,14Z,16E)-eicosapentaenoate",
"summary": "",
"cellular_location": "",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P12527-1",
"P09917-1",
"P48999-1"
],
"evidence": [
{
"id": "50204",
"database": "Rhea",
"url": "https://www.rhea-db.org/rhea/50204"
}
]
},
{
"id": "50268",
"name": "",
"equation": "(5S)-hydroperoxy-(18R)-hydroxy-(6E,8Z,11Z,14Z,16E)-eicosapentaenoate = (5S,6S)-epoxy-(18R)-hydroxy-(7E,9E,11Z,14Z,16E)-eicosapentaenoate + H2O",
"summary": "",
"cellular_location": "",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P12527-1",
"P09917-1",
"P48999-1"
],
"evidence": [
{
"id": "50268",
"database": "Rhea",
"url": "https://www.rhea-db.org/rhea/50268"
}
]
},
{
"id": "50840",
"name": "",
"equation": "(4Z,7Z,10Z,13Z,16Z,19Z)-docosahexaenoate + O2 = (17S)-hydroperoxy-(4Z,7Z,10Z,13Z,15E,19Z)-docosahexaenoate",
"summary": "",
"cellular_location": "",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"Q02759-1",
"P12527-1",
"P16050-1",
"P09917-1",
"P39654-1",
"P48999-1"
],
"evidence": [
{
"id": "50840",
"database": "Rhea",
"url": "https://www.rhea-db.org/rhea/50840"
}
]
},
{
"id": "50844",
"name": "",
"equation": "(5S)-hydroperoxy-18-hydroxy-(7E,9E,11Z,14Z,16E)-eicosapentaenoate = (5S,6S)-epoxy-18-hydroxy-(7E,9E,11Z,14Z,16E)-eicosapentaenoate + H2O",
"summary": "",
"cellular_location": "",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P12527-1",
"P09917-1",
"P48999-1"
],
"evidence": [
{
"id": "50844",
"database": "Rhea",
"url": "https://www.rhea-db.org/rhea/50844"
}
]
},
{
"id": "51968",
"name": "",
"equation": "(18R)-hydroxy-(5Z,8Z,11Z,14Z,16E)-eicosapentaenoate + O2 = (5S)-hydroperoxy-(18R)-hydroxy-(6E,8Z,11Z,14Z,16E)-eicosapentaenoate",
"summary": "",
"cellular_location": "",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P12527-1",
"P09917-1",
"P48999-1"
],
"evidence": [
{
"id": "51968",
"database": "Rhea",
"url": "https://www.rhea-db.org/rhea/51968"
}
]
},
{
"id": "62600",
"name": "",
"equation": "(5Z,8Z,11Z,14Z,17Z)-eicosapentaenoate + O2 = 5-hydroperoxy-(6E,8Z,11Z,14Z,17Z)-eicosapentaenoate",
"summary": "",
"cellular_location": "",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P12527-1",
"P09917-1",
"P48999-1"
],
"evidence": [
{
"id": "62600",
"database": "Rhea",
"url": "https://www.rhea-db.org/rhea/62600"
}
]
},
{
"id": "62644",
"name": "",
"equation": "(5Z,8Z)-eicosadienoate + O2 = (5S)-hydroperoxy-(6E,8Z)-eicosadienoate",
"summary": "",
"cellular_location": "",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P12527-1",
"P09917-1",
"P48999-1"
],
"evidence": [
{
"id": "62644",
"database": "Rhea",
"url": "https://www.rhea-db.org/rhea/62644"
}
]
},
{
"id": "62648",
"name": "",
"equation": "(12S)-hydroxy-(5Z,8Z,10E,14Z)-eicosatetraenoate + O2 = (5S)-hydroperoxy-(12S)-hydroxy-(6E,8Z,10E,14Z)-eicosatetraenoate",
"summary": "",
"cellular_location": "",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P12527-1",
"P09917-1",
"P48999-1"
],
"evidence": [
{
"id": "62648",
"database": "Rhea",
"url": "https://www.rhea-db.org/rhea/62648"
}
]
},
{
"id": "64668",
"name": "",
"equation": "(4Z,7Z,10Z,13Z,16Z,19Z)-docosahexaenoate + O2 = (7S)-hydroperoxy-(4Z,8E,10Z,13Z,16Z,19Z)-docosahexaenoate",
"summary": "",
"cellular_location": "",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P12527-1",
"P09917-1",
"P48999-1"
],
"evidence": [
{
"id": "64668",
"database": "Rhea",
"url": "https://www.rhea-db.org/rhea/64668"
}
]
},
{
"id": "R-HSA-2161768",
"name": "EXA4 is converted to EXC4 by LTC4S",
"equation": "",
"summary": "In addition to its role converting leukotriene A4 (LTA4) into leukotriene C4 (LTC4), the enzyme leukotriene C4 synthase (LTC4S) analogously converts eoxin A4 (EXA4), with reduced glutathione (GSH), to eoxin C4 (EXC4) (Feltenmark et al. 2008, Claesson et al. 2008).",
"cellular_location": "cytosol, nuclear envelope",
"input_participant_list": [
"R-ALL-2142772"
],
"output_participant_list": [
"R-ALL-2142726"
],
"enzyme_list": [
"P09917-1",
"Q16873-1"
],
"evidence": [
{
"id": "R-HSA-2161768",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2161768"
}
]
},
{
"id": "R-HSA-2161907",
"name": "ALOX5 oxidises 15R-HETE to 15epi-LXA4/B4",
"equation": "",
"summary": "Arachidonate 5-lipoxygenase (ALOX5) converts 15R-hydro-eicosatetraenoic acid (15R-HETE) to the epi-lipoxins, 15epi-lipoxin A4 (15epi-LXA4) and 15epi-lipoxin B4 (15epi-LXB4) (Claria & Serhan 1995). These epi-lipoxins have altered configuration at the C-15 hydroxyl but similar biological potency.",
"cellular_location": "cytosol, nuclear envelope",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P09917-1",
"Q16873-1"
],
"evidence": [
{
"id": "R-HSA-2161907",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2161907"
}
]
},
{
"id": "R-HSA-2161917",
"name": "ALOX5 oxidises 15S-HpETE to LXA4/B4",
"equation": "",
"summary": "Arachidonate 5-lipoxygenase (ALOX5) (Ueda et al. 1987) converts 15S-hydroperoxy-eicosatetraenoic acid (15S-HpETE) into lipoxin A4 (LXA4) and B4 (LXB4) (Serhan et al. 1984A, Serhan et al. 1984B). One of the reaction intermediates of this process might be 5S,6S-epoxy-15S-hydroxy-7E,9E,11Z,13E-eicosatetraenoic acid (5,6-Ep-15S-HETE) (Puustinen et al. 1986). However, its generation from LTA4 is unclear but it can be hydrolysed to form the lipoxins.",
"cellular_location": "cytosol",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P09917-1",
"Q16873-1"
],
"evidence": [
{
"id": "R-HSA-2161917",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2161917"
}
]
},
{
"id": "R-HSA-265296",
"name": "Arachidonic acid is oxidised to 5S-HpETE by ALOX5",
"equation": "",
"summary": "Arachidonate 5-lipoxygenase (ALOX5) catalyzes the formation of leukotriene A4 (LTA4) from arachidonic acid in a two-step process. First, arachidonic acid AA is oxidized to form 5S-hydroperoxyeicosatetranoic acid (5S-HpETE) (Rouzer et al. 1988, Rouzer & Samuelsson 1987, Rouzer et al. 1986).",
"cellular_location": "cytosol, nuclear envelope",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P09917-1",
"Q16873-1"
],
"evidence": [
{
"id": "R-HSA-265296",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-265296"
}
]
},
{
"id": "R-HSA-266050",
"name": "LTA4 is converted to LTC4 by LTC4S",
"equation": "",
"summary": "Leukotriene A4 conjugates with reduced glutathione (GSH) to produce leukotriene C4 (LTC4). This conjugation is mediated by the homodimeric, perinuclear membrane-bound enzyme leukotriene C4 synthase (LTC4S) (Lam et al. 1994, Welsch et al. 1994). LTC4S differs from cytosolic and microsomal GSH-S-transferases by having a very narrow substrate specificity and the inability to conjugate xenobiotics.",
"cellular_location": "cytosol, nuclear envelope",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P09917-1",
"Q16873-1"
],
"evidence": [
{
"id": "R-HSA-266050",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-266050"
}
]
},
{
"id": "R-HSA-266051",
"name": "5S-HpETE is dehydrated to LTA4 by ALOX5",
"equation": "",
"summary": "In the second step of the formation of leukotriene A4 (LTA4) from arachidonic acid, arachidonate 5-lipoxygenase (ALOX5) converts 5S-hydroperoxyeicosatetranoic acid (5S-HpETE) to an allylic epoxide, leukotriene A4 (LTA4) (Rouzer et al. 1988, Rouzer & Samuelsson 1987, Rouzer et al. 1986).",
"cellular_location": "cytosol, nuclear envelope",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P09917-1",
"Q16873-1"
],
"evidence": [
{
"id": "R-HSA-266051",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-266051"
}
]
},
{
"id": "R-HSA-429016",
"name": "ALOX5 is phosphorylated by MAPKAP2",
"equation": "",
"summary": "Arachidonate 5-lipoxygenase (ALOX5) catalyzes the first step in leukotriene biosynthesis and has a key role in inflammatory processes. ALOX5 is phosphorylated by MAPKAPK2; MAPKAPK2 is stimulated by arachidonic acid.",
"cellular_location": "cytosol",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P09917-1",
"P49137-1"
],
"evidence": [
{
"id": "R-HSA-429016",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-429016"
}
]
},
{
"id": "R-HSA-6797293",
"name": "Expression of IL18, ALOX5",
"equation": "",
"summary": "In human peripheral blood, monocytes Interleukin-4 (IL4) and Interleukin-13 significantly downregulate the expression of classical proinflammatory signal transducers, such as Interleukin-1 (IL1), Interleukin-6, Interleukin-8, Interleukin-18, C-C motif chemokine 2 (CCL2) and Tumor necrosis factor (TNF). Expression of Prostaglandin G/H synthase 2 (PTGS2, COX2) and Arachidonate 5-lipoxygenase (ALOX5), enzymes involved in the biosynthesis of the proinflammatory eicosanoids, is also attenuated (Chatidis et al. 2005).
This is a black box event because the mechanism of gene regulation is not fully defined.",
"cellular_location": "cytosol, nucleoplasm",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P09917-1"
],
"evidence": [
{
"id": "R-HSA-6797293",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6797293"
}
]
},
{
"id": "R-HSA-6798748",
"name": "Exocytosis of secretory granule lumen proteins",
"equation": "",
"summary": "Secretory vesicles provide a reservoir of secreted proteins and membrane-associated receptors that are required at the earliest stages of the neutrophil-mediated inflammatory response. They are mobilized in response to a wide variety of inflammatory stimuli (Sengelov et al. 1993a,b). Resultant cell surface changes allow the neutrophil to establish firm contact with activated vascular epithelium (Faurschou & Borregaard 2003).",
"cellular_location": "extracellular region, secretory granule lumen",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P18669-1",
"Q13464-1",
"P32320-1",
"P09917-1",
"O00487-1",
"P13639-1",
"P12268-1",
"P62937-1",
"Q96G03-1",
"P68402-1",
"Q99436-1",
"P55072-1",
"P68104-1",
"P11142-1",
"Q9Y315-1",
"P13010-1",
"P04075-1",
"P09972-1",
"P07900-1",
"P09769-1",
"P09211-1",
"Q16539-1",
"P14618-1",
"P07741-1",
"Q01432-1",
"P12956-1",
"Q7Z6Z7-1",
"Q9UNP9-1",
"P14174-1",
"P04040-1",
"O00571-1",
"P06744-1",
"P52790-1",
"P11678-1",
"P00491-1",
"P06737-1",
"P00746-1",
"Q13162-1",
"P17858-1",
"P46976-1",
"P22392-1",
"P13716-1",
"O75874-1",
"P20839-1",
"O00764-1"
],
"evidence": [
{
"id": "R-HSA-6798748",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6798748"
}
]
},
{
"id": "R-HSA-6800434",
"name": "Exocytosis of ficolin-rich granule lumen proteins",
"equation": "",
"summary": "Ficoli-1 rich granules are a relatively new fourth neutrophil granule population that is enriched in the microbial lectin ficolin-1. Ficolin-1 is present in tertiary granules, but ficolin-1 rich granules can be differentiated by having low levels of gelatinases and an elevated exocytosis propensity (Rorvig et al. 2009, 2013). The importance of these granules may be to provide rapid release of pattern recognition molecules to activate the lectin complement pathway (Rorvig et al. 2009).",
"cellular_location": "extracellular region, ficolin-1-rich granule lumen",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"Q9UBR2-1",
"P18669-1",
"P32320-1",
"P09917-1",
"O00487-1",
"P13639-1",
"P12268-1",
"P62937-1",
"P15586-1",
"Q96G03-1",
"Q9P0J7-1",
"P68402-1",
"P36871-1",
"Q99436-1",
"P07339-1",
"P13798-1",
"P53396-1",
"P55072-1",
"P68104-1",
"P11142-1",
"Q9Y315-1",
"P04075-1",
"P09972-1",
"P07900-1",
"P09211-1",
"Q16539-1",
"P07858-1",
"P14618-1",
"P28482-1",
"Q01432-1",
"P12956-1",
"Q7Z6Z7-1",
"Q9UNP9-1",
"Q13510-1",
"P14174-1",
"P15848-1",
"P16278-1",
"Q8WVQ1-1",
"P04040-1",
"O00571-1",
"P14780-1",
"P06744-1",
"P52790-1",
"P00491-1",
"P06737-1",
"Q16769-1",
"P08236-1",
"P02794-1",
"P07384-1",
"Q14004-1",
"P00746-1",
"P98066-1",
"P25774-1",
"Q13162-1",
"P17858-1",
"P46976-1",
"P09960-1",
"P22392-1",
"P13716-1",
"O75874-1",
"P20839-1"
],
"evidence": [
{
"id": "R-HSA-6800434",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6800434"
}
]
},
{
"id": "R-HSA-9018858",
"name": "ALOX5 oxidises 18(S)-HEPE to 5(S)-Hp-18(S)-HEPE",
"equation": "",
"summary": "Unlike resolvin E3, which is biosynthesised in eosinophils or resident macrophages via the 15-lipoxygenase (ALOX15) pathway, resolvins E1 and E2 are biosynthesised by neutrophils via the 5-lipoxygenase pathway. In neutrophils, ALOX5 oxidises 18(S)-hydroxyeicosapentaenoic acid (18(S)-HEPE) to 5(S)-hydroperoxy-18(S)-hydroxyeicosapentaenoic acid (5(S)-Hp-18(S)-HEPE) (Tjonahen et al. 2006, Oh et al. 2012).",
"cellular_location": "cytosol",
"input_participant_list": [],
"output_participant_list": [
"R-ALL-9020602"
],
"enzyme_list": [
"P09917-1"
],
"evidence": [
{
"id": "R-HSA-9018858",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018858"
}
]
},
{
"id": "R-HSA-9018859",
"name": "ALOX5 oxidises 5(S)-Hp-18(S)-HEPE to 5S,6S-epoxy-18(S)-HEPE",
"equation": "",
"summary": "In neutrophils, 5-lipoxygenase (ALOX5) can mediate the insertion of molecular oxygen into 5(S)-hydroperoxy-18(S)-hydroxyeicosapentaenoic acid (5(S)-Hp-18(S)-HEPE) to form 5S,6S-epoxy-18(S)-HEPE which is essential for 18(S)-resolvin E1 biosynthesis (Tjonahen et al. 2006, Oh et al. 2012).",
"cellular_location": "cytosol",
"input_participant_list": [],
"output_participant_list": [
"R-ALL-9022655"
],
"enzyme_list": [
"P09917-1"
],
"evidence": [
{
"id": "R-HSA-9018859",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018859"
}
]
},
{
"id": "R-HSA-9018863",
"name": "ALOX5 oxidises 18(R)-HEPE to 5(S)-Hp-18(R)-HEPE",
"equation": "",
"summary": "Unlike resolvin E3, which is biosynthesised in eosinophils or resident macrophages via the 15-lipoxygenase (ALOX15) pathway, resolvins E1 and E2 are biosynthesised by neutrophils via the 5-lipoxygenase pathway. In neutrophils, ALOX5 oxidises 18(R)-hydroxyeicosapentaenoic acid (18(R)-HEPE) to 5(R)-hydroperoxy-18(R)-hydroxyeicosapentaenoic acid (5(R)-Hp-18(R)-HEPE) (Tjonahen et al. 2006, Oh et al. 2012).",
"cellular_location": "cytosol",
"input_participant_list": [],
"output_participant_list": [
"R-ALL-9023702"
],
"enzyme_list": [
"P09917-1"
],
"evidence": [
{
"id": "R-HSA-9018863",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018863"
}
]
},
{
"id": "R-HSA-9018894",
"name": "ALOX5 oxidises 5(S)-Hp-18(R)-HEPE to 5S,6S-epoxy-18(R)-HEPE",
"equation": "",
"summary": "In neutrophils, 5-lipoxygenase (ALOX5) can mediate the insertion of molecular oxygen into 5(S)-hydroperoxy-18(R)-hydroxyeicosapentaenoic acid (5(S)-Hp-18(R)-HEPE) to form 5S,6S-epoxy-18(R)-HEPE which is essential for 18(R)-resolvin E1 biosynthesis (Tjonahen et al. 2006, Oh et al. 2012).",
"cellular_location": "cytosol",
"input_participant_list": [],
"output_participant_list": [
"R-ALL-9023708"
],
"enzyme_list": [
"P09917-1"
],
"evidence": [
{
"id": "R-HSA-9018894",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018894"
}
]
},
{
"id": "R-HSA-9020251",
"name": "ALOX5 oxidises 17(R)-HDHA to 7(S)-Hp-17(R)-HDHA",
"equation": "",
"summary": "Lipoxygenase 5 (ALOX5) can oxidise 17(R)-hydroxydocosahexaenoic acid (17(R)-HDHA) into two hydroperoxy intermediates in human polymorphonuclear leukocytes (PMNs) (Serhan et al. 2002). The formation of 7(S)-hydroperoxy-17(R)-hydroxydocosahexaenoic acid (7(S)-Hp-17(R)-HDHA) is decribed here.",
"cellular_location": "cytosol",
"input_participant_list": [
"R-ALL-9024463"
],
"output_participant_list": [],
"enzyme_list": [
"P09917-1"
],
"evidence": [
{
"id": "R-HSA-9020251",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9020251"
}
]
},
{
"id": "R-HSA-9020255",
"name": "ALOX5 dehydrogenates 7(S)-Hp-17(S)-HDHA to 7S(8)-epoxy-17S-HDHA",
"equation": "",
"summary": "5-lipoxygenase (ALOX5) possesses dual lipoxygenase activity (Shimizu et al. 1984). In polymorphonuclear (PMN) cells, ALOX5 can epoxygenate (via dehydration) 7(S)-hydroperoxy-17(S)-hydroxydocosahexaenoic acid (7(S)-Hp-17(S)-HDHA) to form 7S(8)-epoxy-17(S)-hydroxydocosahexaenoic acid (7S(8)-epoxy-17(S)-HDHA (Serhan et al. 2002).",
"cellular_location": "cytosol",
"input_participant_list": [
"R-ALL-9024765"
],
"output_participant_list": [
"R-ALL-9024768"
],
"enzyme_list": [
"P09917-1"
],
"evidence": [
{
"id": "R-HSA-9020255",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9020255"
}
]
},
{
"id": "R-HSA-9020256",
"name": "ALOX5 dehydrogenates 7(S)-Hp-17R-HDHA to 7S(8)-epoxy-17R-HDHA",
"equation": "",
"summary": "5-lipoxygenase (ALOX5) possesses dual lipoxygenase activity (Shimizu et al. 1984). In polymorphonuclear (PMN) cells, ALOX5 can epoxygenate (via dehydration) 7(S)-hydroperoxy-17(R)-hydroxydocosahexaenoic acid (7(S)-Hp-17(R)-HDHA) to form 7S(8)-epoxy-17(R)-hydroxydocosahexaenoic acid (7S(8)-epoxy-17(R)-HDHA (Serhan et al. 2002).",
"cellular_location": "cytosol",
"input_participant_list": [
"R-ALL-9024479"
],
"output_participant_list": [
"R-ALL-9024602"
],
"enzyme_list": [
"P09917-1"
],
"evidence": [
{
"id": "R-HSA-9020256",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9020256"
}
]
},
{
"id": "R-HSA-9020259",
"name": "ALOX5 oxidises 17(R)-HDHA to 4(S)-Hp-17(R)-HDHA",
"equation": "",
"summary": "Lipoxygenase 5 (ALOX5) can oxidise 17(R)-hydroxydocosahexaenoic acid (17(R)-HDHA) into two hydroperoxy intermediates in human polymorphonuclear leukocytes (PMNs) (Serhan et al. 2002). The formation of 4(S)-hydroperoxy-17(R)-hydroxydocosahexaenoic acid (4(S)-Hp-17(R)-HDHA) is decribed here.",
"cellular_location": "cytosol",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P09917-1"
],
"evidence": [
{
"id": "R-HSA-9020259",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9020259"
}
]
},
{
"id": "R-HSA-9020264",
"name": "ALOX5 oxidises 17(S)-HDHA to 4(S)-Hp-17(S)-HDHA",
"equation": "",
"summary": "Lipoxygenase 5 (ALOX5) can oxidise 17(S)-hydroxydocosahexaenoic acid (17(S)-HDHA) into two hydroperoxy intermediates in human polymorphonuclear leukocytes (PMNs) (Serhan et al. 2002). The formation of 4(S)-hydroperoxy-17(S)-hydroxydocosahexaenoic acid (4(S)-Hp-17(S)-HDHA) is decribed here.",
"cellular_location": "cytosol",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P09917-1"
],
"evidence": [
{
"id": "R-HSA-9020264",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9020264"
}
]
},
{
"id": "R-HSA-9020277",
"name": "ALOX5 dehydrogenates 4(S)-Hp-17(S)-HDHA to 4S(5)-epoxy-17(S)-HDHA",
"equation": "",
"summary": "5-lipoxygenase (ALOX5) possesses dual lipoxygenase activity (Shimizu et al. 1984). In polymorphonuclear (PMN) cells, ALOX5 can epoxygenate (via dehydration) 4(S)-hydroperoxy-17(S)-hydroxydocosahexaenoic acid (4(S)-Hp-17(S)-HDHA) to form 4S(5)-epoxy-17(S)-hydroxydocosahexaenoic acid (4S(5)-epoxy-17(S)-HDHA (Serhan et al. 2002).",
"cellular_location": "cytosol",
"input_participant_list": [
"R-ALL-9024797"
],
"output_participant_list": [
"R-ALL-9024781"
],
"enzyme_list": [
"P09917-1"
],
"evidence": [
{
"id": "R-HSA-9020277",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9020277"
}
]
},
{
"id": "R-HSA-9020278",
"name": "ALOX5 dehydrogenates 4(S)-Hp-17(R)-HDHA to 4S(5)-epoxy-17(R)-HDHA",
"equation": "",
"summary": "5-lipoxygenase (ALOX5) possesses dual lipoxygenase activity (Shimizu et al. 1984). In polymorphonuclear (PMN) cells, ALOX5 can epoxygenate (via dehydration) 4(S)-hydroperoxy-17(R)-hydroxydocosahexaenoic acid (4(S)-Hp-17(R)-HDHA) to form 4S(5)-epoxy-17(R)-hydroxydocosahexaenoic acid (4S(5)-epoxy-17(R)-HDHA (Serhan et al. 2002).",
"cellular_location": "cytosol",
"input_participant_list": [
"R-ALL-9024576"
],
"output_participant_list": [
"R-ALL-9024577"
],
"enzyme_list": [
"P09917-1"
],
"evidence": [
{
"id": "R-HSA-9020278",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9020278"
}
]
},
{
"id": "R-HSA-9020282",
"name": "ALOX5 oxidises 17(S)-HDHA to 7(S)-Hp-17(S)-HDHA",
"equation": "",
"summary": "Lipoxygenase 5 (ALOX5) can oxidise 17(S)-hydroxydocosahexaenoic acid (17(S)-HDHA) into two hydroperoxy intermediates in human polymorphonuclear leukocytes (PMNs) (Serhan et al. 2002). The formation of 7(S)-hydroperoxy-17(S)-hydroxydocosahexaenoic acid (7(S)-Hp-17(S)-HDHA) is decribed here.",
"cellular_location": "cytosol",
"input_participant_list": [
"R-ALL-9024815"
],
"output_participant_list": [],
"enzyme_list": [
"P09917-1"
],
"evidence": [
{
"id": "R-HSA-9020282",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9020282"
}
]
},
{
"id": "R-HSA-9024997",
"name": "ALOX5 oxidises 14(S)-Hp-DHA to 7(S),14(S)-diHp-DHA",
"equation": "",
"summary": "In macrophages, lipoxygenase 5 (ALOX5) is proposed to further oxygenate 14(S)-hydroperoxy-docosahexaenoic acid (14(S)-Hp-DHA) to 7(S),14(S)-dihydroperoxy-docosaheaenoic acid (7(S),14(S)-diHp-DHA) (Serhan et al. 2009).",
"cellular_location": "cytosol",
"input_participant_list": [],
"output_participant_list": [
"R-ALL-9024989"
],
"enzyme_list": [
"P09917-1"
],
"evidence": [
{
"id": "R-HSA-9024997",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9024997"
}
]
},
{
"id": "R-HSA-9025995",
"name": "ALOX5 dehydrogenates 7,17-diHp-DPAn-3 to 7,8-epoxy,17-HDPAn-3",
"equation": "",
"summary": "Instead of the dihydroperoxy intermediate being reduced, a lipoxygenase may mediate hydrogen abstraction from 7,17-dihydroperoxy-docosapentaenoic acid (7,17-diHp-DPAn-3) to form 7,8-epoxy, 17-hydroxydocosapentaenoic acid (7,8-epoxy,17-HDPAn-3) (Dalli et al. 2013). Although this is a proposed biosynthetic route for the formation of DPA-n-3 resolvins, it is assumed DPAn-3-derived SPMs follow a similar synthesis route to DHA- and EPA-derived SPMs and therefore, the lipoxygenase could be the dual-functional 5-lipoxygenase (ALOX5).",
"cellular_location": "cytosol",
"input_participant_list": [
"R-ALL-9026034"
],
"output_participant_list": [
"R-ALL-9026050"
],
"enzyme_list": [
"P09917-1"
],
"evidence": [
{
"id": "R-HSA-9025995",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9025995"
}
]
},
{
"id": "R-HSA-9025996",
"name": "ALOX5 oxidises 17(S)-Hp-DPAn-3 to 7,17-diHp-DPAn-3",
"equation": "",
"summary": "In an alternative route to the production of protectins PD1n-3DPA and PD2n-3DPA, 17(S)-hydroperoxy-docosapentaenoic acid (17(S)-Hp-DPAn-3) can be further oxygenated by a lipoxygenase to form 7,17-dihydroperoxy-docosapentaenoic acid (7,17-diHp-DPAn-3) (Dalli et al. 2013). Although this is a proposed biosynthetic route, it is assumed DPAn-3-derived SPMs follow a similar synthesis route to DHA- and EPA-derived SPMs therefore the lipoxygenase could be the dual-functional 5-lipoxygenase (ALOX5).",
"cellular_location": "cytosol",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P09917-1"
],
"evidence": [
{
"id": "R-HSA-9025996",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9025996"
}
]
},
{
"id": "R-HSA-9025999",
"name": "ALOX5 dehydrogenates 17(S)-Hp-DPAn-3 to 16(S),17(S)-epoxy-DPAn-3",
"equation": "",
"summary": "In neutrophils, an unknown lipoxygenase may mediate hydrogen abstraction from 17(S)-hydroperoxy-docosapentaenoic acid (17(S)-Hp-DPAn-3) to form 16(S),17(S)-epoxy-docosapentaenoic acid (16(S),17(S)-epoxy-DPAn-3) (Dalli et al. 2013). If, as assumed, DPA metabolism follows the same path as DHA metabolism, the lipoxygenase could be the dual-functional 5-lipoxygenase (ALOX5). The formation of this epoxy intermediate is supported by chemical synthesis experiments (Aursnes et al. 2014, Primdahl et al. 2017).",
"cellular_location": "cytosol",
"input_participant_list": [
"R-ALL-9026047"
],
"output_participant_list": [
"R-ALL-9026046"
],
"enzyme_list": [
"P09917-1"
],
"evidence": [
{
"id": "R-HSA-9025999",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9025999"
}
]
},
{
"id": "R-HSA-9026005",
"name": "ALOX5 oxidises 14(S)-Hp-DPAn-3 to MaR3n-3 DPA",
"equation": "",
"summary": "In an alternative reaction to epoxidation, 14(S)-hydroperoxy-docosapentaenoic acid (14(S)-HpDPAn-3) can undergo a second oxygenation at the \u03c9-1 position to yield 14(S), 21-dihydroxy-docosapentaenoic acid (MaR3n-3 DPA) (Dalli et al. 2013). MaR3n-3 DPA is named after maresin-1 (derived from DHA) as they share an alcohol group at C14 and is proposed to possess similar anti-inflammatory and proresolving potency and activity as maresin-1. With human leukocytes this n-3 DPA-SPM reduced neutrophil chemotaxis, adhesion and enhanced macrophage phagocytosis (Dalli et al. 2013, Vik et al. 2017). If, as assumed, DPA metabolism follows the same path as DHA metabolism, the lipoxygenase could be the dual-functional 5-lipoxygenase (ALOX5).",
"cellular_location": "cytosol",
"input_participant_list": [],
"output_participant_list": [
"R-ALL-9026311"
],
"enzyme_list": [
"P09917-1"
],
"evidence": [
{
"id": "R-HSA-9026005",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9026005"
}
]
},
{
"id": "R-HSA-9026405",
"name": "ALOX5 oxidises 13(R)-HDPAn-3 to RvT1-4",
"equation": "",
"summary": "In neutrophils, 5-lipoxygenase (ALOX5) oxidises 13(R)-hydroxy-docosapentaenoic acid (13(R)-DPAn-3) to the 13(R)-resolvins RvT1-4 (7,13,20-trihydroxy-docosapentaenoic acid, 7,12,13-trihydroxy-docosapentaenoic acid, 7,8,13-trihydroxy-docosapentaenoic acid and 7,13-dihydroxy-docosapentaenoic acid respectively) (Dalli et al. 2015, Primdahl et al. 2016). They were all shown to posses anti-inflammatory and proresolving activities (Dalli et al. 2015). Recently, RvTs have been shown to mediate the proresolving actions of several statins in mice with inflammatory arthritis (Walker et al. 2017).",
"cellular_location": "cytosol",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P09917-1"
],
"evidence": [
{
"id": "R-HSA-9026405",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9026405"
}
]
},
{
"id": "R-HSA-9027624",
"name": "ALOX5 oxidises DHA to 7-HDHA",
"equation": "",
"summary": "In human neutrophils, 5-lipoxygenase (ALOX5) can mediate the lipoxygenation of docosahexaenoic acid (DHA) to 7-hydroxy-docosahexaenoic acid (7-HDHA) (Cipollina et al. 2014). Neutrophils treated with an ALOX5 inhibitor completely suppressed the formation of 7-oxo-DHA and its hydroxy precursor 7-HDHA, demonstrating that ALOX5 mediates the first step in 5-oxo-DHA biosynthesis (Cipollina et al. 2014).",
"cellular_location": "cytosol",
"input_participant_list": [],
"output_participant_list": [
"R-ALL-9028274"
],
"enzyme_list": [
"P09917-1"
],
"evidence": [
{
"id": "R-HSA-9027624",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9027624"
}
]
},
{
"id": "R-HSA-9027628",
"name": "ALOX5 oxidises EPA to 5-HEPE",
"equation": "",
"summary": "In human neutrophils, 5-lipoxygenase (ALOX5) can mediate the lipoxygenation of eicosapentaenoic acid (EPA) to 5-hydroxy-eicosapentaenoic acid (5-HEPE) (Cipollina et al. 2014, Powell et al. 1995). Neutrophils treated with an ALOX5 inhibitor completely suppressed the formation of 5-oxo-EPA and its hydroxy precursor 5-HEPE, demonstrating that ALOX5 mediates the first step in 5-oxo-EPA biosynthesis (Cipollina et al. 2014).",
"cellular_location": "cytosol",
"input_participant_list": [],
"output_participant_list": [
"R-ALL-9028283"
],
"enzyme_list": [
"P09917-1"
],
"evidence": [
{
"id": "R-HSA-9027628",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9027628"
}
]
},
{
"id": "R-HSA-9027633",
"name": "ALOX5 oxidises DPAn-3 to 7-HDPAn-3",
"equation": "",
"summary": "In human neutrophils, 5-lipoxygenase (ALOX5) can mediate the lipoxygenation of \u03c9-3 docosapentaenoic acid (DPAn-3) to 7-hydroxy-\u03c9-3-docosapentaenoic acid (7-HDPAn-3) (Cipollina et al. 2014). Neutrophils treated with an ALOX5 inhibitor completely suppressed the formation of 7-oxo-DPAn-3 and its hydroxy precursor 7-HDPAn-3, demonstrating that ALOX5 mediates the first step in 7-oxo-DPAn-3 biosynthesis (Cipollina et al. 2014).",
"cellular_location": "cytosol",
"input_participant_list": [],
"output_participant_list": [
"R-ALL-9028240"
],
"enzyme_list": [
"P09917-1"
],
"evidence": [
{
"id": "R-HSA-9027633",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9027633"
}
]
},
{
"id": "R-HSA-9707186",
"name": "ALOX5 binds ALOX5 inhibitors",
"equation": "",
"summary": "Eicosanoids, oxygenated, 20-carbon fatty acids, are autocrine and paracrine signaling molecules that modulate physiological processes including pain, fever, inflammation, blood clot formation, smooth muscle contraction and relaxation, and the release of gastric acid. Eicosanoids are synthesized in humans primarily from arachidonic acid (AA) that is released from membrane phospholipids. Once released, AA can be acted on by various enzymes to form different eicosanoids. Arachidonate lipoxygenase 5 (ALOX)5 form leukotrienes (LTs) and eicosatetraenoic acids (ETEs) from AA. LTs and ETEs are biologically active molecules formed in response to inflammatory stimuli. They cause contraction of bronchial smooth muscles, stimulation of vascular permeability, and attraction and activation of leukocytes. When produced in excess, these molecules may contribute to a wide range of pathological inflammatory responses.
ALOX5 inhibitors are compounds that slow or stop the action of the ALOX5 enzyme, which is responsible for the production of inflammatory LTs and ETEs. Zileuton blocks the activity of ALOX5 (Carter et al. 1991). Zileuton is used in the treatment of acne vulgaris (Zouboulis 2005, Zouboulis et al. 2009) and for the prophylaxis and chronic treatment of allergic asthma (Bruno et al. 2018, Morina et al. 2016). Meclofenamic acid is a non-steroidal anti-inflammatory drug (NSAID) used for the relief of mild to moderate pain, for the treatment of primary dysmenorrhea and for the treatment of idiopathic heavy menstrual blood loss. It is also used for relief of the signs and symptoms of acute and chronic rheumatoid arthritis and osteoarthritis. In vitro meclofenamic acid was found to be an inhibitor of human ALOX5 activity (Boctor et al. 1986). Balsalazide, olsalazine and sulfasalazine are all pro-drugs that are enzymatically cleaved in the colon to produce the anti-inflammatory agent mesalazine (5-aminosalicylic acid, 5-ASA, mesalazine (Klotz 1985, Selby et al. 1985, Sharon et al. 1978, Hawkey et al. 1985, Neilsen et al. 1987). Once metabolised, 5-ASA acts locally in the colon to reduce inflammation in conditions such as inflammatory bowel disease and ulcerative colitis (Wiggins & Rajapakse 2009, Rask-Madsen et al. 1992, Singer et al. 2006, Hoult 1986, Feagan & Macdonald 2012).",
"cellular_location": "cytosol, nuclear envelope",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P09917-1",
"Q16873-1"
],
"evidence": [
{
"id": "R-HSA-9707186",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9707186"
}
]
}
],
"reaction_participants": [
{
"participant_id": "R-ALL-2142726",
"participant_name": "EXC4 [cytosol]",
"crossref": [
{
"id": "63984",
"database": "ChEBI",
"url": ""
},
{
"id": "000087528756",
"database": "ZINC",
"url": ""
},
{
"id": "000087528756",
"database": "ZINC",
"url": ""
},
{
"id": "63984",
"database": "ChEBI",
"url": ""
},
{
"id": "63984",
"database": "ChEBI",
"url": ""
},
{
"id": "000087528756",
"database": "ZINC",
"url": ""
},
{
"id": "000087528756",
"database": "ZINC",
"url": ""
},
{
"id": "63984",
"database": "ChEBI",
"url": ""
},
{
"id": "63984",
"database": "ChEBI",
"url": ""
},
{
"id": "000087528756",
"database": "ZINC",
"url": ""
}
]
},
{
"participant_id": "R-ALL-2142772",
"participant_name": "EXA4 [cytosol]",
"crossref": [
{
"id": "63983",
"database": "ChEBI",
"url": ""
},
{
"id": "000087528753",
"database": "ZINC",
"url": ""
},
{
"id": "63983",
"database": "ChEBI",
"url": ""
},
{
"id": "000087528753",
"database": "ZINC",
"url": ""
},
{
"id": "000087528753",
"database": "ZINC",
"url": ""
},
{
"id": "63983",
"database": "ChEBI",
"url": ""
},
{
"id": "63983",
"database": "ChEBI",
"url": ""
},
{
"id": "000087528753",
"database": "ZINC",
"url": ""
},
{
"id": "63983",
"database": "ChEBI",
"url": ""
},
{
"id": "000087528753",
"database": "ZINC",
"url": ""
}
]
},
{
"participant_id": "R-ALL-9020602",
"participant_name": "5(S)-Hp-18(S)-HEPE [cytosol]",
"crossref": [
{
"id": "132802",
"database": "ChEBI",
"url": ""
},
{
"id": "000147579838",
"database": "ZINC",
"url": ""
},
{
"id": "000147579838",
"database": "ZINC",
"url": ""
},
{
"id": "132802",
"database": "ChEBI",
"url": ""
},
{
"id": "132802",
"database": "ChEBI",
"url": ""
},
{
"id": "000147579838",
"database": "ZINC",
"url": ""
},
{
"id": "000147579838",
"database": "ZINC",
"url": ""
},
{
"id": "132802",
"database": "ChEBI",
"url": ""
},
{
"id": "132802",
"database": "ChEBI",
"url": ""
},
{
"id": "000147579838",
"database": "ZINC",
"url": ""
}
]
},
{
"participant_id": "R-ALL-9022655",
"participant_name": "5S,6S-epoxy-18(S)-HEPE [cytosol]",
"crossref": [
{
"id": "138490",
"database": "ChEBI",
"url": ""
},
{
"id": "138490",
"database": "ChEBI",
"url": ""
},
{
"id": "138490",
"database": "ChEBI",
"url": ""
},
{
"id": "138490",
"database": "ChEBI",
"url": ""
},
{
"id": "138490",
"database": "ChEBI",
"url": ""
},
{
"id": "138490",
"database": "ChEBI",
"url": ""
},
{
"id": "138490",
"database": "ChEBI",
"url": ""
}
]
},
{
"participant_id": "R-ALL-9023702",
"participant_name": "5(S)-Hp-18(R)-HEPE [cytosol]",
"crossref": [
{
"id": "132908",
"database": "ChEBI",
"url": ""
},
{
"id": "000056875036",
"database": "ZINC",
"url": ""
},
{
"id": "132908",
"database": "ChEBI",
"url": ""
},
{
"id": "000056875036",
"database": "ZINC",
"url": ""
},
{
"id": "132908",
"database": "ChEBI",
"url": ""
},
{
"id": "000056875036",
"database": "ZINC",
"url": ""
},
{
"id": "132908",
"database": "ChEBI",
"url": ""
},
{
"id": "000056875036",
"database": "ZINC",
"url": ""
},
{
"id": "132908",
"database": "ChEBI",
"url": ""
},
{
"id": "000056875036",
"database": "ZINC",
"url": ""
}
]
},
{
"participant_id": "R-ALL-9023708",
"participant_name": "5S,6S-epoxy-18(R)-HEPE [cytosol]",
"crossref": [
{
"id": "138563",
"database": "ChEBI",
"url": ""
},
{
"id": "138563",
"database": "ChEBI",
"url": ""
},
{
"id": "138563",
"database": "ChEBI",
"url": ""
},
{
"id": "138563",
"database": "ChEBI",
"url": ""
},
{
"id": "138563",
"database": "ChEBI",
"url": ""
},
{
"id": "138563",
"database": "ChEBI",
"url": ""
},
{
"id": "138563",
"database": "ChEBI",
"url": ""
}
]
},
{
"participant_id": "R-ALL-9024463",
"participant_name": "17(R)-HDHA [cytosol]",
"crossref": [
{
"id": "91137",
"database": "ChEBI",
"url": ""
},
{
"id": "000032821825",
"database": "ZINC",
"url": ""
},
{
"id": "91137",
"database": "ChEBI",
"url": ""
},
{
"id": "000032821825",
"database": "ZINC",
"url": ""
},
{
"id": "91137",
"database": "ChEBI",
"url": ""
},
{
"id": "000032821825",
"database": "ZINC",
"url": ""
},
{
"id": "91137",
"database": "ChEBI",
"url": ""
},
{
"id": "000032821825",
"database": "ZINC",
"url": ""
},
{
"id": "91137",
"database": "ChEBI",
"url": ""
},
{
"id": "000032821825",
"database": "ZINC",
"url": ""
}
]
},
{
"participant_id": "R-ALL-9024479",
"participant_name": "7(S)-Hp-17(R)-HDHA [cytosol]",
"crossref": [
{
"id": "138602",
"database": "ChEBI",
"url": ""
},
{
"id": "138602",
"database": "ChEBI",
"url": ""
},
{
"id": "138602",
"database": "ChEBI",
"url": ""
},
{
"id": "138602",
"database": "ChEBI",
"url": ""
},
{
"id": "138602",
"database": "ChEBI",
"url": ""
}
]
},
{
"participant_id": "R-ALL-9024576",
"participant_name": "4(S)-Hp-17(R)-HDHA [cytosol]",
"crossref": [
{
"id": "138601",
"database": "ChEBI",
"url": ""
},
{
"id": "138601",
"database": "ChEBI",
"url": ""
},
{
"id": "138601",
"database": "ChEBI",
"url": ""
},
{
"id": "138601",
"database": "ChEBI",
"url": ""
},
{
"id": "138601",
"database": "ChEBI",
"url": ""
}
]
},
{
"participant_id": "R-ALL-9024577",
"participant_name": "4S(5)-epoxy-17(R)-HDHA [cytosol]",
"crossref": [
{
"id": "138612",
"database": "ChEBI",
"url": ""
},
{
"id": "138612",
"database": "ChEBI",
"url": ""
},
{
"id": "138612",
"database": "ChEBI",
"url": ""
},
{
"id": "138612",
"database": "ChEBI",
"url": ""
},
{
"id": "138612",
"database": "ChEBI",
"url": ""
}
]
},
{
"participant_id": "R-ALL-9024602",
"participant_name": "7S(8)-epoxy-17(R)-HDHA [cytosol]",
"crossref": [
{
"id": "138613",
"database": "ChEBI",
"url": ""
},
{
"id": "138613",
"database": "ChEBI",
"url": ""
},
{
"id": "138613",
"database": "ChEBI",
"url": ""
},
{
"id": "138613",
"database": "ChEBI",
"url": ""
},
{
"id": "138613",
"database": "ChEBI",
"url": ""
}
]
},
{
"participant_id": "R-ALL-9024765",
"participant_name": "7(S)-Hp-17(S)-HDHA [cytosol]",
"crossref": [
{
"id": "138642",
"database": "ChEBI",
"url": ""
},
{
"id": "138642",
"database": "ChEBI",
"url": ""
},
{
"id": "138642",
"database": "ChEBI",
"url": ""
},
{
"id": "138642",
"database": "ChEBI",
"url": ""
},
{
"id": "138642",
"database": "ChEBI",
"url": ""
}
]
},
{
"participant_id": "R-ALL-9024768",
"participant_name": "7S(8)-epoxy-17(S)-HDHA [cytosol]",
"crossref": [
{
"id": "138646",
"database": "ChEBI",
"url": ""
},
{
"id": "138646",
"database": "ChEBI",
"url": ""
},
{
"id": "138646",
"database": "ChEBI",
"url": ""
},
{
"id": "138646",
"database": "ChEBI",
"url": ""
},
{
"id": "138646",
"database": "ChEBI",
"url": ""
}
]
},
{
"participant_id": "R-ALL-9024781",
"participant_name": "4S(5)-epoxy-17(S)-HDHA [cytosol]",
"crossref": [
{
"id": "138647",
"database": "ChEBI",
"url": ""
},
{
"id": "138647",
"database": "ChEBI",
"url": ""
},
{
"id": "138647",
"database": "ChEBI",
"url": ""
},
{
"id": "138647",
"database": "ChEBI",
"url": ""
},
{
"id": "138647",
"database": "ChEBI",
"url": ""
}
]
},
{
"participant_id": "R-ALL-9024797",
"participant_name": "4(S)-Hp-17(S)-HDHA [cytosol]",
"crossref": [
{
"id": "138641",
"database": "ChEBI",
"url": ""
},
{
"id": "138641",
"database": "ChEBI",
"url": ""
},
{
"id": "138641",
"database": "ChEBI",
"url": ""
},
{
"id": "138641",
"database": "ChEBI",
"url": ""
},
{
"id": "138641",
"database": "ChEBI",
"url": ""
}
]
},
{
"participant_id": "R-ALL-9024815",
"participant_name": "17(S)-HDHA [cytosol]",
"crossref": [
{
"id": "138640",
"database": "ChEBI",
"url": ""
},
{
"id": "138640",
"database": "ChEBI",
"url": ""
},
{
"id": "138640",
"database": "ChEBI",
"url": ""
},
{
"id": "138640",
"database": "ChEBI",
"url": ""
},
{
"id": "138640",
"database": "ChEBI",
"url": ""
}
]
},
{
"participant_id": "R-ALL-9024989",
"participant_name": "7(S),14(S)-diHp-DHA [cytosol]",
"crossref": [
{
"id": "140196",
"database": "ChEBI",
"url": ""
},
{
"id": "140196",
"database": "ChEBI",
"url": ""
},
{
"id": "140196",
"database": "ChEBI",
"url": ""
},
{
"id": "140196",
"database": "ChEBI",
"url": ""
},
{
"id": "140196",
"database": "ChEBI",
"url": ""
}
]
},
{
"participant_id": "R-ALL-9026034",
"participant_name": "7,17-diHp-DPAn-3 [cytosol]",
"crossref": [
{
"id": "140248",
"database": "ChEBI",
"url": ""
},
{
"id": "140248",
"database": "ChEBI",
"url": ""
},
{
"id": "140248",
"database": "ChEBI",
"url": ""
},
{
"id": "140248",
"database": "ChEBI",
"url": ""
},
{
"id": "140248",
"database": "ChEBI",
"url": ""
}
]
},
{
"participant_id": "R-ALL-9026046",
"participant_name": "16(S),17(S)-epoxy-DPAn-3 [cytosol]",
"crossref": [
{
"id": "140224",
"database": "ChEBI",
"url": ""
},
{
"id": "140224",
"database": "ChEBI",
"url": ""
},
{
"id": "140224",
"database": "ChEBI",
"url": ""
},
{
"id": "140224",
"database": "ChEBI",
"url": ""
},
{
"id": "140224",
"database": "ChEBI",
"url": ""
}
]
},
{
"participant_id": "R-ALL-9026047",
"participant_name": "17(S)-Hp-DPAn-3 [cytosol]",
"crossref": [
{
"id": "140226",
"database": "ChEBI",
"url": ""
},
{
"id": "140226",
"database": "ChEBI",
"url": ""
},
{
"id": "140226",
"database": "ChEBI",
"url": ""
},
{
"id": "140226",
"database": "ChEBI",
"url": ""
},
{
"id": "140226",
"database": "ChEBI",
"url": ""
}
]
},
{
"participant_id": "R-ALL-9026050",
"participant_name": "7,8-epoxy,17-HDPAn-3 [cytosol]",
"crossref": [
{
"id": "140234",
"database": "ChEBI",
"url": ""
},
{
"id": "140234",
"database": "ChEBI",
"url": ""
},
{
"id": "140234",
"database": "ChEBI",
"url": ""
},
{
"id": "140234",
"database": "ChEBI",
"url": ""
},
{
"id": "140234",
"database": "ChEBI",
"url": ""
}
]
},
{
"participant_id": "R-ALL-9026311",
"participant_name": "MaR3n-3 DPA [cytosol]",
"crossref": [
{
"id": "140258",
"database": "ChEBI",
"url": ""
},
{
"id": "140258",
"database": "ChEBI",
"url": ""
},
{
"id": "140258",
"database": "ChEBI",
"url": ""
},
{
"id": "140258",
"database": "ChEBI",
"url": ""
},
{
"id": "140258",
"database": "ChEBI",
"url": ""
}
]
},
{
"participant_id": "R-ALL-9028240",
"participant_name": "7-HDPAn-3 [cytosol]",
"crossref": [
{
"id": "140250",
"database": "ChEBI",
"url": ""
},
{
"id": "140250",
"database": "ChEBI",
"url": ""
},
{
"id": "140250",
"database": "ChEBI",
"url": ""
},
{
"id": "140250",
"database": "ChEBI",
"url": ""
},
{
"id": "140250",
"database": "ChEBI",
"url": ""
}
]
},
{
"participant_id": "R-ALL-9028274",
"participant_name": "7-HDHA [cytosol]",
"crossref": [
{
"id": "72623",
"database": "ChEBI",
"url": ""
},
{
"id": "000034961942",
"database": "ZINC",
"url": ""
},
{
"id": "000034961939",
"database": "ZINC",
"url": ""
},
{
"id": "000034961942",
"database": "ZINC",
"url": ""
},
{
"id": "72623",
"database": "ChEBI",
"url": ""
},
{
"id": "000034961939",
"database": "ZINC",
"url": ""
},
{
"id": "72623",
"database": "ChEBI",
"url": ""
},
{
"id": "000034961942",
"database": "ZINC",
"url": ""
},
{
"id": "000034961939",
"database": "ZINC",
"url": ""
},
{
"id": "72623",
"database": "ChEBI",
"url": ""
},
{
"id": "000034961939",
"database": "ZINC",
"url": ""
},
{
"id": "000034961942",
"database": "ZINC",
"url": ""
},
{
"id": "72623",
"database": "ChEBI",
"url": ""
},
{
"id": "000034961942",
"database": "ZINC",
"url": ""
},
{
"id": "000034961939",
"database": "ZINC",
"url": ""
}
]
},
{
"participant_id": "R-ALL-9028283",
"participant_name": "5-HEPE [cytosol]",
"crossref": [
{
"id": "72801",
"database": "ChEBI",
"url": ""
},
{
"id": "HMDB0005081",
"database": "HMDB Metabolite",
"url": ""
},
{
"id": "000012496534",
"database": "ZINC",
"url": ""
},
{
"id": "000008860440",
"database": "ZINC",
"url": ""
},
{
"id": "000012496534",
"database": "ZINC",
"url": ""
},
{
"id": "72801",
"database": "ChEBI",
"url": ""
},
{
"id": "000008860440",
"database": "ZINC",
"url": ""
},
{
"id": "HMDB0005081",
"database": "HMDB Metabolite",
"url": ""
},
{
"id": "72801",
"database": "ChEBI",
"url": ""
},
{
"id": "HMDB0005081",
"database": "HMDB Metabolite",
"url": ""
},
{
"id": "000012496534",
"database": "ZINC",
"url": ""
},
{
"id": "000008860440",
"database": "ZINC",
"url": ""
},
{
"id": "000012496534",
"database": "ZINC",
"url": ""
},
{
"id": "72801",
"database": "ChEBI",
"url": ""
},
{
"id": "000008860440",
"database": "ZINC",
"url": ""
},
{
"id": "HMDB0005081",
"database": "HMDB Metabolite",
"url": ""
},
{
"id": "72801",
"database": "ChEBI",
"url": ""
},
{
"id": "HMDB0005081",
"database": "HMDB Metabolite",
"url": ""
},
{
"id": "000012496534",
"database": "ZINC",
"url": ""
},
{
"id": "000008860440",
"database": "ZINC",
"url": ""
}
]
}
],
"reaction_enzymes": [
{
"uniprot_ac": "D3ZQF9",
"gene_name": "Alox12e",
"activity": [
{
"ec_number": "1.13.11.-",
"activity": "",
"evidence": [
{
"id": "D3ZQF9",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/D3ZQF9"
}
]
},
{
"ec_number": "1.13.11.31",
"activity": "(5Z,8Z,11Z,14Z)-eicosatetraenoate + O2 = (12S)-hydroperoxy-(5Z,8Z,10E,14Z)-eicosatetraenoate.",
"evidence": [
{
"id": "D3ZQF9",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/D3ZQF9"
}
]
}
]
},
{
"uniprot_ac": "F1LQ70",
"gene_name": "Alox12",
"activity": [
{
"ec_number": "1.13.11.-",
"activity": "",
"evidence": [
{
"id": "F1LQ70",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/F1LQ70"
}
]
},
{
"ec_number": "1.13.11.31",
"activity": "(5Z,8Z,11Z,14Z)-eicosatetraenoate + O2 = (12S)-hydroperoxy-(5Z,8Z,10E,14Z)-eicosatetraenoate.",
"evidence": [
{
"id": "F1LQ70",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/F1LQ70"
}
]
},
{
"ec_number": "3.3.2.-",
"activity": "",
"evidence": [
{
"id": "F1LQ70",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/F1LQ70"
}
]
},
{
"ec_number": "1.13.11.33",
"activity": "(5Z,8Z,11Z,14Z)-eicosatetraenoate + O2 = (15S)-hydroperoxy-(5Z,8Z,11Z,13E)-eicosatetraenoate.",
"evidence": [
{
"id": "F1LQ70",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/F1LQ70"
}
]
}
]
},
{
"uniprot_ac": "O00487",
"gene_name": "PSMD14",
"activity": [
{
"ec_number": "3.4.19.-",
"activity": "",
"evidence": [
{
"id": "O00487",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O00487"
}
]
}
]
},
{
"uniprot_ac": "O00571",
"gene_name": "DDX3X",
"activity": [
{
"ec_number": "3.6.4.13",
"activity": "ATP + H2O = ADP + H(+) + phosphate.",
"evidence": [
{
"id": "O00571",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O00571"
}
]
},
{
"ec_number": "3.6.4.13",
"activity": "",
"evidence": [
{
"id": "O00571",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O00571"
}
]
}
]
},
{
"uniprot_ac": "O00764",
"gene_name": "PDXK",
"activity": [
{
"ec_number": "2.7.1.35",
"activity": "ATP + pyridoxal = ADP + H(+) + pyridoxal 5'-phosphate.",
"evidence": [
{
"id": "O00764",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O00764"
}
]
},
{
"ec_number": "2.7.1.35",
"activity": "",
"evidence": [
{
"id": "O00764",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O00764"
}
]
}
]
},
{
"uniprot_ac": "O35936",
"gene_name": "Alox8",
"activity": [
{
"ec_number": "1.13.11.-",
"activity": "",
"evidence": [
{
"id": "O35936",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O35936"
}
]
},
{
"ec_number": "1.13.11.58",
"activity": "(9Z,12Z)-octadecadienoate + O2 = (9S)-hydroperoxy-(10E,12Z)-octadecadienoate.",
"evidence": [
{
"id": "O35936",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O35936"
}
]
}
]
},
{
"uniprot_ac": "O75874",
"gene_name": "IDH1",
"activity": [
{
"ec_number": "1.1.1.42",
"activity": "D-threo-isocitrate + NADP(+) = 2-oxoglutarate + CO2 + NADPH.",
"evidence": [
{
"id": "O75874",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O75874"
}
]
},
{
"ec_number": "1.1.1.42",
"activity": "",
"evidence": [
{
"id": "O75874",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O75874"
}
]
}
]
},
{
"uniprot_ac": "P00491",
"gene_name": "PNP",
"activity": [
{
"ec_number": "2.4.2.1",
"activity": "a purine 2'-deoxy-D-ribonucleoside + phosphate = 2-deoxy-alpha-D-ribose 1-phosphate + a purine nucleobase.",
"evidence": [
{
"id": "P00491",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P00491"
}
]
},
{
"ec_number": "2.4.2.1",
"activity": "",
"evidence": [
{
"id": "P00491",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P00491"
}
]
}
]
},
{
"uniprot_ac": "P00746",
"gene_name": "CFD",
"activity": [
{
"ec_number": "3.4.21.46",
"activity": "Selective cleavage of Arg-|-Lys bond in complement factor B when in complex with complement subcomponent C3b or with cobra venom factor.",
"evidence": [
{
"id": "P00746",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P00746"
}
]
},
{
"ec_number": "3.4.21.46",
"activity": "",
"evidence": [
{
"id": "P00746",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P00746"
}
]
}
]
},
{
"uniprot_ac": "P02794",
"gene_name": "FTH1",
"activity": [
{
"ec_number": "1.16.3.1",
"activity": "4 Fe(2+) + 4 H(+) + O2 = 4 Fe(3+) + 2 H2O.",
"evidence": [
{
"id": "P02794",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P02794"
}
]
},
{
"ec_number": "1.16.3.1",
"activity": "",
"evidence": [
{
"id": "P02794",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P02794"
}
]
}
]
},
{
"uniprot_ac": "P04040",
"gene_name": "CAT",
"activity": [
{
"ec_number": "1.11.1.6",
"activity": "2 H2O2 = 2 H2O + O2.",
"evidence": [
{
"id": "P04040",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P04040"
}
]
},
{
"ec_number": "1.11.1.6",
"activity": "",
"evidence": [
{
"id": "P04040",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P04040"
}
]
}
]
},
{
"uniprot_ac": "P04075",
"gene_name": "ALDOA",
"activity": [
{
"ec_number": "4.1.2.13",
"activity": "beta-D-fructose 1,6-bisphosphate = D-glyceraldehyde 3-phosphate + dihydroxyacetone phosphate.",
"evidence": [
{
"id": "P04075",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P04075"
}
]
},
{
"ec_number": "4.1.2.13",
"activity": "",
"evidence": [
{
"id": "P04075",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P04075"
}
]
}
]
},
{
"uniprot_ac": "P06737",
"gene_name": "PYGL",
"activity": [
{
"ec_number": "2.4.1.1",
"activity": "[(1->4)-alpha-D-glucosyl](n) + phosphate = [(1->4)-alpha-D-glucosyl](n-1) + alpha-D-glucose 1-phosphate.",
"evidence": [
{
"id": "P06737",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P06737"
}
]
},
{
"ec_number": "2.4.1.1",
"activity": "",
"evidence": [
{
"id": "P06737",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P06737"
}
]
}
]
},
{
"uniprot_ac": "P06744",
"gene_name": "GPI",
"activity": [
{
"ec_number": "5.3.1.9",
"activity": "alpha-D-glucose 6-phosphate = beta-D-fructose 6-phosphate.",
"evidence": [
{
"id": "P06744",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P06744"
}
]
},
{
"ec_number": "5.3.1.9",
"activity": "",
"evidence": [
{
"id": "P06744",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P06744"
}
]
}
]
},
{
"uniprot_ac": "P07339",
"gene_name": "CTSD",
"activity": [
{
"ec_number": "3.4.23.5",
"activity": "Specificity similar to, but narrower than, that of pepsin A. Does not cleave the 4-Gln-|-His-5 bond in B chain of insulin.",
"evidence": [
{
"id": "P07339",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P07339"
}
]
},
{
"ec_number": "3.4.23.5",
"activity": "",
"evidence": [
{
"id": "P07339",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P07339"
}
]
}
]
},
{
"uniprot_ac": "P07384",
"gene_name": "CAPN1",
"activity": [
{
"ec_number": "3.4.22.52",
"activity": "Broad endopeptidase specificity.",
"evidence": [
{
"id": "P07384",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P07384"
}
]
},
{
"ec_number": "3.4.22.52",
"activity": "",
"evidence": [
{
"id": "P07384",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P07384"
}
]
}
]
},
{
"uniprot_ac": "P07741",
"gene_name": "APRT",
"activity": [
{
"ec_number": "2.4.2.7",
"activity": "AMP + diphosphate = 5-phospho-alpha-D-ribose 1-diphosphate + adenine.",
"evidence": [
{
"id": "P07741",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P07741"
}
]
},
{
"ec_number": "2.4.2.7",
"activity": "",
"evidence": [
{
"id": "P07741",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P07741"
}
]
}
]
},
{
"uniprot_ac": "P07858",
"gene_name": "CTSB",
"activity": [
{
"ec_number": "3.4.22.1",
"activity": "Hydrolysis of proteins with broad specificity for peptide bonds. Preferentially cleaves -Arg-Arg-|-Xaa bonds in small molecule substrates (thus differing from cathepsin L). In addition to being an endopeptidase, shows peptidyl-dipeptidase activity, liberating C-terminal dipeptides.",
"evidence": [
{
"id": "P07858",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P07858"
}
]
},
{
"ec_number": "3.4.22.1",
"activity": "",
"evidence": [
{
"id": "P07858",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P07858"
}
]
}
]
},
{
"uniprot_ac": "P07900",
"gene_name": "HSP90AA1",
"activity": [
{
"ec_number": "3.6.4.10",
"activity": "ATP + H2O = ADP + H(+) + phosphate.",
"evidence": [
{
"id": "P07900",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P07900"
}
]
},
{
"ec_number": "3.6.4.10",
"activity": "",
"evidence": [
{
"id": "P07900",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P07900"
}
]
}
]
},
{
"uniprot_ac": "P08236",
"gene_name": "GUSB",
"activity": [
{
"ec_number": "3.2.1.31",
"activity": "a beta-D-glucuronoside + H2O = an alcohol + D-glucuronate.",
"evidence": [
{
"id": "P08236",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P08236"
}
]
},
{
"ec_number": "3.2.1.31",
"activity": "",
"evidence": [
{
"id": "P08236",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P08236"
}
]
}
]
},
{
"uniprot_ac": "P09211",
"gene_name": "GSTP1",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "P09211",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P09211"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "P09211",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P09211"
}
]
}
]
},
{
"uniprot_ac": "P09769",
"gene_name": "FGR",
"activity": [
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P09769",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P09769"
}
]
},
{
"ec_number": "2.7.10.2",
"activity": "",
"evidence": [
{
"id": "P09769",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P09769"
}
]
}
]
},
{
"uniprot_ac": "P09917",
"gene_name": "ALOX5",
"activity": [
{
"ec_number": "1.13.11.-",
"activity": "",
"evidence": [
{
"id": "P09917",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P09917"
}
]
},
{
"ec_number": "1.13.11.34",
"activity": "(5Z,8Z,11Z,14Z)-eicosatetraenoate + O2 = H2O + leukotriene A4.",
"evidence": [
{
"id": "P09917",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P09917"
}
]
}
]
},
{
"uniprot_ac": "P09960",
"gene_name": "LTA4H",
"activity": [
{
"ec_number": "3.3.2.6",
"activity": "H2O + leukotriene A4 = leukotriene B4.",
"evidence": [
{
"id": "P09960",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P09960"
}
]
},
{
"ec_number": "3.4.11.4",
"activity": "Release of the N-terminal residue from a tripeptide.",
"evidence": [
{
"id": "P09960",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P09960"
}
]
},
{
"ec_number": "3.3.2.6",
"activity": "",
"evidence": [
{
"id": "P09960",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P09960"
}
]
}
]
},
{
"uniprot_ac": "P09972",
"gene_name": "ALDOC",
"activity": [
{
"ec_number": "4.1.2.13",
"activity": "beta-D-fructose 1,6-bisphosphate = D-glyceraldehyde 3-phosphate + dihydroxyacetone phosphate.",
"evidence": [
{
"id": "P09972",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P09972"
}
]
},
{
"ec_number": "4.1.2.13",
"activity": "",
"evidence": [
{
"id": "P09972",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P09972"
}
]
}
]
},
{
"uniprot_ac": "P11142",
"gene_name": "HSPA8",
"activity": [
{
"ec_number": "3.6.4.10",
"activity": "ATP + H2O = ADP + H(+) + phosphate.",
"evidence": [
{
"id": "P11142",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P11142"
}
]
},
{
"ec_number": "3.6.4.10",
"activity": "",
"evidence": [
{
"id": "P11142",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P11142"
}
]
}
]
},
{
"uniprot_ac": "P11678",
"gene_name": "EPX",
"activity": [
{
"ec_number": "1.11.1.7",
"activity": "2 a phenolic donor + H2O2 = 2 a phenolic radical donor + 2 H2O.",
"evidence": [
{
"id": "P11678",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P11678"
}
]
},
{
"ec_number": "1.11.1.7",
"activity": "",
"evidence": [
{
"id": "P11678",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P11678"
}
]
}
]
},
{
"uniprot_ac": "P12268",
"gene_name": "IMPDH2",
"activity": [
{
"ec_number": "1.1.1.205",
"activity": "H2O + IMP + NAD(+) = H(+) + NADH + XMP.",
"evidence": [
{
"id": "P12268",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P12268"
}
]
},
{
"ec_number": "1.1.1.205",
"activity": "",
"evidence": [
{
"id": "P12268",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P12268"
}
]
}
]
},
{
"uniprot_ac": "P12527",
"gene_name": "Alox5",
"activity": [
{
"ec_number": "1.13.11.-",
"activity": "",
"evidence": [
{
"id": "P12527",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P12527"
}
]
},
{
"ec_number": "1.13.11.34",
"activity": "(5Z,8Z,11Z,14Z)-eicosatetraenoate + O2 = H2O + leukotriene A4.",
"evidence": [
{
"id": "P12527",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P12527"
}
]
}
]
},
{
"uniprot_ac": "P12956",
"gene_name": "XRCC6",
"activity": [
{
"ec_number": "4.2.99.-",
"activity": "",
"evidence": [
{
"id": "P12956",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P12956"
}
]
},
{
"ec_number": "3.6.4.-",
"activity": "",
"evidence": [
{
"id": "P12956",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P12956"
}
]
}
]
},
{
"uniprot_ac": "P13010",
"gene_name": "XRCC5",
"activity": [
{
"ec_number": "3.6.4.-",
"activity": "",
"evidence": [
{
"id": "P13010",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P13010"
}
]
}
]
},
{
"uniprot_ac": "P13639",
"gene_name": "EEF2",
"activity": [
{
"ec_number": "3.6.5.-",
"activity": "",
"evidence": [
{
"id": "P13639",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P13639"
}
]
}
]
},
{
"uniprot_ac": "P13716",
"gene_name": "ALAD",
"activity": [
{
"ec_number": "4.2.1.24",
"activity": "2 5-aminolevulinate = H(+) + 2 H2O + porphobilinogen.",
"evidence": [
{
"id": "P13716",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P13716"
}
]
},
{
"ec_number": "4.2.1.24",
"activity": "",
"evidence": [
{
"id": "P13716",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P13716"
}
]
}
]
},
{
"uniprot_ac": "P13798",
"gene_name": "APEH",
"activity": [
{
"ec_number": "3.4.19.1",
"activity": "Internal cleavage of oxidized and glycated proteins.",
"evidence": [
{
"id": "P13798",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P13798"
}
]
},
{
"ec_number": "3.4.19.1",
"activity": "",
"evidence": [
{
"id": "P13798",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P13798"
}
]
}
]
},
{
"uniprot_ac": "P14174",
"gene_name": "MIF",
"activity": [
{
"ec_number": "5.3.2.1",
"activity": "3-phenylpyruvate = enol-phenylpyruvate.",
"evidence": [
{
"id": "P14174",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P14174"
}
]
},
{
"ec_number": "5.3.3.12",
"activity": "L-dopachrome = 5,6-dihydroxyindole-2-carboxylate.",
"evidence": [
{
"id": "P14174",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P14174"
}
]
},
{
"ec_number": "5.3.2.1",
"activity": "",
"evidence": [
{
"id": "P14174",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P14174"
}
]
}
]
},
{
"uniprot_ac": "P14618",
"gene_name": "PKM",
"activity": [
{
"ec_number": "2.7.1.40",
"activity": "CTP + pyruvate = CDP + H(+) + phosphoenolpyruvate.",
"evidence": [
{
"id": "P14618",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P14618"
}
]
},
{
"ec_number": "2.7.1.40",
"activity": "",
"evidence": [
{
"id": "P14618",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P14618"
}
]
},
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P14618",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P14618"
}
]
},
{
"ec_number": "2.7.11.1",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "P14618",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P14618"
}
]
}
]
},
{
"uniprot_ac": "P14780",
"gene_name": "MMP9",
"activity": [
{
"ec_number": "3.4.24.35",
"activity": "Cleavage of gelatin types I and V and collagen types IV and V.",
"evidence": [
{
"id": "P14780",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P14780"
}
]
},
{
"ec_number": "3.4.24.35",
"activity": "",
"evidence": [
{
"id": "P14780",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P14780"
}
]
}
]
},
{
"uniprot_ac": "P15586",
"gene_name": "GNS",
"activity": [
{
"ec_number": "3.1.6.14",
"activity": "Hydrolysis of the 6-sulfate groups of the N-acetyl-D-glucosamine 6-sulfate units of heparan sulfate and keratan sulfate.",
"evidence": [
{
"id": "P15586",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P15586"
}
]
},
{
"ec_number": "3.1.6.14",
"activity": "",
"evidence": [
{
"id": "P15586",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P15586"
}
]
}
]
},
{
"uniprot_ac": "P15848",
"gene_name": "ARSB",
"activity": [
{
"ec_number": "3.1.6.12",
"activity": "Hydrolysis of the 4-sulfate groups of the N-acetyl-D-galactosamine 4-sulfate units of chondroitin sulfate and dermatan sulfate.",
"evidence": [
{
"id": "P15848",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P15848"
}
]
},
{
"ec_number": "3.1.6.12",
"activity": "",
"evidence": [
{
"id": "P15848",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P15848"
}
]
}
]
},
{
"uniprot_ac": "P16050",
"gene_name": "ALOX15",
"activity": [
{
"ec_number": "1.13.11.-",
"activity": "",
"evidence": [
{
"id": "P16050",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P16050"
}
]
},
{
"ec_number": "1.13.11.31",
"activity": "(5Z,8Z,11Z,14Z)-eicosatetraenoate + O2 = (12S)-hydroperoxy-(5Z,8Z,10E,14Z)-eicosatetraenoate.",
"evidence": [
{
"id": "P16050",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P16050"
}
]
},
{
"ec_number": "1.13.11.33",
"activity": "(5Z,8Z,11Z,14Z)-eicosatetraenoate + O2 = (15S)-hydroperoxy-(5Z,8Z,11Z,13E)-eicosatetraenoate.",
"evidence": [
{
"id": "P16050",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P16050"
}
]
},
{
"ec_number": "1.13.11.12",
"activity": "(9Z,12Z,15Z)-octadecatrienoate + O2 = (13S)-hydroperoxy-(9Z,11E,15Z)-octadecatrienoate.",
"evidence": [
{
"id": "P16050",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P16050"
}
]
}
]
},
{
"uniprot_ac": "P16278",
"gene_name": "GLB1",
"activity": [
{
"ec_number": "3.2.1.23",
"activity": "Hydrolysis of terminal non-reducing beta-D-galactose residues in beta-D-galactosides.",
"evidence": [
{
"id": "P16278",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P16278"
}
]
},
{
"ec_number": "3.2.1.23",
"activity": "",
"evidence": [
{
"id": "P16278",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P16278"
}
]
}
]
},
{
"uniprot_ac": "P17858",
"gene_name": "PFKL",
"activity": [
{
"ec_number": "2.7.1.11",
"activity": "ATP + beta-D-fructose 6-phosphate = ADP + beta-D-fructose 1,6-bisphosphate + H(+).",
"evidence": [
{
"id": "P17858",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P17858"
}
]
},
{
"ec_number": "2.7.1.11",
"activity": "",
"evidence": [
{
"id": "P17858",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P17858"
}
]
}
]
},
{
"uniprot_ac": "P18054",
"gene_name": "ALOX12",
"activity": [
{
"ec_number": "1.13.11.-",
"activity": "",
"evidence": [
{
"id": "P18054",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P18054"
}
]
},
{
"ec_number": "1.13.11.31",
"activity": "(5Z,8Z,11Z,14Z)-eicosatetraenoate + O2 = (12S)-hydroperoxy-(5Z,8Z,10E,14Z)-eicosatetraenoate.",
"evidence": [
{
"id": "P18054",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P18054"
}
]
},
{
"ec_number": "3.3.2.-",
"activity": "",
"evidence": [
{
"id": "P18054",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P18054"
}
]
},
{
"ec_number": "1.13.11.33",
"activity": "(5Z,8Z,11Z,14Z)-eicosatetraenoate + O2 = (15S)-hydroperoxy-(5Z,8Z,11Z,13E)-eicosatetraenoate.",
"evidence": [
{
"id": "P18054",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P18054"
}
]
}
]
},
{
"uniprot_ac": "P18669",
"gene_name": "PGAM1",
"activity": [
{
"ec_number": "5.4.2.11",
"activity": "(2R)-2-phosphoglycerate = (2R)-3-phosphoglycerate.",
"evidence": [
{
"id": "P18669",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P18669"
}
]
},
{
"ec_number": "5.4.2.4",
"activity": "(2R)-3-phospho-glyceroyl phosphate = (2R)-2,3-bisphosphoglycerate + H(+).",
"evidence": [
{
"id": "P18669",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P18669"
}
]
},
{
"ec_number": "5.4.2.4",
"activity": "",
"evidence": [
{
"id": "P18669",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P18669"
}
]
},
{
"ec_number": "5.4.2.11",
"activity": "",
"evidence": [
{
"id": "P18669",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P18669"
}
]
}
]
},
{
"uniprot_ac": "P20839",
"gene_name": "IMPDH1",
"activity": [
{
"ec_number": "1.1.1.205",
"activity": "H2O + IMP + NAD(+) = H(+) + NADH + XMP.",
"evidence": [
{
"id": "P20839",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P20839"
}
]
},
{
"ec_number": "1.1.1.205",
"activity": "",
"evidence": [
{
"id": "P20839",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P20839"
}
]
}
]
},
{
"uniprot_ac": "P22392",
"gene_name": "NME2",
"activity": [
{
"ec_number": "2.7.4.6",
"activity": "a ribonucleoside 5'-diphosphate + ATP = a ribonucleoside 5'-triphosphate + ADP.",
"evidence": [
{
"id": "P22392",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P22392"
}
]
},
{
"ec_number": "2.7.13.3",
"activity": "ATP + protein L-histidine = ADP + protein N-phospho-L-histidine.",
"evidence": [
{
"id": "P22392",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P22392"
}
]
},
{
"ec_number": "2.7.4.6",
"activity": "",
"evidence": [
{
"id": "P22392",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P22392"
}
]
},
{
"ec_number": "2.7.13.3",
"activity": "",
"evidence": [
{
"id": "P22392",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P22392"
}
]
}
]
},
{
"uniprot_ac": "P25774",
"gene_name": "CTSS",
"activity": [
{
"ec_number": "3.4.22.27",
"activity": "Similar to cathepsin L, but with much less activity on Z-Phe-Arg-|-NHMec, and more activity on the Z-Val-Val-Arg-|-Xaa compound.",
"evidence": [
{
"id": "P25774",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P25774"
}
]
},
{
"ec_number": "3.4.22.27",
"activity": "",
"evidence": [
{
"id": "P25774",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P25774"
}
]
}
]
},
{
"uniprot_ac": "P28482",
"gene_name": "MAPK1",
"activity": [
{
"ec_number": "2.7.11.24",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "P28482",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P28482"
}
]
},
{
"ec_number": "2.7.11.24",
"activity": "",
"evidence": [
{
"id": "P28482",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P28482"
}
]
}
]
},
{
"uniprot_ac": "P32320",
"gene_name": "CDA",
"activity": [
{
"ec_number": "3.5.4.5",
"activity": "2'-deoxycytidine + H(+) + H2O = 2'-deoxyuridine + NH4(+).",
"evidence": [
{
"id": "P32320",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P32320"
}
]
},
{
"ec_number": "3.5.4.5",
"activity": "",
"evidence": [
{
"id": "P32320",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P32320"
}
]
}
]
},
{
"uniprot_ac": "P36871",
"gene_name": "PGM1",
"activity": [
{
"ec_number": "5.4.2.2",
"activity": "alpha-D-glucose 1-phosphate = alpha-D-glucose 6-phosphate.",
"evidence": [
{
"id": "P36871",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P36871"
}
]
},
{
"ec_number": "5.4.2.2",
"activity": "",
"evidence": [
{
"id": "P36871",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P36871"
}
]
}
]
},
{
"uniprot_ac": "P39654",
"gene_name": "Alox15",
"activity": [
{
"ec_number": "1.13.11.-",
"activity": "",
"evidence": [
{
"id": "P39654",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P39654"
}
]
},
{
"ec_number": "1.13.11.31",
"activity": "(5Z,8Z,11Z,14Z)-eicosatetraenoate + O2 = (12S)-hydroperoxy-(5Z,8Z,10E,14Z)-eicosatetraenoate.",
"evidence": [
{
"id": "P39654",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P39654"
}
]
},
{
"ec_number": "1.13.11.33",
"activity": "(5Z,8Z,11Z,14Z)-eicosatetraenoate + O2 = (15S)-hydroperoxy-(5Z,8Z,11Z,13E)-eicosatetraenoate.",
"evidence": [
{
"id": "P39654",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P39654"
}
]
},
{
"ec_number": "1.13.11.12",
"activity": "(9Z,12Z,15Z)-octadecatrienoate + O2 = (13S)-hydroperoxy-(9Z,11E,15Z)-octadecatrienoate.",
"evidence": [
{
"id": "P39654",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P39654"
}
]
}
]
},
{
"uniprot_ac": "P39655",
"gene_name": "Alox12",
"activity": [
{
"ec_number": "1.13.11.-",
"activity": "",
"evidence": [
{
"id": "P39655",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P39655"
}
]
},
{
"ec_number": "1.13.11.31",
"activity": "(5Z,8Z,11Z,14Z)-eicosatetraenoate + O2 = (12S)-hydroperoxy-(5Z,8Z,10E,14Z)-eicosatetraenoate.",
"evidence": [
{
"id": "P39655",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P39655"
}
]
},
{
"ec_number": "3.3.2.-",
"activity": "",
"evidence": [
{
"id": "P39655",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P39655"
}
]
},
{
"ec_number": "1.13.11.33",
"activity": "(5Z,8Z,11Z,14Z)-eicosatetraenoate + O2 = (15S)-hydroperoxy-(5Z,8Z,11Z,13E)-eicosatetraenoate.",
"evidence": [
{
"id": "P39655",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P39655"
}
]
}
]
},
{
"uniprot_ac": "P46976",
"gene_name": "GYG1",
"activity": [
{
"ec_number": "2.4.1.186",
"activity": "[1,4-alpha-D-glucosyl](n)-L-tyrosyl-[glycogenin] + UDP-alpha-D-glucose = [1,4-alpha-D-glucosyl](n+1)-L-tyrosyl-[glycogenin] + H(+) + UDP.",
"evidence": [
{
"id": "P46976",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P46976"
}
]
},
{
"ec_number": "2.4.1.186",
"activity": "",
"evidence": [
{
"id": "P46976",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P46976"
}
]
}
]
},
{
"uniprot_ac": "P48999",
"gene_name": "Alox5",
"activity": [
{
"ec_number": "1.13.11.-",
"activity": "",
"evidence": [
{
"id": "P48999",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P48999"
}
]
},
{
"ec_number": "1.13.11.34",
"activity": "(5Z,8Z,11Z,14Z)-eicosatetraenoate + O2 = H2O + leukotriene A4.",
"evidence": [
{
"id": "P48999",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P48999"
}
]
}
]
},
{
"uniprot_ac": "P49137",
"gene_name": "MAPKAPK2",
"activity": [
{
"ec_number": "2.7.11.1",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "P49137",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P49137"
}
]
},
{
"ec_number": "2.7.11.1",
"activity": "",
"evidence": [
{
"id": "P49137",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P49137"
}
]
}
]
},
{
"uniprot_ac": "P52790",
"gene_name": "HK3",
"activity": [
{
"ec_number": "2.7.1.1",
"activity": "ATP + D-fructose = ADP + D-fructose 6-phosphate + H(+).",
"evidence": [
{
"id": "P52790",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P52790"
}
]
},
{
"ec_number": "2.7.1.1",
"activity": "",
"evidence": [
{
"id": "P52790",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P52790"
}
]
},
{
"ec_number": "2.7.1.-",
"activity": "",
"evidence": [
{
"id": "P52790",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P52790"
}
]
}
]
},
{
"uniprot_ac": "P53396",
"gene_name": "ACLY",
"activity": [
{
"ec_number": "2.3.3.8",
"activity": "acetyl-CoA + ADP + oxaloacetate + phosphate = ATP + citrate + CoA.",
"evidence": [
{
"id": "P53396",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P53396"
}
]
},
{
"ec_number": "2.3.3.8",
"activity": "",
"evidence": [
{
"id": "P53396",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P53396"
}
]
}
]
},
{
"uniprot_ac": "P55072",
"gene_name": "VCP",
"activity": [
{
"ec_number": "3.6.4.6",
"activity": "ATP + H2O = ADP + H(+) + phosphate.",
"evidence": [
{
"id": "P55072",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P55072"
}
]
},
{
"ec_number": "3.6.4.6",
"activity": "",
"evidence": [
{
"id": "P55072",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P55072"
}
]
}
]
},
{
"uniprot_ac": "P55249",
"gene_name": "Alox12e",
"activity": [
{
"ec_number": "1.13.11.-",
"activity": "",
"evidence": [
{
"id": "P55249",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P55249"
}
]
},
{
"ec_number": "1.13.11.31",
"activity": "(5Z,8Z,11Z,14Z)-eicosatetraenoate + O2 = (12S)-hydroperoxy-(5Z,8Z,10E,14Z)-eicosatetraenoate.",
"evidence": [
{
"id": "P55249",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P55249"
}
]
}
]
},
{
"uniprot_ac": "P62937",
"gene_name": "PPIA",
"activity": [
{
"ec_number": "5.2.1.8",
"activity": "[protein]-peptidylproline (omega=180) = [protein]-peptidylproline (omega=0).",
"evidence": [
{
"id": "P62937",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P62937"
}
]
},
{
"ec_number": "5.2.1.8",
"activity": "",
"evidence": [
{
"id": "P62937",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P62937"
}
]
}
]
},
{
"uniprot_ac": "P68104",
"gene_name": "EEF1A1",
"activity": [
{
"ec_number": "3.6.5.-",
"activity": "",
"evidence": [
{
"id": "P68104",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P68104"
}
]
}
]
},
{
"uniprot_ac": "P68402",
"gene_name": "PAFAH1B2",
"activity": [
{
"ec_number": "3.1.1.47",
"activity": "a 1-O-alkyl-2-acetyl-sn-glycero-3-phosphocholine + H2O = 1-O-alkyl-sn-glycero-3-phosphocholine + acetate + H(+).",
"evidence": [
{
"id": "P68402",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P68402"
}
]
},
{
"ec_number": "3.1.1.47",
"activity": "",
"evidence": [
{
"id": "P68402",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P68402"
}
]
}
]
},
{
"uniprot_ac": "P98066",
"gene_name": "TNFAIP6",
"activity": [
{
"ec_number": "3.1.1.-",
"activity": "",
"evidence": [
{
"id": "P98066",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P98066"
}
]
}
]
},
{
"uniprot_ac": "Q01432",
"gene_name": "AMPD3",
"activity": [
{
"ec_number": "3.5.4.6",
"activity": "AMP + H(+) + H2O = IMP + NH4(+).",
"evidence": [
{
"id": "Q01432",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q01432"
}
]
},
{
"ec_number": "3.5.4.6",
"activity": "",
"evidence": [
{
"id": "Q01432",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q01432"
}
]
}
]
},
{
"uniprot_ac": "Q02759",
"gene_name": "Alox15",
"activity": [
{
"ec_number": "1.13.11.-",
"activity": "",
"evidence": [
{
"id": "Q02759",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q02759"
}
]
},
{
"ec_number": "1.13.11.31",
"activity": "(5Z,8Z,11Z,14Z)-eicosatetraenoate + O2 = (12S)-hydroperoxy-(5Z,8Z,10E,14Z)-eicosatetraenoate.",
"evidence": [
{
"id": "Q02759",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q02759"
}
]
},
{
"ec_number": "1.13.11.33",
"activity": "(5Z,8Z,11Z,14Z)-eicosatetraenoate + O2 = (15S)-hydroperoxy-(5Z,8Z,11Z,13E)-eicosatetraenoate.",
"evidence": [
{
"id": "Q02759",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q02759"
}
]
},
{
"ec_number": "1.13.11.12",
"activity": "(9Z,12Z,15Z)-octadecatrienoate + O2 = (13S)-hydroperoxy-(9Z,11E,15Z)-octadecatrienoate.",
"evidence": [
{
"id": "Q02759",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q02759"
}
]
},
{
"ec_number": "1.13.11.33",
"activity": "",
"evidence": [
{
"id": "Q02759",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q02759"
}
]
},
{
"ec_number": "1.13.11.12",
"activity": "",
"evidence": [
{
"id": "Q02759",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q02759"
}
]
},
{
"ec_number": "1.13.11.31",
"activity": "",
"evidence": [
{
"id": "Q02759",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q02759"
}
]
}
]
},
{
"uniprot_ac": "Q13162",
"gene_name": "PRDX4",
"activity": [
{
"ec_number": "1.11.1.24",
"activity": "[thioredoxin]-dithiol + a hydroperoxide = [thioredoxin]-disulfide + an alcohol + H2O.",
"evidence": [
{
"id": "Q13162",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q13162"
}
]
},
{
"ec_number": "1.11.1.24",
"activity": "",
"evidence": [
{
"id": "Q13162",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q13162"
}
]
}
]
},
{
"uniprot_ac": "Q13464",
"gene_name": "ROCK1",
"activity": [
{
"ec_number": "2.7.11.1",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "Q13464",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q13464"
}
]
},
{
"ec_number": "2.7.11.1",
"activity": "",
"evidence": [
{
"id": "Q13464",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q13464"
}
]
}
]
},
{
"uniprot_ac": "Q13510",
"gene_name": "ASAH1",
"activity": [
{
"ec_number": "3.5.1.23",
"activity": "an N-acylsphing-4-enine + H2O = a fatty acid + sphing-4-enine.",
"evidence": [
{
"id": "Q13510",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q13510"
}
]
},
{
"ec_number": "3.5.1.23",
"activity": "",
"evidence": [
{
"id": "Q13510",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q13510"
}
]
},
{
"ec_number": "3.5.1.-",
"activity": "",
"evidence": [
{
"id": "Q13510",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q13510"
}
]
}
]
},
{
"uniprot_ac": "Q14004",
"gene_name": "CDK13",
"activity": [
{
"ec_number": "2.7.11.22",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "Q14004",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q14004"
}
]
},
{
"ec_number": "2.7.11.23",
"activity": "[DNA-directed RNA polymerase] + ATP = ADP + H(+) + phospho-[DNA-directed RNA polymerase].",
"evidence": [
{
"id": "Q14004",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q14004"
}
]
},
{
"ec_number": "2.7.11.22",
"activity": "",
"evidence": [
{
"id": "Q14004",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q14004"
}
]
},
{
"ec_number": "2.7.11.23",
"activity": "",
"evidence": [
{
"id": "Q14004",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q14004"
}
]
}
]
},
{
"uniprot_ac": "Q16539",
"gene_name": "MAPK14",
"activity": [
{
"ec_number": "2.7.11.24",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "Q16539",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q16539"
}
]
},
{
"ec_number": "2.7.11.24",
"activity": "",
"evidence": [
{
"id": "Q16539",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q16539"
}
]
}
]
},
{
"uniprot_ac": "Q16769",
"gene_name": "QPCT",
"activity": [
{
"ec_number": "2.3.2.5",
"activity": "N-terminal L-glutaminyl-[peptide] = N-terminal 5-oxo-L-prolyl-[peptide] + NH4(+).",
"evidence": [
{
"id": "Q16769",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q16769"
}
]
},
{
"ec_number": "2.3.2.5",
"activity": "",
"evidence": [
{
"id": "Q16769",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q16769"
}
]
}
]
},
{
"uniprot_ac": "Q16873",
"gene_name": "LTC4S",
"activity": [
{
"ec_number": "4.4.1.20",
"activity": "leukotriene C4 = glutathione + leukotriene A4.",
"evidence": [
{
"id": "Q16873",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q16873"
}
]
},
{
"ec_number": "4.4.1.20",
"activity": "",
"evidence": [
{
"id": "Q16873",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q16873"
}
]
},
{
"ec_number": "2.5.1.-",
"activity": "",
"evidence": [
{
"id": "Q16873",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q16873"
}
]
}
]
},
{
"uniprot_ac": "Q7Z6Z7",
"gene_name": "HUWE1",
"activity": [
{
"ec_number": "2.3.2.26",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q7Z6Z7",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q7Z6Z7"
}
]
},
{
"ec_number": "2.3.2.26",
"activity": "",
"evidence": [
{
"id": "Q7Z6Z7",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q7Z6Z7"
}
]
}
]
},
{
"uniprot_ac": "Q8WVQ1",
"gene_name": "CANT1",
"activity": [
{
"ec_number": "3.6.1.6",
"activity": "ADP + H2O = AMP + H(+) + phosphate.",
"evidence": [
{
"id": "Q8WVQ1",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8WVQ1"
}
]
},
{
"ec_number": "3.6.1.6",
"activity": "",
"evidence": [
{
"id": "Q8WVQ1",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8WVQ1"
}
]
}
]
},
{
"uniprot_ac": "Q96G03",
"gene_name": "PGM2",
"activity": [
{
"ec_number": "5.4.2.2",
"activity": "alpha-D-glucose 1-phosphate = alpha-D-glucose 6-phosphate.",
"evidence": [
{
"id": "Q96G03",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q96G03"
}
]
},
{
"ec_number": "5.4.2.7",
"activity": "2-deoxy-alpha-D-ribose 1-phosphate = 2-deoxy-D-ribose 5-phosphate.",
"evidence": [
{
"id": "Q96G03",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q96G03"
}
]
},
{
"ec_number": "5.4.2.7",
"activity": "",
"evidence": [
{
"id": "Q96G03",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q96G03"
}
]
}
]
},
{
"uniprot_ac": "Q99436",
"gene_name": "PSMB7",
"activity": [
{
"ec_number": "3.4.25.1",
"activity": "Cleavage of peptide bonds with very broad specificity.",
"evidence": [
{
"id": "Q99436",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q99436"
}
]
},
{
"ec_number": "3.4.25.1",
"activity": "",
"evidence": [
{
"id": "Q99436",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q99436"
}
]
}
]
},
{
"uniprot_ac": "Q9P0J7",
"gene_name": "KCMF1",
"activity": [
{
"ec_number": "2.3.2.27",
"activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
"evidence": [
{
"id": "Q9P0J7",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9P0J7"
}
]
},
{
"ec_number": "2.3.2.27",
"activity": "",
"evidence": [
{
"id": "Q9P0J7",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9P0J7"
}
]
}
]
},
{
"uniprot_ac": "Q9UBR2",
"gene_name": "CTSZ",
"activity": [
{
"ec_number": "3.4.18.1",
"activity": "Release of C-terminal amino acid residues with broad specificity, but lacks action on C-terminal proline. Shows weak endopeptidase activity.",
"evidence": [
{
"id": "Q9UBR2",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9UBR2"
}
]
},
{
"ec_number": "3.4.18.1",
"activity": "",
"evidence": [
{
"id": "Q9UBR2",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9UBR2"
}
]
}
]
},
{
"uniprot_ac": "Q9UNP9",
"gene_name": "PPIE",
"activity": [
{
"ec_number": "5.2.1.8",
"activity": "[protein]-peptidylproline (omega=180) = [protein]-peptidylproline (omega=0).",
"evidence": [
{
"id": "Q9UNP9",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9UNP9"
}
]
},
{
"ec_number": "5.2.1.8",
"activity": "",
"evidence": [
{
"id": "Q9UNP9",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9UNP9"
}
]
}
]
},
{
"uniprot_ac": "Q9Y315",
"gene_name": "DERA",
"activity": [
{
"ec_number": "4.1.2.4",
"activity": "2-deoxy-D-ribose 5-phosphate = acetaldehyde + D-glyceraldehyde 3-phosphate.",
"evidence": [
{
"id": "Q9Y315",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9Y315"
}
]
},
{
"ec_number": "4.1.2.4",
"activity": "",
"evidence": [
{
"id": "Q9Y315",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9Y315"
}
]
}
]
}
],
"biomarkers": [],
"synthesized_glycans": [],
"cluster_types": [
{
"name": "isoformset.uniprotkb",
"label": "Isoforms"
},
{
"name": "homologset.mgi",
"label": "MGI Homologs"
},
{
"name": "homologset.oma",
"label": "OMA Homologs"
}
],
"sequence_features": {
"n_linked_sites": [],
"o_linked_sites": [],
"snv_sites": [
371
],
"glycation_sites": [],
"phosphorylation_sites": [
42,
53,
94,
271,
272,
445,
523,
524,
664
],
"sequon_annotation_sites": [
{
"start_pos": 181,
"end_pos": 183
},
{
"start_pos": 296,
"end_pos": 298
},
{
"start_pos": 426,
"end_pos": 428
}
]
},
"section_stats": [
{
"table_id": "glycosylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported_with_glycan",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_predicted",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_automatic_literature_mining",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "phosphorylation",
"table_stats": [
{
"field": "total",
"count": 14
},
{
"field": "total_sites",
"count": 9
}
],
"sort_fields": [
"start_pos",
"end_pos",
"kinase_uniprot_canonical_ac",
"kinase_gene_name",
"residue",
"comment",
"site_lbl"
]
},
{
"table_id": "snv",
"table_stats": [
{
"field": "total",
"count": 1
},
{
"field": "total_sites",
"count": 1
}
],
"sort_fields": [
"start_pos",
"end_pos",
"subjects_tested",
"subjects_positive",
"frequency",
"sequence_org",
"sequence_mut",
"comment",
"chr_id",
"chr_pos",
"ref_nt",
"alt_nt",
"minor_allelic_frequency",
"site_lbl"
]
},
{
"table_id": "snv_disease",
"table_stats": [
{
"field": "total",
"count": 1
},
{
"field": "total_sites",
"count": 1
}
],
"sort_fields": [
"start_pos",
"end_pos",
"subjects_tested",
"subjects_positive",
"frequency",
"sequence_org",
"sequence_mut",
"comment",
"chr_id",
"chr_pos",
"ref_nt",
"alt_nt",
"minor_allelic_frequency",
"site_lbl"
]
},
{
"table_id": "snv_non_disease",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "publication",
"table_stats": [
{
"field": "total",
"count": 207
}
],
"sort_fields": [
"title",
"journal",
"date",
"authors"
]
}
]
}