{ "uniprot_canonical_ac": "P08670-1", "uniprot_ac": "P08670", "uniprot_id": "VIME_HUMAN", "mass": { "chemical_mass": 53652.0, "monoisotopic_mass": 53652.0 }, "refseq": { "ac": "NP_003371", "name": "vimentin", "summary": "This gene encodes a type III intermediate filament protein. Intermediate filaments, along with microtubules and actin microfilaments, make up the cytoskeleton. The encoded protein is responsible for maintaining cell shape and integrity of the cytoplasm, and stabilizing cytoskeletal interactions. This protein is involved in neuritogenesis and cholesterol transport and functions as an organizer of a number of other critical proteins involved in cell attachment, migration, and signaling. Bacterial and viral pathogens have been shown to attach to this protein on the host cell surface. Mutations in this gene are associated with congenital cataracts in human patients. [provided by RefSeq, Aug 2017].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003371" }, "gene_names": [ { "name": "VIM", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P08670", "id": "P08670" }, { "name": "VIM", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003371", "id": "NP_003371" } ], "protein_names": [ { "name": "Vimentin", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P08670" }, { "name": "epididymis secretory sperm binding protein", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003371", "id": "NP_003371" }, { "name": "vimentin", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003371", "id": "NP_003371" } ], "function": [ { "annotation": "Circular RNA cVIM promotes hepatic stellate cell activation in liver fibrosis via miR-122-5p/miR-9-5p-mediated TGF-beta signaling cascade. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_003371", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003371" }, { "database": "PubMed", "id": "38243118", "url": "https://glygen.org/publication/PubMed/38243118" } ] }, { "annotation": "ENAH-202 promotes cancer progression in oral squamous cell carcinoma by regulating ZNF502/VIM axis.", "evidence": [ { "database": "RefSeq", "id": "NP_003371", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003371" }, { "database": "PubMed", "id": "37902191", "url": "https://glygen.org/publication/PubMed/37902191" } ] }, { "annotation": "FAM171B stabilizes vimentin and enhances CCL2-mediated TAM infiltration to promote bladder cancer progression. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_003371", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003371" }, { "database": "PubMed", "id": "37915048", "url": "https://glygen.org/publication/PubMed/37915048" } ] }, { "annotation": "Interaction of species A rotavirus VP4 with the cellular proteins vimentin and actin related protein 2 discovered by a proximity interactome assay.", "evidence": [ { "database": "RefSeq", "id": "NP_003371", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003371" }, { "database": "PubMed", "id": "37991368", "url": "https://glygen.org/publication/PubMed/37991368" } ] }, { "annotation": "Involved with LARP6 in the stabilization of type I collagen mRNAs for CO1A1 and CO1A2.", "evidence": [ { "database": "UniProtKB", "id": "B0YJC4", "url": "https://www.uniprot.org/uniprot/B0YJC4#function" }, { "database": "UniProtKB", "id": "ARBA00003885", "url": "https://www.uniprot.org/uniprot/ARBA00003885#function" }, { "database": "UniProtKB", "id": "A0A1B0GVG8", "url": "https://www.uniprot.org/uniprot/A0A1B0GVG8#function" }, { "database": "UniProtKB", "id": "P08670", "url": "https://www.uniprot.org/uniprot/P08670#function" }, { "database": "PubMed", "id": "21746880", "url": "https://glygen.org/publication/PubMed/21746880" }, { "database": "UniProtKB", "id": "A0A1B0GTT5", "url": "https://www.uniprot.org/uniprot/A0A1B0GTT5#function" } ] }, { "annotation": "Phosphorylated vimentin at Ser72 is associated with epithelial-mesenchymal transition in lupus nephritis.", "evidence": [ { "database": "RefSeq", "id": "NP_003371", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003371" }, { "database": "PubMed", "id": "38078507", "url": "https://glygen.org/publication/PubMed/38078507" } ] }, { "annotation": "This gene encodes a type III intermediate filament protein. Intermediate filaments, along with microtubules and actin microfilaments, make up the cytoskeleton. The encoded protein is responsible for maintaining cell shape and integrity of the cytoplasm, and stabilizing cytoskeletal interactions. This protein is involved in neuritogenesis and cholesterol transport and functions as an organizer of a number of other critical proteins involved in cell attachment, migration, and signaling. Bacterial and viral pathogens have been shown to attach to this protein on the host cell surface. Mutations in this gene are associated with congenital cataracts in human patients. [provided by RefSeq, Aug 2017].", "evidence": [ { "database": "RefSeq", "id": "NP_003371", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003371" } ] }, { "annotation": "Vimentins are class-III intermediate filaments found in various non-epithelial cells, especially mesenchymal cells. Vimentin is attached to the nucleus, endoplasmic reticulum, and mitochondria, either laterally or terminally.", "evidence": [ { "database": "UniProtKB", "id": "B0YJC4", "url": "https://www.uniprot.org/uniprot/B0YJC4#function" }, { "database": "UniProtKB", "id": "ARBA00002825", "url": "https://www.uniprot.org/uniprot/ARBA00002825#function" }, { "database": "UniProtKB", "id": "B0YJC5", "url": "https://www.uniprot.org/uniprot/B0YJC5#function" }, { "database": "UniProtKB", "id": "P08670", "url": "https://www.uniprot.org/uniprot/P08670#function" }, { "database": "UniProtKB", "id": "P31000", "url": "https://www.uniprot.org/uniprot/P31000#function" }, { "database": "UniProtKB", "id": "A0A1B0GTT5", "url": "https://www.uniprot.org/uniprot/A0A1B0GTT5#function" } ] } ], "disease": [ { "disease_id": "DOID:0110248", "recommended_name": { "id": "DOID:0110248", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0110248", "name": "cataract 30", "description": "A cataract that has_material_basis_in heterozygous mutation in the VIM gene on chromosome 10p13." }, "synonyms": [ { "id": "DOID:0110248", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0110248", "name": "CTRCT30", "description": "" }, { "id": "DOID:0110248", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0110248", "name": "Dusty cataract", "description": "" }, { "id": "DOID:0110248", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0110248", "name": "cataract 30 pulverulent", "description": "" }, { "id": "DOID:0110248", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0110248", "name": "cataract Coppock-like", "description": "" }, { "id": "MONDO:0007286", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007286", "name": "cataract 30", "description": "A cataract that has material basis in heterozygous mutation in the VIM gene on chromosome 10p13." }, { "id": "MONDO:0007286", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007286", "name": "CTRCT30", "description": "" }, { "id": "MONDO:0007286", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007286", "name": "cataract 30", "description": "" }, { "id": "MONDO:0007286", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007286", "name": "cataract 30 pulverulent", "description": "" }, { "id": "MONDO:0007286", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007286", "name": "cataract Coppock-like", "description": "" }, { "id": "MONDO:0007286", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007286", "name": "cataract type 30", "description": "" }, { "id": "MONDO:0007286", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007286", "name": "cataract 30, multiple types", "description": "" }, { "id": "MONDO:0007286", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007286", "name": "cataract 30, pulverulent", "description": "" }, { "id": "MIM:116300", "resource": "MIM", "url": "https://www.omim.org/entry/116300", "name": "Cataract 30, multiple types", "description": "Cataract 30, multiple types" } ], "evidence": [ { "id": "116300", "database": "MIM", "url": "https://www.omim.org/entry/116300" } ] } ], "snv": [ { "evidence": [ { "id": "rs1356941925", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1356941925" }, { "id": "rs1356941925", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1356941925" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 27, "end_pos": 27, "sequence_org": "S", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (SRS->NRS); o-glyco-site-loss (S->N).", "chr_id": "10", "chr_pos": "17229502", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S27", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1335964173", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1335964173" }, { "id": "rs1335964173", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1335964173" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 47, "end_pos": 47, "sequence_org": "S", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (STS->NTS); o-glyco-site-loss (S->N).", "chr_id": "10", "chr_pos": "17229562", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S47", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1312761190", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1312761190" }, { "id": "rs1312761190", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1312761190" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 49, "end_pos": 49, "sequence_org": "S", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (SRS->NRS); o-glyco-site-loss (S->N).", "chr_id": "10", "chr_pos": "17229568", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S49", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs902288870", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs902288870" }, { "id": "rs902288870", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs902288870#frequency_tab" }, { "id": "rs902288870", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs902288870" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 130, "end_pos": 130, "sequence_org": "I", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NKI->NKT).", "chr_id": "10", "chr_pos": "17229811", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "I130", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1200409133", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1200409133" }, { "id": "rs1200409133", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1200409133#frequency_tab" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 179, "end_pos": 179, "sequence_org": "A", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NLA->NLT).", "chr_id": "10", "chr_pos": "17229957", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "A179", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs866251474", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs866251474" }, { "id": "rs866251474", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs866251474" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 20, "end_pos": 20, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->I).", "chr_id": "10", "chr_pos": "17230691", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T20", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P08670", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P08670" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 22, "end_pos": 22, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "S", "sequence_mut": "I", "comment": "Somatic mutation passed 1 out of 6 filters: o-glyco-site-loss (S->I).", "chr_id": "10", "chr_pos": "17229487", "ref_nt": "G", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "S22", "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs1202092452", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1202092452" }, { "id": "rs1202092452", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1202092452" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 22, "end_pos": 22, "sequence_org": "S", "sequence_mut": "R", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->R).", "chr_id": "10", "chr_pos": "17229488", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S22", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs957631225", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs957631225" }, { "id": "rs957631225", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs957631225" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 25, "end_pos": 25, "sequence_org": "S", "sequence_mut": "R", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->R).", "chr_id": "10", "chr_pos": "17229497", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S25", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs775343323", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs775343323" }, { "id": "rs775343323", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs775343323" }, { "id": "rs775343323", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs775343323#frequency_tab" }, { "id": "rs775343323", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs775343323" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 27, "end_pos": 27, "sequence_org": "S", "sequence_mut": "G", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->G).", "chr_id": "10", "chr_pos": "17229501", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S27", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs775343323", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs775343323" }, { "id": "rs775343323", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs775343323" }, { "id": "rs775343323", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs775343323#frequency_tab" }, { "id": "rs775343323", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs775343323" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 27, "end_pos": 27, "sequence_org": "S", "sequence_mut": "R", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->R).", "chr_id": "10", "chr_pos": "17229501", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S27", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs11545546", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs11545546" }, { "id": "rs11545546", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs11545546" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 308, "end_pos": 308, "sequence_org": "A", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NDA->NDS).", "chr_id": "10", "chr_pos": "17234732", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "A308", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs11545546", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs11545546" }, { "id": "rs11545546", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs11545546" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 308, "end_pos": 308, "sequence_org": "A", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NDA->NDT).", "chr_id": "10", "chr_pos": "17234732", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "A308", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs763707422", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs763707422" }, { "id": "rs763707422", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs763707422" }, { "id": "rs763707422", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs763707422" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 33, "end_pos": 33, "sequence_org": "T", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->A).", "chr_id": "10", "chr_pos": "17229519", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T33", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P08670", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P08670" }, { "id": "rs1344328729", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1344328729" }, { "id": "rs1344328729", "database": "NCI-TCGA", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1344328729" }, { "id": "rs1344328729", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1344328729" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 33, "end_pos": 33, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "T", "sequence_mut": "M", "comment": "Somatic mutation passed 1 out of 6 filters: o-glyco-site-loss (T->M).", "chr_id": "10", "chr_pos": "17229520", "ref_nt": "C", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "T33", "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease", "ebi", "germline" ] }, { "evidence": [ { "id": "P08670", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P08670" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 352, "end_pos": 352, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "A", "sequence_mut": "T", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (NFA->NFT).", "chr_id": "10", "chr_pos": "17235214", "ref_nt": "G", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "A352", "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs756711607", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs756711607" }, { "id": "rs756711607", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs756711607" }, { "id": "rs756711607", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs756711607#frequency_tab" }, { "id": "rs756711607", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs756711607" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 35, "end_pos": 35, "sequence_org": "T", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->A).", "chr_id": "10", "chr_pos": "17229525", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T35", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P08670", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P08670" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 390, "end_pos": 390, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "K", "sequence_mut": "T", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (NVK->NVT).", "chr_id": "10", "chr_pos": "17235329", "ref_nt": "A", "alt_nt": "C", "minor_allelic_frequency": "", "site_lbl": "K390", "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "P08670", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P08670" }, { "id": "rs1490612095", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1490612095" }, { "id": "rs1490612095", "database": "NCI-TCGA", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1490612095" }, { "id": "rs1490612095", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1490612095" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 420, "end_pos": 420, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "S", "sequence_mut": "F", "comment": "Somatic mutation passed 1 out of 6 filters: o-glyco-site-loss (S->F).", "chr_id": "10", "chr_pos": "17235875", "ref_nt": "C", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "S420", "disease": [ { "disease_id": "DOID:4159", "recommended_name": { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "skin cancer", "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells." }, "synonyms": [ { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "CA - skin cancer", "description": "" }, { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "malignant neoplasm of skin", "description": "" }, { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "melanoma and Non-melanoma skin cancer", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease", "ebi", "germline" ] }, { "evidence": [ { "id": "rs765564921", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs765564921" }, { "id": "rs765564921", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs765564921" }, { "id": "rs765564921", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs765564921" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 444, "end_pos": 444, "sequence_org": "I", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (IKT->NKT).", "chr_id": "10", "chr_pos": "17236351", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "I444", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs747701399", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs747701399" }, { "id": "rs747701399", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs747701399" }, { "id": "rs747701399", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs747701399#frequency_tab" }, { "id": "rs747701399", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs747701399" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 458, "end_pos": 458, "sequence_org": "T", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->A).", "chr_id": "10", "chr_pos": "17237242", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T458", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs771777895", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs771777895" }, { "id": "rs771777895", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs771777895" }, { "id": "rs771777895", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs771777895" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 458, "end_pos": 458, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->I).", "chr_id": "10", "chr_pos": "17237243", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T458", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs771777895", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs771777895" }, { "id": "rs771777895", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs771777895" }, { "id": "rs771777895", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs771777895" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 458, "end_pos": 458, "sequence_org": "T", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->N).", "chr_id": "10", "chr_pos": "17237243", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T458", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs745851443", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs745851443" }, { "id": "rs745851443", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs745851443" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 48, "end_pos": 48, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->I).", "chr_id": "10", "chr_pos": "17229565", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T48", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs201189169", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs201189169" }, { "id": "rs201189169", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs201189169" }, { "id": "rs201189169", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs201189169" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 48, "end_pos": 48, "sequence_org": "T", "sequence_mut": "P", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->P).", "chr_id": "10", "chr_pos": "17229564", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T48", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs769749512", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs769749512" }, { "id": "rs769749512", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs769749512" }, { "id": "rs769749512", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs769749512" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 49, "end_pos": 49, "sequence_org": "S", "sequence_mut": "G", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->G).", "chr_id": "10", "chr_pos": "17229567", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S49", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1367516245", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1367516245" }, { "id": "rs1367516245", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1367516245" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 49, "end_pos": 49, "sequence_org": "S", "sequence_mut": "R", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->R).", "chr_id": "10", "chr_pos": "17229569", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S49", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs775190116", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs775190116" }, { "id": "rs775190116", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs775190116" }, { "id": "rs775190116", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs775190116" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 51, "end_pos": 51, "sequence_org": "S", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->I).", "chr_id": "10", "chr_pos": "17229574", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S51", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs762699034", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs762699034" }, { "id": "rs762699034", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs762699034" }, { "id": "rs762699034", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs762699034" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 55, "end_pos": 55, "sequence_org": "S", "sequence_mut": "*", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->*).", "chr_id": "10", "chr_pos": "17229586", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S55", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs768322635", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs768322635" }, { "id": "rs768322635", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs768322635" }, { "id": "rs768322635", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs768322635" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 56, "end_pos": 56, "sequence_org": "S", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->A).", "chr_id": "10", "chr_pos": "17229588", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S56", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs773938980", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs773938980" }, { "id": "rs773938980", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs773938980" }, { "id": "rs773938980", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs773938980#frequency_tab" }, { "id": "rs773938980", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs773938980" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 56, "end_pos": 56, "sequence_org": "S", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->Y).", "chr_id": "10", "chr_pos": "17229589", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S56", "disease": [ { "disease_id": "DOID:0110248", "recommended_name": { "id": "DOID:0110248", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0110248", "name": "cataract 30", "description": "A cataract that has_material_basis_in heterozygous mutation in the VIM gene on chromosome 10p13." }, "synonyms": [ { "id": "DOID:0110248", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0110248", "name": "CTRCT30", "description": "" }, { "id": "DOID:0110248", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0110248", "name": "Dusty cataract", "description": "" }, { "id": "DOID:0110248", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0110248", "name": "cataract 30 pulverulent", "description": "" }, { "id": "DOID:0110248", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0110248", "name": "cataract Coppock-like", "description": "" }, { "id": "MONDO:0007286", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007286", "name": "cataract 30", "description": "A cataract that has material basis in heterozygous mutation in the VIM gene on chromosome 10p13." }, { "id": "MONDO:0007286", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007286", "name": "CTRCT30", "description": "" }, { "id": "MONDO:0007286", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007286", "name": "cataract 30", "description": "" }, { "id": "MONDO:0007286", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007286", "name": "cataract 30 pulverulent", "description": "" }, { "id": "MONDO:0007286", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007286", "name": "cataract Coppock-like", "description": "" }, { "id": "MONDO:0007286", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007286", "name": "cataract type 30", "description": "" }, { "id": "MONDO:0007286", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007286", "name": "cataract 30, multiple types", "description": "" }, { "id": "MONDO:0007286", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007286", "name": "cataract 30, pulverulent", "description": "" }, { "id": "MIM:116300", "resource": "MIM", "url": "https://www.omim.org/entry/116300", "name": "Cataract 30, multiple types", "description": "Cataract 30, multiple types" } ] } ], "keywords": [ "ebi", "germline", "disease" ] }, { "evidence": [ { "id": "rs749097460", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs749097460" }, { "id": "rs749097460", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs749097460" }, { "id": "rs749097460", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs749097460" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 85, "end_pos": 85, "sequence_org": "D", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (DFS->NFS).", "chr_id": "10", "chr_pos": "17229675", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "D85", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1452623960", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1452623960" }, { "id": "rs1452623960", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1452623960#frequency_tab" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 94, "end_pos": 94, "sequence_org": "T", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->A).", "chr_id": "10", "chr_pos": "17229702", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T94", "keywords": [ "ebi", "germline" ] } ], "mutagenesis": [], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "98.8", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000026025", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000026025" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "99.43", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000026025", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000026025" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "99.4", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000026025", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000026025" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "99.86", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000026025", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000026025" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "99.89", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000026025", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000026025" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "99.54", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000026025", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000026025" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "99.11", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000026025", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000026025" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "99.74", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000026025", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000026025" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "99.86", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000026025", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000026025" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "99.92", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000026025", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000026025" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "96.99", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000026025", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000026025" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "99.44", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000026025", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000026025" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "99.83", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000026025", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000026025" } ] } ], "expression_disease": [ { "significant": "Yes", "trend": "down", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "P08670", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P08670" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "P08670", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P08670" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "P08670", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P08670" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "P08670", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P08670" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "P08670", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P08670" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "P08670", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P08670" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "P08670", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P08670" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "P08670", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P08670" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "P08670", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P08670" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "P08670", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P08670" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "P08670", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P08670" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "P08670", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P08670" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P08670", "url": "https://www.uniprot.org/uniprot/P08670" } ], "common_name": "Human" } ], "gene": [ { "name": "VIM", "url": "https://www.uniprot.org/uniprot/P08670", "locus": { "chromosome": "10", "start_pos": 17237593, "end_pos": 17228241, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000026025", "url": "https://www.ensembl.org/id/ENSG00000026025" } ] } } ], "crossref": [ { "id": "ENSG00000026025", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000026025", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "P08670", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P08670", "database": "BioMuta", "categories": [ "Variation" ] }, { "id": "CHEMBL3712854", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL3712854", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "VIM", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=VIM", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "7431", "url": "https://www.ncbi.nlm.nih.gov/gene/7431", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "2867", "url": "https://glyconnect.expasy.org/browser/proteins/2867", "database": "GlyConnect", "categories": [ "Glycoproteomics", "Glycan" ] }, { "id": "12692", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=12692", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "P08670", "url": "https://www.ebi.ac.uk/intact/interactors/id:P08670*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR006821", "url": "https://www.ebi.ac.uk/interpro/entry/IPR006821", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR018039", "url": "https://www.ebi.ac.uk/interpro/entry/IPR018039", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR039008", "url": "https://www.ebi.ac.uk/interpro/entry/IPR039008", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:7431", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:7431", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "116300", "url": "http://www.omim.org/entry/116300", "database": "MIM", "categories": [ "Other" ] }, { "id": "193060", "url": "http://www.omim.org/entry/193060", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_P08670", "url": "https://www.nextprot.org/entry/NX_P08670", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "P08670", "url": "https://oglcnac.org/atlas/detail/P08670", "database": "O-GlcNAc Atlas", "categories": [ "Glycoproteomics" ] }, { "id": "P08670", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08670", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "GGMYATK", "url": "https://omabrowser.org/oma/group/GGMYATK/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "4640531at2759", "url": "http://www.orthodb.org/?query=4640531at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR45652", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR45652", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR45652:SF5", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR45652:SF5", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "1GK4", "url": "https://www.rcsb.org/structure/1GK4", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1GK6", "url": "https://www.rcsb.org/structure/1GK6", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1GK7", "url": "https://www.rcsb.org/structure/1GK7", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3G1E", "url": "https://www.rcsb.org/structure/3G1E", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3KLT", "url": "https://www.rcsb.org/structure/3KLT", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3S4R", "url": "https://www.rcsb.org/structure/3S4R", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3SSU", "url": "https://www.rcsb.org/structure/3SSU", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3SWK", "url": "https://www.rcsb.org/structure/3SWK", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3TRT", "url": "https://www.rcsb.org/structure/3TRT", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3UF1", "url": "https://www.rcsb.org/structure/3UF1", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4MCY", "url": "https://www.rcsb.org/structure/4MCY", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4MCZ", "url": "https://www.rcsb.org/structure/4MCZ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4MD0", "url": "https://www.rcsb.org/structure/4MD0", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4MD5", "url": "https://www.rcsb.org/structure/4MD5", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4MDI", "url": "https://www.rcsb.org/structure/4MDI", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4MDJ", "url": "https://www.rcsb.org/structure/4MDJ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4YPC", "url": "https://www.rcsb.org/structure/4YPC", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4YV3", "url": "https://www.rcsb.org/structure/4YV3", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5WHF", "url": "https://www.rcsb.org/structure/5WHF", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6ATF", "url": "https://www.rcsb.org/structure/6ATF", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6ATI", "url": "https://www.rcsb.org/structure/6ATI", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6BIR", "url": "https://www.rcsb.org/structure/6BIR", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6YXK", "url": "https://www.rcsb.org/structure/6YXK", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00038", "url": "http://pfam.xfam.org/family/PF00038", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF04732", "url": "http://pfam.xfam.org/family/PF04732", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "P08670", "url": "https://pharos.nih.gov/targets/P08670", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_P08670", "url": "http://purl.obolibrary.org/obo/PR_P08670", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-264870", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-264870", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-390522", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-390522", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9013422", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013422", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9613829", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9613829", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9615710", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9615710", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9646399", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9646399", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_003371", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003371", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A1B0GTT5", "url": "https://www.uniprot.org/uniprot/A0A1B0GTT5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1B0GTT5-1", "url": "https://www.uniprot.org/uniprot/A0A1B0GTT5-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1B0GVG8", "url": "https://www.uniprot.org/uniprot/A0A1B0GVG8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1B0GVG8-1", "url": "https://www.uniprot.org/uniprot/A0A1B0GVG8-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "B0YJC4", "url": "https://www.uniprot.org/uniprot/B0YJC4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "B0YJC4-1", "url": "https://www.uniprot.org/uniprot/B0YJC4-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "B0YJC5", "url": "https://www.uniprot.org/uniprot/B0YJC5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "B0YJC5-1", "url": "https://www.uniprot.org/uniprot/B0YJC5-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P08670", "url": "https://www.uniprot.org/uniprot/P08670", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P08670-1", "url": "https://www.uniprot.org/uniprot/P08670-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MSTRSVSSSSYRRMFGGPGTASRPSSSRSYVTTSTRTYSLGSALRPSTSRSLYASSPGGVYATRSSAVRLRSSVPGVRLLQDSVDFSLADAINTEFKNTRTNEKVELQELNDRFANYIDKVRFLEQQNKILLAELEQLKGQGKSRLGDLYEEEMRELRRQVDQLTNDKARVEVERDNLAEDIMRLREKLQEEMLQREEAENTLQSFRQDVDNASLARLDLERKVESLQEEIAFLKKLHEEEIQELQAQIQEQHVQIDVDVSKPDLTAALRDVRQQYESVAAKNLQEAEEWYKSKFADLSEAANRNNDALRQAKQESTEYRRQVQSLTCEVDALKGTNESLERQMREMEENFAVEAANYQDTIGRLQDEIQNMKEEMARHLREYQDLLNVKMALDIEIATYRKLLEGEESRISLPLPNFSSLNLRETNLDSLPLVDTHSKRTLLIKTVETRDGQVINETSQHHDDLE", "length": 466, "header": "sp|P08670-1|VIME_HUMAN Isoform 1 of Vimentin OS=Homo sapiens OX=9606 GN=VIM PE=1 SV=4 CANONICAL=P08670-1" }, "isoforms": [ { "isoform_ac": "A0A1B0GTT5-1", "url": "", "sequence": { "sequence": "MSTRSVSSSSYRRMFGGPGTASRPSSSRSYVTTSTRTYSLGSALRPSTSRSLYASSPGGVYATRSSAVRLRSSVPGVRLLQDSVDFSLADAINTEFKNTRTNEKVELQELNDRFANYIDKVRFLEQQNKILLAELEQLKGQGKSRLGDL", "length": 149, "header": "tr|A0A1B0GTT5-1|A0A1B0GTT5_HUMAN Computationally mapped isoform of Vimentin OS=Homo sapiens OX=9606 GN=VIM PE=1 SV=1 CANONICAL=P08670-1" }, "locus": { "chromosome": "10", "start_pos": 17229869, "end_pos": 17229423, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000478746.1", "url": "https://www.ensembl.org/id/ENST00000478746.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000489830.1", "url": "https://www.ensembl.org/id/ENSP00000489830.1" } ] } }, { "isoform_ac": "A0A1B0GVG8-1", "url": "", "sequence": { "sequence": "MSTRSVSSSSYRRMFGGPGTASRPSSSRSYVTTSTRTYSLGSALRPSTSRSLYASSPGGVYATRSSAVRLRSSVPGVRLLQDSVDFSLADAINTEFKNTRTNEKVELQE", "length": 109, "header": "tr|A0A1B0GVG8-1|VIME_HUMAN Computationally mapped isoform of Vimentin OS=Homo sapiens OX=9606 GN=VIM PE=1 SV=1 CANONICAL=P08670-1" }, "locus": { "chromosome": "10", "start_pos": 17229749, "end_pos": 17229423, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000497849.1", "url": "https://www.ensembl.org/id/ENST00000497849.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000490509.1", "url": "https://www.ensembl.org/id/ENSP00000490509.1" } ] } }, { "isoform_ac": "B0YJC4-1", "url": "", "sequence": { "sequence": "MSTRSVSSSSYRRMFGGPGTASRPSSSRSYVTTSTRTYSLGSALRPSTSRSLYASSPGGVYATRSSAVRLRSSVPGVRLLQDSVDFSLADAINTEFKNTRTNEKVELQELNDRFANYIDKVRFLEQQNKILLAELEQLKGQGKSRLGDLYEEEMRELRRQVDQLTNDKARVEVERDNLAEDIMRLREKLQEEMLQREEAENTLQSFRQDVDNASLARLDLERKVESLQEEIAFLKKLHEEEIQELQAQIQEQHVQIDVDVSKPDLTAALRDVRQQYESVAAKNLQEAEEWYKSKFADLSEAANRNNDALRQAKQESTEYRRQVQSLTCEVDALKGTNESLERQMREMEENFAVEAANYQDTIGRLQDEIQNMKEEMARHLREYQDLLNVKMALDIEIATYRKLLEGEESRISLPLPNFSSLNLRGKHFISL", "length": 431, "header": "tr|B0YJC4-1|VIME_HUMAN Computationally mapped isoform of Vimentin OS=Homo sapiens OX=9606 GN=VIM PE=1 SV=1 CANONICAL=P08670-1" }, "locus": { "chromosome": "10", "start_pos": 17235909, "end_pos": 17229423, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000487938.5", "url": "https://www.ensembl.org/id/ENST00000487938.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000435613.1", "url": "https://www.ensembl.org/id/ENSP00000435613.1" } ] } }, { "isoform_ac": "B0YJC5-1", "url": "", "sequence": { "sequence": "MRNCFRLQEEMLQREEAENTLQSFRQDVDNASLARLDLERKVESLQEEIAFLKKLHEEEIQELQAQIQEQHVQIDVDVSKPDLTAALRDVRQQYESVAAKNLQEAEEWYKSKFADLSEAANRNNDALRQAKQESTEYRRQVQSLTCEVDALKGTNESLERQMREMEENFAVEAANYQDTIGRLQDEIQNMKEEMARHLREYQDLLNVKMALDIEIATYRKLLEGEESR", "length": 228, "header": "tr|B0YJC5-1|VIME_HUMAN Computationally mapped isoform of Vimentin OS=Homo sapiens OX=9606 GN=VIM PE=1 SV=1 CANONICAL=P08670-1" }, "locus": { "chromosome": "10", "start_pos": 17235390, "end_pos": 17230633, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000469543.5", "url": "https://www.ensembl.org/id/ENST00000469543.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000431702.1", "url": "https://www.ensembl.org/id/ENSP00000431702.1" } ] } }, { "isoform_ac": "P08670-1", "url": "", "sequence": { "sequence": "MSTRSVSSSSYRRMFGGPGTASRPSSSRSYVTTSTRTYSLGSALRPSTSRSLYASSPGGVYATRSSAVRLRSSVPGVRLLQDSVDFSLADAINTEFKNTRTNEKVELQELNDRFANYIDKVRFLEQQNKILLAELEQLKGQGKSRLGDLYEEEMRELRRQVDQLTNDKARVEVERDNLAEDIMRLREKLQEEMLQREEAENTLQSFRQDVDNASLARLDLERKVESLQEEIAFLKKLHEEEIQELQAQIQEQHVQIDVDVSKPDLTAALRDVRQQYESVAAKNLQEAEEWYKSKFADLSEAANRNNDALRQAKQESTEYRRQVQSLTCEVDALKGTNESLERQMREMEENFAVEAANYQDTIGRLQDEIQNMKEEMARHLREYQDLLNVKMALDIEIATYRKLLEGEESRISLPLPNFSSLNLRETNLDSLPLVDTHSKRTLLIKTVETRDGQVINETSQHHDDLE", "length": 466, "header": "sp|P08670-1|VIME_HUMAN Isoform 1 of Vimentin OS=Homo sapiens OX=9606 GN=VIM PE=1 SV=4 CANONICAL=P08670-1" }, "locus": { "chromosome": "10", "start_pos": 17237268, "end_pos": 17229423, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000224237.9", "url": "https://www.ensembl.org/id/ENST00000224237.9" }, { "database": "Ensembl Peptide", "id": "ENSP00000224237.5", "url": "https://www.ensembl.org/id/ENSP00000224237.5" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 20, "start_aa": "Thr", "end_pos": 20, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr20", "evidence": [ { "id": "P08670", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08670" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "29513221", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29513221" }, { "id": "30620550", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30620550" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "35289036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35289036" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "33465208", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33465208" }, { "id": "29237092", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29237092" }, { "id": "28262738", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28262738" }, { "id": "31373491", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31373491" }, { "id": "23271734", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23271734" }, { "id": "37217939", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37217939" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "20305658", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20305658" }, { "id": "22121020", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22121020" }, { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "35008409", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35008409" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "32522876", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32522876" }, { "id": "26853435", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26853435" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "21740066", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21740066" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "23576270", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23576270" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "35083852", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35083852" }, { "id": "36240223", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/36240223" }, { "id": "18653473", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/18653473" }, { "id": "20068230", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20068230" }, { "id": "P08670", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P08670" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 214, "start_aa": "Ser", "end_pos": 214, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser214", "evidence": [ { "id": "P08670", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08670" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "29513221", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29513221" }, { "id": "30620550", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30620550" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "35289036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35289036" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "33465208", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33465208" }, { "id": "29237092", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29237092" }, { "id": "28262738", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28262738" }, { "id": "31373491", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31373491" }, { "id": "23271734", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23271734" }, { "id": "37217939", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37217939" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "20305658", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20305658" }, { "id": "22121020", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22121020" }, { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "35008409", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35008409" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "32522876", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32522876" }, { "id": "26853435", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26853435" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "21740066", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21740066" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "23576270", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23576270" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "35083852", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35083852" }, { "id": "36240223", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/36240223" }, { "id": "18653473", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/18653473" }, { "id": "20068230", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20068230" }, { "id": "P08670", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P08670" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 22, "start_aa": "Ser", "end_pos": 22, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser22", "evidence": [ { "id": "P08670", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08670" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "29513221", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29513221" }, { "id": "30620550", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30620550" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "35289036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35289036" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "33465208", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33465208" }, { "id": "29237092", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29237092" }, { "id": "28262738", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28262738" }, { "id": "31373491", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31373491" }, { "id": "23271734", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23271734" }, { "id": "37217939", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37217939" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "20305658", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20305658" }, { "id": "22121020", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22121020" }, { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "35008409", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35008409" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "32522876", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32522876" }, { "id": "26853435", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26853435" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "21740066", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21740066" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "23576270", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23576270" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "35083852", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35083852" }, { "id": "36240223", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/36240223" }, { "id": "18653473", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/18653473" }, { "id": "20068230", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20068230" }, { "id": "P08670", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P08670" } ] }, { "glytoucan_ac": "G70994MS", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 22, "start_aa": "Ser", "end_pos": 22, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser22", "evidence": [ { "id": "GLY_000142", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000142" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 25, "start_aa": "Ser", "end_pos": 25, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser25", "evidence": [ { "id": "P08670", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08670" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "29513221", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29513221" }, { "id": "30620550", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30620550" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "35289036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35289036" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "33465208", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33465208" }, { "id": "29237092", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29237092" }, { "id": "28262738", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28262738" }, { "id": "31373491", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31373491" }, { "id": "23271734", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23271734" }, { "id": "37217939", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37217939" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "20305658", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20305658" }, { "id": "22121020", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22121020" }, { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "35008409", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35008409" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "32522876", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32522876" }, { "id": "26853435", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26853435" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "21740066", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21740066" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "23576270", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23576270" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "35083852", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35083852" }, { "id": "36240223", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/36240223" }, { "id": "18653473", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/18653473" }, { "id": "20068230", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20068230" }, { "id": "P08670", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P08670" } ] }, { "glytoucan_ac": "G70994MS", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 25, "start_aa": "Ser", "end_pos": 25, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser25", "evidence": [ { "id": "GLY_000142", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000142" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 26, "start_aa": "Ser", "end_pos": 26, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser26", "evidence": [ { "id": "P08670", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08670" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "29513221", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29513221" }, { "id": "30620550", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30620550" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "35289036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35289036" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "33465208", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33465208" }, { "id": "29237092", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29237092" }, { "id": "28262738", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28262738" }, { "id": "31373491", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31373491" }, { "id": "23271734", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23271734" }, { "id": "37217939", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37217939" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "20305658", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20305658" }, { "id": "22121020", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22121020" }, { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "35008409", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35008409" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "32522876", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32522876" }, { "id": "26853435", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26853435" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "21740066", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21740066" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "23576270", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23576270" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "35083852", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35083852" }, { "id": "36240223", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/36240223" }, { "id": "18653473", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/18653473" }, { "id": "20068230", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20068230" }, { "id": "P08670", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P08670" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 27, "start_aa": "Ser", "end_pos": 27, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser27", "evidence": [ { "id": "P08670", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08670" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "29513221", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29513221" }, { "id": "30620550", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30620550" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "35289036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35289036" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "33465208", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33465208" }, { "id": "29237092", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29237092" }, { "id": "28262738", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28262738" }, { "id": "31373491", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31373491" }, { "id": "23271734", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23271734" }, { "id": "37217939", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37217939" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "20305658", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20305658" }, { "id": "22121020", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22121020" }, { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "35008409", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35008409" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "32522876", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32522876" }, { "id": "26853435", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26853435" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "21740066", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21740066" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "23576270", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23576270" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "35083852", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35083852" }, { "id": "36240223", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/36240223" }, { "id": "18653473", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/18653473" }, { "id": "20068230", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20068230" }, { "id": "P08670", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P08670" } ] }, { "glytoucan_ac": "G70994MS", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 27, "start_aa": "Ser", "end_pos": 27, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser27", "evidence": [ { "id": "GLY_000142", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000142" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 29, "start_aa": "Ser", "end_pos": 29, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser29", "evidence": [ { "id": "P08670", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08670" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "29513221", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29513221" }, { "id": "30620550", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30620550" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "35289036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35289036" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "33465208", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33465208" }, { "id": "29237092", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29237092" }, { "id": "28262738", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28262738" }, { "id": "31373491", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31373491" }, { "id": "23271734", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23271734" }, { "id": "37217939", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37217939" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "20305658", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20305658" }, { "id": "22121020", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22121020" }, { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "35008409", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35008409" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "32522876", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32522876" }, { "id": "26853435", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26853435" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "21740066", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21740066" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "23576270", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23576270" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "35083852", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35083852" }, { "id": "36240223", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/36240223" }, { "id": "18653473", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/18653473" }, { "id": "20068230", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20068230" }, { "id": "P08670", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P08670" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 327, "start_aa": "Thr", "end_pos": 327, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr327", "evidence": [ { "id": "P08670", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08670" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "29513221", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29513221" }, { "id": "30620550", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30620550" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "35289036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35289036" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "33465208", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33465208" }, { "id": "29237092", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29237092" }, { "id": "28262738", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28262738" }, { "id": "31373491", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31373491" }, { "id": "23271734", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23271734" }, { "id": "37217939", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37217939" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "20305658", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20305658" }, { "id": "22121020", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22121020" }, { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "35008409", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35008409" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "32522876", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32522876" }, { "id": "26853435", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26853435" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "21740066", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21740066" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "23576270", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23576270" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "35083852", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35083852" }, { "id": "36240223", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/36240223" }, { "id": "18653473", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/18653473" }, { "id": "20068230", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20068230" }, { "id": "P08670", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P08670" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 32, "start_aa": "Thr", "end_pos": 32, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr32", "evidence": [ { "id": "P08670", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08670" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "29513221", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29513221" }, { "id": "30620550", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30620550" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "35289036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35289036" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "33465208", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33465208" }, { "id": "29237092", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29237092" }, { "id": "28262738", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28262738" }, { "id": "31373491", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31373491" }, { "id": "23271734", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23271734" }, { "id": "37217939", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37217939" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "20305658", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20305658" }, { "id": "22121020", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22121020" }, { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "35008409", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35008409" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "32522876", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32522876" }, { "id": "26853435", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26853435" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "21740066", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21740066" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "23576270", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23576270" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "35083852", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35083852" }, { "id": "36240223", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/36240223" }, { "id": "18653473", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/18653473" }, { "id": "20068230", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20068230" }, { "id": "P08670", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P08670" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 33, "start_aa": "Thr", "end_pos": 33, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr33", "evidence": [ { "id": "P08670", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08670" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "29513221", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29513221" }, { "id": "30620550", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30620550" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "35289036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35289036" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "33465208", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33465208" }, { "id": "29237092", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29237092" }, { "id": "28262738", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28262738" }, { "id": "31373491", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31373491" }, { "id": "23271734", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23271734" }, { "id": "37217939", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37217939" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "20305658", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20305658" }, { "id": "22121020", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22121020" }, { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "35008409", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35008409" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "32522876", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32522876" }, { "id": "26853435", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26853435" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "21740066", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21740066" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "23576270", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23576270" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "35083852", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35083852" }, { "id": "36240223", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/36240223" }, { "id": "18653473", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/18653473" }, { "id": "20068230", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20068230" }, { "id": "P08670", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P08670" }, { "id": "2867", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2867" } ] }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported", "site_seq": "T", "relation": "attached", "comment": "O-linked (GlcNAc) threonine O-GlcNAcylation", "start_pos": 33, "start_aa": "Thr", "end_pos": 33, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr33", "evidence": [ { "id": "P08670", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08670#ptm_processing" }, { "id": "20068230", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20068230" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 34, "start_aa": "Ser", "end_pos": 34, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser34", "evidence": [ { "id": "P08670", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08670" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "29513221", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29513221" }, { "id": "30620550", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30620550" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "35289036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35289036" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "33465208", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33465208" }, { "id": "29237092", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29237092" }, { "id": "28262738", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28262738" }, { "id": "31373491", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31373491" }, { "id": "23271734", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23271734" }, { "id": "37217939", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37217939" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "20305658", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20305658" }, { "id": "22121020", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22121020" }, { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "35008409", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35008409" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "32522876", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32522876" }, { "id": "26853435", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26853435" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "21740066", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21740066" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "23576270", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23576270" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "35083852", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35083852" }, { "id": "36240223", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/36240223" }, { "id": "18653473", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/18653473" }, { "id": "20068230", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20068230" }, { "id": "P08670", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P08670" }, { "id": "2867", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2867" } ] }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported", "site_seq": "S", "relation": "attached", "comment": "O-linked (GlcNAc) serine; alternate O-GlcNAcylation", "start_pos": 34, "start_aa": "Ser", "end_pos": 34, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser34", "evidence": [ { "id": "P08670", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08670#ptm_processing" }, { "id": "20068230", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20068230" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 35, "start_aa": "Thr", "end_pos": 35, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr35", "evidence": [ { "id": "P08670", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08670" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "29513221", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29513221" }, { "id": "30620550", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30620550" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "35289036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35289036" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "33465208", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33465208" }, { "id": "29237092", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29237092" }, { "id": "28262738", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28262738" }, { "id": "31373491", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31373491" }, { "id": "23271734", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23271734" }, { "id": "37217939", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37217939" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "20305658", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20305658" }, { "id": "22121020", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22121020" }, { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "35008409", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35008409" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "32522876", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32522876" }, { "id": "26853435", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26853435" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "21740066", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21740066" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "23576270", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23576270" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "35083852", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35083852" }, { "id": "36240223", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/36240223" }, { "id": "18653473", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/18653473" }, { "id": "20068230", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20068230" }, { "id": "P08670", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P08670" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 37, "start_aa": "Thr", "end_pos": 37, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr37", "evidence": [ { "id": "P08670", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08670" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "29513221", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29513221" }, { "id": "30620550", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30620550" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "35289036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35289036" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "33465208", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33465208" }, { "id": "29237092", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29237092" }, { "id": "28262738", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28262738" }, { "id": "31373491", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31373491" }, { "id": "23271734", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23271734" }, { "id": "37217939", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37217939" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "20305658", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20305658" }, { "id": "22121020", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22121020" }, { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "35008409", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35008409" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "32522876", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32522876" }, { "id": "26853435", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26853435" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "21740066", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21740066" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "23576270", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23576270" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "35083852", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35083852" }, { "id": "36240223", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/36240223" }, { "id": "18653473", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/18653473" }, { "id": "20068230", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20068230" }, { "id": "P08670", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P08670" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 39, "start_aa": "Ser", "end_pos": 39, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser39", "evidence": [ { "id": "P08670", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08670" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "29513221", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29513221" }, { "id": "30620550", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30620550" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "35289036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35289036" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "33465208", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33465208" }, { "id": "29237092", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29237092" }, { "id": "28262738", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28262738" }, { "id": "31373491", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31373491" }, { "id": "23271734", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23271734" }, { "id": "37217939", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37217939" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "20305658", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20305658" }, { "id": "22121020", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22121020" }, { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "35008409", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35008409" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "32522876", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32522876" }, { "id": "26853435", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26853435" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "21740066", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21740066" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "23576270", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23576270" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "35083852", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35083852" }, { "id": "36240223", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/36240223" }, { "id": "18653473", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/18653473" }, { "id": "20068230", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20068230" }, { "id": "P08670", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P08670" }, { "id": "32938750", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32938750" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 419, "start_aa": "Ser", "end_pos": 419, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser419", "evidence": [ { "id": "P08670", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P08670" }, { "id": "31373491", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31373491" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 420, "start_aa": "Ser", "end_pos": 420, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser420", "evidence": [ { "id": "P08670", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P08670" }, { "id": "31373491", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31373491" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 458, "start_aa": "Thr", "end_pos": 458, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr458", "evidence": [ { "id": "P08670", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P08670" }, { "id": "31373491", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31373491" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 47, "start_aa": "Ser", "end_pos": 47, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser47", "evidence": [ { "id": "P08670", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08670" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "29513221", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29513221" }, { "id": "30620550", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30620550" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "35289036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35289036" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "33465208", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33465208" }, { "id": "29237092", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29237092" }, { "id": "28262738", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28262738" }, { "id": "31373491", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31373491" }, { "id": "23271734", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23271734" }, { "id": "37217939", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37217939" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "20305658", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20305658" }, { "id": "22121020", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22121020" }, { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "35008409", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35008409" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "32522876", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32522876" }, { "id": "26853435", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26853435" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "21740066", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21740066" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "23576270", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23576270" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "35083852", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35083852" }, { "id": "36240223", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/36240223" }, { "id": "18653473", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/18653473" }, { "id": "20068230", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20068230" }, { "id": "P08670", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P08670" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 48, "start_aa": "Thr", "end_pos": 48, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr48", "evidence": [ { "id": "P08670", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08670" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "29513221", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29513221" }, { "id": "30620550", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30620550" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "35289036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35289036" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "33465208", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33465208" }, { "id": "29237092", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29237092" }, { "id": "28262738", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28262738" }, { "id": "31373491", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31373491" }, { "id": "23271734", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23271734" }, { "id": "37217939", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37217939" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "20305658", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20305658" }, { "id": "22121020", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22121020" }, { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "35008409", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35008409" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "32522876", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32522876" }, { "id": "26853435", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26853435" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "21740066", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21740066" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "23576270", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23576270" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "35083852", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35083852" }, { "id": "36240223", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/36240223" }, { "id": "18653473", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/18653473" }, { "id": "20068230", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20068230" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 49, "start_aa": "Ser", "end_pos": 49, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser49", "evidence": [ { "id": "P08670", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08670" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "29513221", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29513221" }, { "id": "30620550", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30620550" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "35289036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35289036" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "33465208", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33465208" }, { "id": "29237092", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29237092" }, { "id": "28262738", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28262738" }, { "id": "31373491", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31373491" }, { "id": "23271734", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23271734" }, { "id": "37217939", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37217939" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "20305658", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20305658" }, { "id": "22121020", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22121020" }, { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "35008409", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35008409" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "32522876", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32522876" }, { "id": "26853435", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26853435" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "21740066", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21740066" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "23576270", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23576270" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "35083852", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35083852" }, { "id": "36240223", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/36240223" }, { "id": "18653473", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/18653473" }, { "id": "20068230", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20068230" }, { "id": "P08670", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P08670" } ] }, { "glytoucan_ac": "G70994MS", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 49, "start_aa": "Ser", "end_pos": 49, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser49", "evidence": [ { "id": "GLY_000142", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000142" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 51, "start_aa": "Ser", "end_pos": 51, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser51", "evidence": [ { "id": "P08670", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08670" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "29513221", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29513221" }, { "id": "30620550", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30620550" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "35289036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35289036" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "33465208", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33465208" }, { "id": "29237092", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29237092" }, { "id": "28262738", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28262738" }, { "id": "31373491", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31373491" }, { "id": "23271734", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23271734" }, { "id": "37217939", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37217939" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "20305658", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20305658" }, { "id": "22121020", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22121020" }, { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "35008409", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35008409" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "32522876", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32522876" }, { "id": "26853435", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26853435" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "21740066", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21740066" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "23576270", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23576270" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "35083852", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35083852" }, { "id": "36240223", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/36240223" }, { "id": "18653473", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/18653473" }, { "id": "20068230", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20068230" }, { "id": "P08670", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P08670" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 55, "start_aa": "Ser", "end_pos": 55, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser55", "evidence": [ { "id": "P08670", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08670" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "29513221", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29513221" }, { "id": "30620550", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30620550" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "35289036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35289036" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "33465208", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33465208" }, { "id": "29237092", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29237092" }, { "id": "28262738", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28262738" }, { "id": "31373491", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31373491" }, { "id": "23271734", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23271734" }, { "id": "37217939", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37217939" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "20305658", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20305658" }, { "id": "22121020", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22121020" }, { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "35008409", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35008409" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "32522876", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32522876" }, { "id": "26853435", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26853435" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "21740066", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21740066" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "23576270", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23576270" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "35083852", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35083852" }, { "id": "36240223", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/36240223" }, { "id": "18653473", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/18653473" }, { "id": "20068230", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20068230" }, { "id": "P08670", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P08670" }, { "id": "17507370", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17507370" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 56, "start_aa": "Ser", "end_pos": 56, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser56", "evidence": [ { "id": "P08670", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08670" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "29513221", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29513221" }, { "id": "30620550", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30620550" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "35289036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35289036" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "33465208", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33465208" }, { "id": "29237092", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29237092" }, { "id": "28262738", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28262738" }, { "id": "31373491", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31373491" }, { "id": "23271734", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23271734" }, { "id": "37217939", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37217939" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "20305658", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20305658" }, { "id": "22121020", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22121020" }, { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "35008409", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35008409" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "32522876", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32522876" }, { "id": "26853435", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26853435" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "21740066", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21740066" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "23576270", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23576270" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "35083852", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35083852" }, { "id": "36240223", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/36240223" }, { "id": "18653473", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/18653473" }, { "id": "20068230", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20068230" }, { "id": "P08670", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P08670" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 5, "start_aa": "Ser", "end_pos": 5, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser5", "evidence": [ { "id": "P08670", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08670" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "29513221", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29513221" }, { "id": "30620550", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30620550" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "35289036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35289036" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "33465208", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33465208" }, { "id": "29237092", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29237092" }, { "id": "28262738", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28262738" }, { "id": "31373491", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31373491" }, { "id": "23271734", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23271734" }, { "id": "37217939", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37217939" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "20305658", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20305658" }, { "id": "22121020", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22121020" }, { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "35008409", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35008409" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "32522876", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32522876" }, { "id": "26853435", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26853435" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "21740066", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21740066" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "23576270", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23576270" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "35083852", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35083852" }, { "id": "36240223", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/36240223" }, { "id": "18653473", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/18653473" }, { "id": "20068230", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20068230" }, { "id": "P08670", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P08670" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 63, "start_aa": "Thr", "end_pos": 63, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr63", "evidence": [ { "id": "P08670", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08670" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "29513221", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29513221" }, { "id": "30620550", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30620550" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "35289036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35289036" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "33465208", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33465208" }, { "id": "29237092", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29237092" }, { "id": "28262738", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28262738" }, { "id": "31373491", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31373491" }, { "id": "23271734", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23271734" }, { "id": "37217939", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37217939" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "20305658", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20305658" }, { "id": "22121020", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22121020" }, { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "35008409", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35008409" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "32522876", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32522876" }, { "id": "26853435", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26853435" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "21740066", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21740066" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "23576270", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23576270" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "35083852", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35083852" }, { "id": "36240223", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/36240223" }, { "id": "18653473", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/18653473" }, { "id": "20068230", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20068230" }, { "id": "P08670", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P08670" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 7, "start_aa": "Ser", "end_pos": 7, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser7", "evidence": [ { "id": "P08670", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08670" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "29513221", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29513221" }, { "id": "30620550", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30620550" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "35289036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35289036" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "33465208", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33465208" }, { "id": "29237092", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29237092" }, { "id": "28262738", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28262738" }, { "id": "31373491", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31373491" }, { "id": "23271734", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23271734" }, { "id": "37217939", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37217939" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "20305658", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20305658" }, { "id": "22121020", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22121020" }, { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "35008409", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35008409" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "32522876", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32522876" }, { "id": "26853435", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26853435" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "21740066", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21740066" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "23576270", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23576270" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "35083852", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35083852" }, { "id": "36240223", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/36240223" }, { "id": "18653473", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/18653473" }, { "id": "20068230", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20068230" }, { "id": "P08670", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P08670" }, { "id": "2867", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2867" } ] }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported", "site_seq": "S", "relation": "attached", "comment": "O-linked (GlcNAc) serine; alternate O-GlcNAcylation", "start_pos": 7, "start_aa": "Ser", "end_pos": 7, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser7", "evidence": [ { "id": "P08670", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08670#ptm_processing" }, { "id": "20068230", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20068230" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 94, "start_aa": "Thr", "end_pos": 94, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr94", "evidence": [ { "id": "P08670", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08670" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "29513221", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29513221" }, { "id": "30620550", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30620550" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "35289036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35289036" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "33465208", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33465208" }, { "id": "29237092", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29237092" }, { "id": "28262738", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28262738" }, { "id": "31373491", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31373491" }, { "id": "23271734", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23271734" }, { "id": "37217939", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37217939" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "20305658", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20305658" }, { "id": "22121020", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22121020" }, { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "35008409", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35008409" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "32522876", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32522876" }, { "id": "26853435", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26853435" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "21740066", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21740066" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "23576270", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23576270" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "35083852", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35083852" }, { "id": "36240223", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/36240223" }, { "id": "18653473", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/18653473" }, { "id": "20068230", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20068230" } ] } ], "phosphorylation": [ { "start_pos": 10, "end_pos": 10, "kinase_uniprot_canonical_ac": "P17252-1", "kinase_gene_name": "PRKCA", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "2500966", "url": "https://glygen.org/publication/PubMed/2500966" } ], "site_lbl": "Ser10" }, { "start_pos": 10, "end_pos": 10, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by PKC", "evidence": [ { "database": "UniProtKB", "id": "P08670", "url": "https://www.uniprot.org/uniprot/P08670" }, { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" }, { "database": "PubMed", "id": "14762106", "url": "https://glygen.org/publication/PubMed/14762106" } ], "site_lbl": "Ser10" }, { "start_pos": 117, "end_pos": 117, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine", "evidence": [ { "database": "UniProtKB", "id": "P08670", "url": "https://www.uniprot.org/uniprot/P08670" }, { "database": "PubMed", "id": "15592455", "url": "https://glygen.org/publication/PubMed/15592455" }, { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" }, { "database": "PubMed", "id": "18083107", "url": "https://glygen.org/publication/PubMed/18083107" }, { "database": "phospho.ELM", "id": "P08670", "url": "http://phospho.elm.eu.org/byAccession/P08670.html" }, { "database": "PubMed", "id": "30696956", "url": "https://glygen.org/publication/PubMed/30696956" } ], "site_lbl": "Tyr117" }, { "start_pos": 144, "end_pos": 144, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P08670", "url": "https://www.uniprot.org/uniprot/P08670" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "21406692", "url": "https://glygen.org/publication/PubMed/21406692" }, { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" }, { "database": "phospho.ELM", "id": "P08670", "url": "http://phospho.elm.eu.org/byAccession/P08670.html" } ], "site_lbl": "Ser144" }, { "start_pos": 205, "end_pos": 205, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Ser205" }, { "start_pos": 20, "end_pos": 20, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "P08670", "url": "https://www.uniprot.org/uniprot/P08670" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "24275569", "url": "https://glygen.org/publication/PubMed/24275569" }, { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" }, { "database": "PubMed", "id": "17287340", "url": "https://glygen.org/publication/PubMed/17287340" }, { "database": "PubMed", "id": "19007248", "url": "https://glygen.org/publication/PubMed/19007248" }, { "database": "PubMed", "id": "19691289", "url": "https://glygen.org/publication/PubMed/19691289" } ], "site_lbl": "Thr20" }, { "start_pos": 214, "end_pos": 214, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P08670", "url": "https://www.uniprot.org/uniprot/P08670" }, { "database": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "24275569", "url": "https://glygen.org/publication/PubMed/24275569" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" }, { "database": "PubMed", "id": "18707149", "url": "https://glygen.org/publication/PubMed/18707149" }, { "database": "PubMed", "id": "19007248", "url": "https://glygen.org/publication/PubMed/19007248" }, { "database": "PubMed", "id": "19691289", "url": "https://glygen.org/publication/PubMed/19691289" }, { "database": "phospho.ELM", "id": "P08670", "url": "http://phospho.elm.eu.org/byAccession/P08670.html" } ], "site_lbl": "Ser214" }, { "start_pos": 226, "end_pos": 226, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P08670", "url": "https://www.uniprot.org/uniprot/P08670" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "phospho.ELM", "id": "P08670", "url": "http://phospho.elm.eu.org/byAccession/P08670.html" } ], "site_lbl": "Ser226" }, { "start_pos": 22, "end_pos": 22, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" }, { "database": "PubMed", "id": "17287340", "url": "https://glygen.org/publication/PubMed/17287340" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "phospho.ELM", "id": "P08670", "url": "http://phospho.elm.eu.org/byAccession/P08670.html" } ], "site_lbl": "Ser22" }, { "start_pos": 25, "end_pos": 25, "kinase_uniprot_canonical_ac": "P17252-1", "kinase_gene_name": "PRKCA", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" }, { "database": "PubMed", "id": "17287340", "url": "https://glygen.org/publication/PubMed/17287340" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "19691289", "url": "https://glygen.org/publication/PubMed/19691289" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "2500966", "url": "https://glygen.org/publication/PubMed/2500966" } ], "site_lbl": "Ser25" }, { "start_pos": 25, "end_pos": 25, "kinase_uniprot_canonical_ac": "P17612-1", "kinase_gene_name": "PRKACA", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" }, { "database": "PubMed", "id": "17287340", "url": "https://glygen.org/publication/PubMed/17287340" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "19691289", "url": "https://glygen.org/publication/PubMed/19691289" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "2500966", "url": "https://glygen.org/publication/PubMed/2500966" } ], "site_lbl": "Ser25" }, { "start_pos": 25, "end_pos": 25, "kinase_uniprot_canonical_ac": "Q96GD4-1", "kinase_gene_name": "AURKB", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" }, { "database": "PubMed", "id": "12458200", "url": "https://glygen.org/publication/PubMed/12458200" } ], "site_lbl": "Ser25" }, { "start_pos": 25, "end_pos": 25, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P08670", "url": "https://www.uniprot.org/uniprot/P08670" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "24275569", "url": "https://glygen.org/publication/PubMed/24275569" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "phospho.ELM", "id": "P08670", "url": "http://phospho.elm.eu.org/byAccession/P08670.html" }, { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" } ], "site_lbl": "Ser25" }, { "start_pos": 261, "end_pos": 261, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" }, { "database": "PubMed", "id": "19007248", "url": "https://glygen.org/publication/PubMed/19007248" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Ser261" }, { "start_pos": 266, "end_pos": 266, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" }, { "database": "PubMed", "id": "19007248", "url": "https://glygen.org/publication/PubMed/19007248" } ], "site_lbl": "Thr266" }, { "start_pos": 26, "end_pos": 26, "kinase_uniprot_canonical_ac": "P17252-1", "kinase_gene_name": "PRKCA", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" }, { "database": "PubMed", "id": "11895474", "url": "https://glygen.org/publication/PubMed/11895474" }, { "database": "PubMed", "id": "17287340", "url": "https://glygen.org/publication/PubMed/17287340" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "2500966", "url": "https://glygen.org/publication/PubMed/2500966" } ], "site_lbl": "Ser26" }, { "start_pos": 26, "end_pos": 26, "kinase_uniprot_canonical_ac": "Q13153-1", "kinase_gene_name": "PAK1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" }, { "database": "PubMed", "id": "11895474", "url": "https://glygen.org/publication/PubMed/11895474" } ], "site_lbl": "Ser26" }, { "start_pos": 26, "end_pos": 26, "kinase_uniprot_canonical_ac": "Q13177-1", "kinase_gene_name": "PAK2", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" }, { "database": "PubMed", "id": "11895474", "url": "https://glygen.org/publication/PubMed/11895474" }, { "database": "PubMed", "id": "17287340", "url": "https://glygen.org/publication/PubMed/17287340" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "2500966", "url": "https://glygen.org/publication/PubMed/2500966" } ], "site_lbl": "Ser26" }, { "start_pos": 26, "end_pos": 26, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P08670", "url": "https://www.uniprot.org/uniprot/P08670" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "phospho.ELM", "id": "P08670", "url": "http://phospho.elm.eu.org/byAccession/P08670.html" }, { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" }, { "database": "PubMed", "id": "11895474", "url": "https://glygen.org/publication/PubMed/11895474" } ], "site_lbl": "Ser26" }, { "start_pos": 27, "end_pos": 27, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" }, { "database": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" }, { "database": "PubMed", "id": "17287340", "url": "https://glygen.org/publication/PubMed/17287340" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "phospho.ELM", "id": "P08670", "url": "http://phospho.elm.eu.org/byAccession/P08670.html" } ], "site_lbl": "Ser27" }, { "start_pos": 299, "end_pos": 299, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P08670", "url": "https://www.uniprot.org/uniprot/P08670" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "19007248", "url": "https://glygen.org/publication/PubMed/19007248" }, { "database": "phospho.ELM", "id": "P08670", "url": "http://phospho.elm.eu.org/byAccession/P08670.html" } ], "site_lbl": "Ser299" }, { "start_pos": 29, "end_pos": 29, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" }, { "database": "PubMed", "id": "18212344", "url": "https://glygen.org/publication/PubMed/18212344" }, { "database": "PubMed", "id": "19007248", "url": "https://glygen.org/publication/PubMed/19007248" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Ser29" }, { "start_pos": 2, "end_pos": 2, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "24282534", "url": "https://glygen.org/publication/PubMed/24282534" } ], "site_lbl": "Ser2" }, { "start_pos": 30, "end_pos": 30, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" }, { "database": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" } ], "site_lbl": "Tyr30" }, { "start_pos": 325, "end_pos": 325, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P08670", "url": "https://www.uniprot.org/uniprot/P08670" }, { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" }, { "database": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" }, { "database": "PubMed", "id": "18578522", "url": "https://glygen.org/publication/PubMed/18578522" }, { "database": "PubMed", "id": "19664995", "url": "https://glygen.org/publication/PubMed/19664995" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Ser325" }, { "start_pos": 327, "end_pos": 327, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" }, { "database": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "phospho.ELM", "id": "P08670", "url": "http://phospho.elm.eu.org/byAccession/P08670.html" } ], "site_lbl": "Thr327" }, { "start_pos": 32, "end_pos": 32, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" }, { "database": "PubMed", "id": "19691289", "url": "https://glygen.org/publication/PubMed/19691289" } ], "site_lbl": "Thr32" }, { "start_pos": 33, "end_pos": 33, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" }, { "database": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" }, { "database": "PubMed", "id": "19007248", "url": "https://glygen.org/publication/PubMed/19007248" }, { "database": "PubMed", "id": "19691289", "url": "https://glygen.org/publication/PubMed/19691289" } ], "site_lbl": "Thr33" }, { "start_pos": 34, "end_pos": 34, "kinase_uniprot_canonical_ac": "P17252-1", "kinase_gene_name": "PRKCA", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" }, { "database": "PubMed", "id": "18212344", "url": "https://glygen.org/publication/PubMed/18212344" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "2500966", "url": "https://glygen.org/publication/PubMed/2500966" } ], "site_lbl": "Ser34" }, { "start_pos": 34, "end_pos": 34, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by PKC; alternate", "evidence": [ { "database": "UniProtKB", "id": "P08670", "url": "https://www.uniprot.org/uniprot/P08670" }, { "database": "phospho.ELM", "id": "P08670", "url": "http://phospho.elm.eu.org/byAccession/P08670.html" }, { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" } ], "site_lbl": "Ser34" }, { "start_pos": 38, "end_pos": 38, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "phospho.ELM", "id": "P08670", "url": "http://phospho.elm.eu.org/byAccession/P08670.html" }, { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" }, { "database": "PubMed", "id": "18083107", "url": "https://glygen.org/publication/PubMed/18083107" } ], "site_lbl": "Tyr38" }, { "start_pos": 39, "end_pos": 39, "kinase_uniprot_canonical_ac": "O75116-1", "kinase_gene_name": "ROCK2", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" }, { "database": "PubMed", "id": "9565595", "url": "https://glygen.org/publication/PubMed/9565595" } ], "site_lbl": "Ser39" }, { "start_pos": 39, "end_pos": 39, "kinase_uniprot_canonical_ac": "P17252-1", "kinase_gene_name": "PRKCA", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" }, { "database": "PubMed", "id": "11895474", "url": "https://glygen.org/publication/PubMed/11895474" }, { "database": "PubMed", "id": "17287340", "url": "https://glygen.org/publication/PubMed/17287340" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "18767875", "url": "https://glygen.org/publication/PubMed/18767875" }, { "database": "PubMed", "id": "19007248", "url": "https://glygen.org/publication/PubMed/19007248" }, { "database": "PubMed", "id": "19691289", "url": "https://glygen.org/publication/PubMed/19691289" }, { "database": "PubMed", "id": "20058876", "url": "https://glygen.org/publication/PubMed/20058876" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "2500966", "url": "https://glygen.org/publication/PubMed/2500966" } ], "site_lbl": "Ser39" }, { "start_pos": 39, "end_pos": 39, "kinase_uniprot_canonical_ac": "P17612-1", "kinase_gene_name": "PRKACA", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" }, { "database": "PubMed", "id": "11895474", "url": "https://glygen.org/publication/PubMed/11895474" }, { "database": "PubMed", "id": "17287340", "url": "https://glygen.org/publication/PubMed/17287340" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "18767875", "url": "https://glygen.org/publication/PubMed/18767875" }, { "database": "PubMed", "id": "19007248", "url": "https://glygen.org/publication/PubMed/19007248" }, { "database": "PubMed", "id": "19691289", "url": "https://glygen.org/publication/PubMed/19691289" }, { "database": "PubMed", "id": "20058876", "url": "https://glygen.org/publication/PubMed/20058876" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "2500966", "url": "https://glygen.org/publication/PubMed/2500966" }, { "database": "PubMed", "id": "14762106", "url": "https://glygen.org/publication/PubMed/14762106" } ], "site_lbl": "Ser39" }, { "start_pos": 39, "end_pos": 39, "kinase_uniprot_canonical_ac": "P31749-1", "kinase_gene_name": "AKT1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" }, { "database": "PubMed", "id": "20856200", "url": "https://glygen.org/publication/PubMed/20856200" } ], "site_lbl": "Ser39" }, { "start_pos": 39, "end_pos": 39, "kinase_uniprot_canonical_ac": "P49137-1", "kinase_gene_name": "MAPKAPK2", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" }, { "database": "PubMed", "id": "12761892", "url": "https://glygen.org/publication/PubMed/12761892" }, { "database": "phospho.ELM", "id": "P08670", "url": "http://phospho.elm.eu.org/byAccession/P08670.html" } ], "site_lbl": "Ser39" }, { "start_pos": 39, "end_pos": 39, "kinase_uniprot_canonical_ac": "Q13153-1", "kinase_gene_name": "PAK1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" }, { "database": "PubMed", "id": "11895474", "url": "https://glygen.org/publication/PubMed/11895474" } ], "site_lbl": "Ser39" }, { "start_pos": 39, "end_pos": 39, "kinase_uniprot_canonical_ac": "Q13177-1", "kinase_gene_name": "PAK2", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" }, { "database": "PubMed", "id": "11895474", "url": "https://glygen.org/publication/PubMed/11895474" }, { "database": "PubMed", "id": "17287340", "url": "https://glygen.org/publication/PubMed/17287340" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "18767875", "url": "https://glygen.org/publication/PubMed/18767875" }, { "database": "PubMed", "id": "19007248", "url": "https://glygen.org/publication/PubMed/19007248" }, { "database": "PubMed", "id": "19691289", "url": "https://glygen.org/publication/PubMed/19691289" }, { "database": "PubMed", "id": "20058876", "url": "https://glygen.org/publication/PubMed/20058876" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "2500966", "url": "https://glygen.org/publication/PubMed/2500966" } ], "site_lbl": "Ser39" }, { "start_pos": 39, "end_pos": 39, "kinase_uniprot_canonical_ac": "Q96GD4-1", "kinase_gene_name": "AURKB", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" }, { "database": "PubMed", "id": "12458200", "url": "https://glygen.org/publication/PubMed/12458200" } ], "site_lbl": "Ser39" }, { "start_pos": 39, "end_pos": 39, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by CaMK2, PKA, PKC and ROCK2", "evidence": [ { "database": "UniProtKB", "id": "P08670", "url": "https://www.uniprot.org/uniprot/P08670" }, { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" }, { "database": "PubMed", "id": "32387766", "url": "" }, { "database": "phospho.ELM", "id": "P08670", "url": "http://phospho.elm.eu.org/byAccession/P08670.html" }, { "database": "PubMed", "id": "17287340", "url": "https://glygen.org/publication/PubMed/17287340" }, { "database": "PubMed", "id": "18220336", "url": "https://glygen.org/publication/PubMed/18220336" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "11895474", "url": "https://glygen.org/publication/PubMed/11895474" }, { "database": "PubMed", "id": "20856200", "url": "https://glygen.org/publication/PubMed/20856200" }, { "database": "PubMed", "id": "21969470", "url": "https://glygen.org/publication/PubMed/21969470" }, { "database": "PubMed", "id": "30696956", "url": "https://glygen.org/publication/PubMed/30696956" }, { "database": "PubMed", "id": "31862882", "url": "https://glygen.org/publication/PubMed/31862882" }, { "database": "PubMed", "id": "32047143", "url": "https://glygen.org/publication/PubMed/32047143" }, { "database": "PubMed", "id": "32389644", "url": "https://glygen.org/publication/PubMed/32389644" }, { "database": "PubMed", "id": "33050149", "url": "https://glygen.org/publication/PubMed/33050149" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "PubMed", "id": "24275569", "url": "https://glygen.org/publication/PubMed/24275569" }, { "database": "PubMed", "id": "14762106", "url": "https://glygen.org/publication/PubMed/14762106" } ], "site_lbl": "Ser39" }, { "start_pos": 400, "end_pos": 400, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" }, { "database": "PubMed", "id": "18083107", "url": "https://glygen.org/publication/PubMed/18083107" } ], "site_lbl": "Tyr400" }, { "start_pos": 409, "end_pos": 409, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P08670", "url": "https://www.uniprot.org/uniprot/P08670" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "phospho.ELM", "id": "P08670", "url": "http://phospho.elm.eu.org/byAccession/P08670.html" } ], "site_lbl": "Ser409" }, { "start_pos": 412, "end_pos": 412, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P08670", "url": "https://www.uniprot.org/uniprot/P08670" }, { "database": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "17924679", "url": "https://glygen.org/publication/PubMed/17924679" }, { "database": "PubMed", "id": "18691976", "url": "https://glygen.org/publication/PubMed/18691976" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" }, { "database": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" }, { "database": "phospho.ELM", "id": "P08670", "url": "http://phospho.elm.eu.org/byAccession/P08670.html" }, { "database": "PubMed", "id": "18220336", "url": "https://glygen.org/publication/PubMed/18220336" } ], "site_lbl": "Ser412" }, { "start_pos": 419, "end_pos": 419, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P08670", "url": "https://www.uniprot.org/uniprot/P08670" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "24275569", "url": "https://glygen.org/publication/PubMed/24275569" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" }, { "database": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" }, { "database": "PubMed", "id": "18578522", "url": "https://glygen.org/publication/PubMed/18578522" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" }, { "database": "PubMed", "id": "20058876", "url": "https://glygen.org/publication/PubMed/20058876" }, { "database": "PubMed", "id": "20166139", "url": "https://glygen.org/publication/PubMed/20166139" }, { "database": "PubMed", "id": "20230923", "url": "https://glygen.org/publication/PubMed/20230923" }, { "database": "phospho.ELM", "id": "P08670", "url": "http://phospho.elm.eu.org/byAccession/P08670.html" } ], "site_lbl": "Ser419" }, { "start_pos": 420, "end_pos": 420, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P08670", "url": "https://www.uniprot.org/uniprot/P08670" }, { "database": "PubMed", "id": "14762106", "url": "https://glygen.org/publication/PubMed/14762106" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" }, { "database": "PubMed", "id": "18578522", "url": "https://glygen.org/publication/PubMed/18578522" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" }, { "database": "PubMed", "id": "20058876", "url": "https://glygen.org/publication/PubMed/20058876" }, { "database": "PubMed", "id": "20166139", "url": "https://glygen.org/publication/PubMed/20166139" }, { "database": "PubMed", "id": "20230923", "url": "https://glygen.org/publication/PubMed/20230923" }, { "database": "phospho.ELM", "id": "P08670", "url": "http://phospho.elm.eu.org/byAccession/P08670.html" } ], "site_lbl": "Ser420" }, { "start_pos": 426, "end_pos": 426, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "P08670", "url": "https://www.uniprot.org/uniprot/P08670" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "24275569", "url": "https://glygen.org/publication/PubMed/24275569" }, { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" }, { "database": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" }, { "database": "PubMed", "id": "18578522", "url": "https://glygen.org/publication/PubMed/18578522" }, { "database": "PubMed", "id": "19691289", "url": "https://glygen.org/publication/PubMed/19691289" }, { "database": "phospho.ELM", "id": "P08670", "url": "http://phospho.elm.eu.org/byAccession/P08670.html" }, { "database": "PubMed", "id": "15274135", "url": "https://glygen.org/publication/PubMed/15274135" } ], "site_lbl": "Thr426" }, { "start_pos": 42, "end_pos": 42, "kinase_uniprot_canonical_ac": "P17252-1", "kinase_gene_name": "PRKCA", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "19007248", "url": "https://glygen.org/publication/PubMed/19007248" }, { "database": "PubMed", "id": "19415658", "url": "https://glygen.org/publication/PubMed/19415658" }, { "database": "PubMed", "id": "19691289", "url": "https://glygen.org/publication/PubMed/19691289" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "2500966", "url": "https://glygen.org/publication/PubMed/2500966" } ], "site_lbl": "Ser42" }, { "start_pos": 42, "end_pos": 42, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by PKC", "evidence": [ { "database": "UniProtKB", "id": "P08670", "url": "https://www.uniprot.org/uniprot/P08670" }, { "database": "phospho.ELM", "id": "P08670", "url": "http://phospho.elm.eu.org/byAccession/P08670.html" }, { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" }, { "database": "PubMed", "id": "18220336", "url": "https://glygen.org/publication/PubMed/18220336" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "PubMed", "id": "14762106", "url": "https://glygen.org/publication/PubMed/14762106" } ], "site_lbl": "Ser42" }, { "start_pos": 430, "end_pos": 430, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P08670", "url": "https://www.uniprot.org/uniprot/P08670" }, { "database": "PubMed", "id": "14762106", "url": "https://glygen.org/publication/PubMed/14762106" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "24275569", "url": "https://glygen.org/publication/PubMed/24275569" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" }, { "database": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" }, { "database": "PubMed", "id": "17287340", "url": "https://glygen.org/publication/PubMed/17287340" }, { "database": "PubMed", "id": "18578522", "url": "https://glygen.org/publication/PubMed/18578522" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "19691289", "url": "https://glygen.org/publication/PubMed/19691289" }, { "database": "phospho.ELM", "id": "P08670", "url": "http://phospho.elm.eu.org/byAccession/P08670.html" } ], "site_lbl": "Ser430" }, { "start_pos": 436, "end_pos": 436, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "P08670", "url": "https://www.uniprot.org/uniprot/P08670" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" }, { "database": "PubMed", "id": "18578522", "url": "https://glygen.org/publication/PubMed/18578522" } ], "site_lbl": "Thr436" }, { "start_pos": 438, "end_pos": 438, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P08670", "url": "https://www.uniprot.org/uniprot/P08670" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" }, { "database": "PubMed", "id": "18578522", "url": "https://glygen.org/publication/PubMed/18578522" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Ser438" }, { "start_pos": 446, "end_pos": 446, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "P08670", "url": "https://www.uniprot.org/uniprot/P08670" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" }, { "database": "PubMed", "id": "17924679", "url": "https://glygen.org/publication/PubMed/17924679" } ], "site_lbl": "Thr446" }, { "start_pos": 458, "end_pos": 458, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "P08670", "url": "https://www.uniprot.org/uniprot/P08670" }, { "database": "PubMed", "id": "14762106", "url": "https://glygen.org/publication/PubMed/14762106" }, { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" }, { "database": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" }, { "database": "PubMed", "id": "17287340", "url": "https://glygen.org/publication/PubMed/17287340" }, { "database": "PubMed", "id": "18767875", "url": "https://glygen.org/publication/PubMed/18767875" }, { "database": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" }, { "database": "PubMed", "id": "19664995", "url": "https://glygen.org/publication/PubMed/19664995" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "phospho.ELM", "id": "P08670", "url": "http://phospho.elm.eu.org/byAccession/P08670.html" } ], "site_lbl": "Thr458" }, { "start_pos": 459, "end_pos": 459, "kinase_uniprot_canonical_ac": "P53350-1", "kinase_gene_name": "PLK1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" }, { "database": "PubMed", "id": "24196446", "url": "https://glygen.org/publication/PubMed/24196446" } ], "site_lbl": "Ser459" }, { "start_pos": 459, "end_pos": 459, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P08670", "url": "https://www.uniprot.org/uniprot/P08670" }, { "database": "PubMed", "id": "14762106", "url": "https://glygen.org/publication/PubMed/14762106" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "PubMed", "id": "21406692", "url": "https://glygen.org/publication/PubMed/21406692" }, { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" }, { "database": "PubMed", "id": "17287340", "url": "https://glygen.org/publication/PubMed/17287340" }, { "database": "PubMed", "id": "17322306", "url": "https://glygen.org/publication/PubMed/17322306" }, { "database": "PubMed", "id": "17924679", "url": "https://glygen.org/publication/PubMed/17924679" }, { "database": "PubMed", "id": "18691976", "url": "https://glygen.org/publication/PubMed/18691976" }, { "database": "PubMed", "id": "18767875", "url": "https://glygen.org/publication/PubMed/18767875" }, { "database": "PubMed", "id": "19007248", "url": "https://glygen.org/publication/PubMed/19007248" }, { "database": "PubMed", "id": "19413330", "url": "https://glygen.org/publication/PubMed/19413330" }, { "database": "PubMed", "id": "19415658", "url": "https://glygen.org/publication/PubMed/19415658" }, { "database": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" }, { "database": "PubMed", "id": "19664995", "url": "https://glygen.org/publication/PubMed/19664995" }, { "database": "PubMed", "id": "20166139", "url": "https://glygen.org/publication/PubMed/20166139" }, { "database": "phospho.ELM", "id": "P08670", "url": "http://phospho.elm.eu.org/byAccession/P08670.html" }, { "database": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" }, { "database": "PubMed", "id": "24282534", "url": "https://glygen.org/publication/PubMed/24282534" } ], "site_lbl": "Ser459" }, { "start_pos": 47, "end_pos": 47, "kinase_uniprot_canonical_ac": "P17612-1", "kinase_gene_name": "PRKACA", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" }, { "database": "PubMed", "id": "17287340", "url": "https://glygen.org/publication/PubMed/17287340" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "2500966", "url": "https://glygen.org/publication/PubMed/2500966" } ], "site_lbl": "Ser47" }, { "start_pos": 47, "end_pos": 47, "kinase_uniprot_canonical_ac": "Q96GD4-1", "kinase_gene_name": "AURKB", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" }, { "database": "PubMed", "id": "12458200", "url": "https://glygen.org/publication/PubMed/12458200" } ], "site_lbl": "Ser47" }, { "start_pos": 47, "end_pos": 47, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P08670", "url": "https://www.uniprot.org/uniprot/P08670" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "phospho.ELM", "id": "P08670", "url": "http://phospho.elm.eu.org/byAccession/P08670.html" }, { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" }, { "database": "PubMed", "id": "17287340", "url": "https://glygen.org/publication/PubMed/17287340" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" } ], "site_lbl": "Ser47" }, { "start_pos": 48, "end_pos": 48, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "phospho.ELM", "id": "P08670", "url": "http://phospho.elm.eu.org/byAccession/P08670.html" }, { "database": "PubMed", "id": "18220336", "url": "https://glygen.org/publication/PubMed/18220336" } ], "site_lbl": "Thr48" }, { "start_pos": 49, "end_pos": 49, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P08670", "url": "https://www.uniprot.org/uniprot/P08670" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" } ], "site_lbl": "Ser49" }, { "start_pos": 51, "end_pos": 51, "kinase_uniprot_canonical_ac": "P49137-1", "kinase_gene_name": "MAPKAPK2", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" }, { "database": "PubMed", "id": "12761892", "url": "https://glygen.org/publication/PubMed/12761892" }, { "database": "phospho.ELM", "id": "P08670", "url": "http://phospho.elm.eu.org/byAccession/P08670.html" } ], "site_lbl": "Ser51" }, { "start_pos": 51, "end_pos": 51, "kinase_uniprot_canonical_ac": "Q13153-1", "kinase_gene_name": "PAK1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" }, { "database": "PubMed", "id": "11895474", "url": "https://glygen.org/publication/PubMed/11895474" } ], "site_lbl": "Ser51" }, { "start_pos": 51, "end_pos": 51, "kinase_uniprot_canonical_ac": "Q13177-1", "kinase_gene_name": "PAK2", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" }, { "database": "PubMed", "id": "11895474", "url": "https://glygen.org/publication/PubMed/11895474" }, { "database": "PubMed", "id": "18212344", "url": "https://glygen.org/publication/PubMed/18212344" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "19007248", "url": "https://glygen.org/publication/PubMed/19007248" }, { "database": "PubMed", "id": "19664995", "url": "https://glygen.org/publication/PubMed/19664995" }, { "database": "PubMed", "id": "19691289", "url": "https://glygen.org/publication/PubMed/19691289" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Ser51" }, { "start_pos": 51, "end_pos": 51, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P08670", "url": "https://www.uniprot.org/uniprot/P08670" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "PubMed", "id": "21406692", "url": "https://glygen.org/publication/PubMed/21406692" }, { "database": "PubMed", "id": "19690332", "url": "https://glygen.org/publication/PubMed/19690332" }, { "database": "phospho.ELM", "id": "P08670", "url": "http://phospho.elm.eu.org/byAccession/P08670.html" }, { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" }, { "database": "PubMed", "id": "18220336", "url": "https://glygen.org/publication/PubMed/18220336" }, { "database": "PubMed", "id": "15713670", "url": "https://glygen.org/publication/PubMed/15713670" }, { "database": "PubMed", "id": "11895474", "url": "https://glygen.org/publication/PubMed/11895474" } ], "site_lbl": "Ser51" }, { "start_pos": 53, "end_pos": 53, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine", "evidence": [ { "database": "UniProtKB", "id": "P08670", "url": "https://www.uniprot.org/uniprot/P08670" }, { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" }, { "database": "PubMed", "id": "16497976", "url": "https://glygen.org/publication/PubMed/16497976" }, { "database": "PubMed", "id": "18083107", "url": "https://glygen.org/publication/PubMed/18083107" }, { "database": "PubMed", "id": "18578522", "url": "https://glygen.org/publication/PubMed/18578522" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "18707149", "url": "https://glygen.org/publication/PubMed/18707149" }, { "database": "PubMed", "id": "19664995", "url": "https://glygen.org/publication/PubMed/19664995" }, { "database": "PubMed", "id": "19901323", "url": "https://glygen.org/publication/PubMed/19901323" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "phospho.ELM", "id": "P08670", "url": "http://phospho.elm.eu.org/byAccession/P08670.html" }, { "database": "PubMed", "id": "30696956", "url": "https://glygen.org/publication/PubMed/30696956" } ], "site_lbl": "Tyr53" }, { "start_pos": 55, "end_pos": 55, "kinase_uniprot_canonical_ac": "P06493-1", "kinase_gene_name": "CDK1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" }, { "database": "PubMed", "id": "16260496", "url": "https://glygen.org/publication/PubMed/16260496" }, { "database": "PubMed", "id": "7983050", "url": "https://glygen.org/publication/PubMed/7983050" } ], "site_lbl": "Ser55" }, { "start_pos": 55, "end_pos": 55, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P08670", "url": "https://www.uniprot.org/uniprot/P08670" }, { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" }, { "database": "PubMed", "id": "17287340", "url": "https://glygen.org/publication/PubMed/17287340" }, { "database": "PubMed", "id": "18491316", "url": "https://glygen.org/publication/PubMed/18491316" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "18691976", "url": "https://glygen.org/publication/PubMed/18691976" }, { "database": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" }, { "database": "PubMed", "id": "19664995", "url": "https://glygen.org/publication/PubMed/19664995" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "phospho.ELM", "id": "P08670", "url": "http://phospho.elm.eu.org/byAccession/P08670.html" }, { "database": "PubMed", "id": "12686602", "url": "https://glygen.org/publication/PubMed/12686602" }, { "database": "PubMed", "id": "12691412", "url": "https://glygen.org/publication/PubMed/12691412" }, { "database": "PubMed", "id": "16260496", "url": "https://glygen.org/publication/PubMed/16260496" }, { "database": "PubMed", "id": "19584300", "url": "https://glygen.org/publication/PubMed/19584300" }, { "database": "PubMed", "id": "25375189", "url": "https://glygen.org/publication/PubMed/25375189" }, { "database": "PubMed", "id": "27603133", "url": "https://glygen.org/publication/PubMed/27603133" }, { "database": "PubMed", "id": "32855235", "url": "https://glygen.org/publication/PubMed/32855235" }, { "database": "PubMed", "id": "9030781", "url": "https://glygen.org/publication/PubMed/9030781" }, { "database": "PubMed", "id": "9378721", "url": "https://glygen.org/publication/PubMed/9378721" } ], "site_lbl": "Ser55" }, { "start_pos": 56, "end_pos": 56, "kinase_uniprot_canonical_ac": "P06493-1", "kinase_gene_name": "CDK1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" }, { "database": "PubMed", "id": "15345747", "url": "https://glygen.org/publication/PubMed/15345747" }, { "database": "PubMed", "id": "16565220", "url": "https://glygen.org/publication/PubMed/16565220" }, { "database": "PubMed", "id": "16964243", "url": "https://glygen.org/publication/PubMed/16964243" }, { "database": "PubMed", "id": "17287340", "url": "https://glygen.org/publication/PubMed/17287340" }, { "database": "PubMed", "id": "17924679", "url": "https://glygen.org/publication/PubMed/17924679" }, { "database": "PubMed", "id": "18212344", "url": "https://glygen.org/publication/PubMed/18212344" }, { "database": "PubMed", "id": "18491316", "url": "https://glygen.org/publication/PubMed/18491316" }, { "database": "PubMed", "id": "18578522", "url": "https://glygen.org/publication/PubMed/18578522" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "18691976", "url": "https://glygen.org/publication/PubMed/18691976" }, { "database": "PubMed", "id": "18707149", "url": "https://glygen.org/publication/PubMed/18707149" }, { "database": "PubMed", "id": "18767875", "url": "https://glygen.org/publication/PubMed/18767875" }, { "database": "PubMed", "id": "19007248", "url": "https://glygen.org/publication/PubMed/19007248" }, { "database": "PubMed", "id": "19413330", "url": "https://glygen.org/publication/PubMed/19413330" }, { "database": "PubMed", "id": "19415658", "url": "https://glygen.org/publication/PubMed/19415658" }, { "database": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" }, { "database": "PubMed", "id": "19664995", "url": "https://glygen.org/publication/PubMed/19664995" }, { "database": "PubMed", "id": "19691289", "url": "https://glygen.org/publication/PubMed/19691289" }, { "database": "PubMed", "id": "20058876", "url": "https://glygen.org/publication/PubMed/20058876" }, { "database": "PubMed", "id": "20068230", "url": "https://glygen.org/publication/PubMed/20068230" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "7983050", "url": "https://glygen.org/publication/PubMed/7983050" }, { "database": "phospho.ELM", "id": "P08670", "url": "http://phospho.elm.eu.org/byAccession/P08670.html" }, { "database": "PubMed", "id": "27603133", "url": "https://glygen.org/publication/PubMed/27603133" } ], "site_lbl": "Ser56" }, { "start_pos": 56, "end_pos": 56, "kinase_uniprot_canonical_ac": "P49137-1", "kinase_gene_name": "MAPKAPK2", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" }, { "database": "PubMed", "id": "12761892", "url": "https://glygen.org/publication/PubMed/12761892" }, { "database": "phospho.ELM", "id": "P08670", "url": "http://phospho.elm.eu.org/byAccession/P08670.html" } ], "site_lbl": "Ser56" }, { "start_pos": 56, "end_pos": 56, "kinase_uniprot_canonical_ac": "Q13153-1", "kinase_gene_name": "PAK1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" }, { "database": "PubMed", "id": "15766329", "url": "https://glygen.org/publication/PubMed/15766329" } ], "site_lbl": "Ser56" }, { "start_pos": 56, "end_pos": 56, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by CDK5 and CDK1", "evidence": [ { "database": "UniProtKB", "id": "P08670", "url": "https://www.uniprot.org/uniprot/P08670" }, { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" }, { "database": "PubMed", "id": "15345747", "url": "https://glygen.org/publication/PubMed/15345747" }, { "database": "PubMed", "id": "16565220", "url": "https://glygen.org/publication/PubMed/16565220" }, { "database": "PubMed", "id": "16964243", "url": "https://glygen.org/publication/PubMed/16964243" }, { "database": "PubMed", "id": "17287340", "url": "https://glygen.org/publication/PubMed/17287340" }, { "database": "PubMed", "id": "17924679", "url": "https://glygen.org/publication/PubMed/17924679" }, { "database": "PubMed", "id": "18212344", "url": "https://glygen.org/publication/PubMed/18212344" }, { "database": "PubMed", "id": "18491316", "url": "https://glygen.org/publication/PubMed/18491316" }, { "database": "PubMed", "id": "18578522", "url": "https://glygen.org/publication/PubMed/18578522" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "18691976", "url": "https://glygen.org/publication/PubMed/18691976" }, { "database": "PubMed", "id": "18707149", "url": "https://glygen.org/publication/PubMed/18707149" }, { "database": "PubMed", "id": "18767875", "url": "https://glygen.org/publication/PubMed/18767875" }, { "database": "PubMed", "id": "19007248", "url": "https://glygen.org/publication/PubMed/19007248" }, { "database": "PubMed", "id": "19413330", "url": "https://glygen.org/publication/PubMed/19413330" }, { "database": "PubMed", "id": "19415658", "url": "https://glygen.org/publication/PubMed/19415658" }, { "database": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" }, { "database": "PubMed", "id": "19664995", "url": "https://glygen.org/publication/PubMed/19664995" }, { "database": "PubMed", "id": "19691289", "url": "https://glygen.org/publication/PubMed/19691289" }, { "database": "PubMed", "id": "20058876", "url": "https://glygen.org/publication/PubMed/20058876" }, { "database": "PubMed", "id": "20068230", "url": "https://glygen.org/publication/PubMed/20068230" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "7983050", "url": "https://glygen.org/publication/PubMed/7983050" }, { "database": "PubMed", "id": "21465480", "url": "https://glygen.org/publication/PubMed/21465480" }, { "database": "phospho.ELM", "id": "P08670", "url": "http://phospho.elm.eu.org/byAccession/P08670.html" }, { "database": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" }, { "database": "PubMed", "id": "15713670", "url": "https://glygen.org/publication/PubMed/15713670" }, { "database": "PubMed", "id": "15766329", "url": "https://glygen.org/publication/PubMed/15766329" }, { "database": "PubMed", "id": "19270731", "url": "https://glygen.org/publication/PubMed/19270731" }, { "database": "PubMed", "id": "16990256", "url": "https://glygen.org/publication/PubMed/16990256" }, { "database": "PubMed", "id": "16997882", "url": "https://glygen.org/publication/PubMed/16997882" }, { "database": "PubMed", "id": "19494238", "url": "https://glygen.org/publication/PubMed/19494238" }, { "database": "PubMed", "id": "19812368", "url": "https://glygen.org/publication/PubMed/19812368" }, { "database": "PubMed", "id": "24282534", "url": "https://glygen.org/publication/PubMed/24282534" }, { "database": "PubMed", "id": "30135525", "url": "https://glygen.org/publication/PubMed/30135525" }, { "database": "PubMed", "id": "30267961", "url": "https://glygen.org/publication/PubMed/30267961" }, { "database": "PubMed", "id": "30658903", "url": "https://glygen.org/publication/PubMed/30658903" }, { "database": "PubMed", "id": "31862882", "url": "https://glygen.org/publication/PubMed/31862882" }, { "database": "PubMed", "id": "31928973", "url": "https://glygen.org/publication/PubMed/31928973" }, { "database": "PubMed", "id": "31931758", "url": "https://glygen.org/publication/PubMed/31931758" }, { "database": "PubMed", "id": "32047143", "url": "https://glygen.org/publication/PubMed/32047143" }, { "database": "PubMed", "id": "32389644", "url": "https://glygen.org/publication/PubMed/32389644" }, { "database": "PubMed", "id": "33050149", "url": "https://glygen.org/publication/PubMed/33050149" }, { "database": "PubMed", "id": "36001933", "url": "" }, { "database": "PubMed", "id": "36231009", "url": "" }, { "database": "PubMed", "id": "19690332", "url": "https://glygen.org/publication/PubMed/19690332" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" } ], "site_lbl": "Ser56" }, { "start_pos": 5, "end_pos": 5, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P08670", "url": "https://www.uniprot.org/uniprot/P08670" }, { "database": "PubMed", "id": "14762106", "url": "https://glygen.org/publication/PubMed/14762106" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "phospho.ELM", "id": "P08670", "url": "http://phospho.elm.eu.org/byAccession/P08670.html" } ], "site_lbl": "Ser5" }, { "start_pos": 61, "end_pos": 61, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine", "evidence": [ { "database": "UniProtKB", "id": "P08670", "url": "https://www.uniprot.org/uniprot/P08670" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "PubMed", "id": "19690332", "url": "https://glygen.org/publication/PubMed/19690332" }, { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" }, { "database": "PubMed", "id": "15592455", "url": "https://glygen.org/publication/PubMed/15592455" }, { "database": "PubMed", "id": "16497976", "url": "https://glygen.org/publication/PubMed/16497976" }, { "database": "PubMed", "id": "17287340", "url": "https://glygen.org/publication/PubMed/17287340" }, { "database": "PubMed", "id": "18212344", "url": "https://glygen.org/publication/PubMed/18212344" }, { "database": "PubMed", "id": "18491316", "url": "https://glygen.org/publication/PubMed/18491316" }, { "database": "PubMed", "id": "18578522", "url": "https://glygen.org/publication/PubMed/18578522" }, { "database": "PubMed", "id": "18707149", "url": "https://glygen.org/publication/PubMed/18707149" }, { "database": "PubMed", "id": "19901323", "url": "https://glygen.org/publication/PubMed/19901323" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "20230923", "url": "https://glygen.org/publication/PubMed/20230923" }, { "database": "phospho.ELM", "id": "P08670", "url": "http://phospho.elm.eu.org/byAccession/P08670.html" }, { "database": "PubMed", "id": "18083107", "url": "https://glygen.org/publication/PubMed/18083107" }, { "database": "PubMed", "id": "30696956", "url": "https://glygen.org/publication/PubMed/30696956" } ], "site_lbl": "Tyr61" }, { "start_pos": 65, "end_pos": 65, "kinase_uniprot_canonical_ac": "Q96GD4-1", "kinase_gene_name": "AURKB", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" }, { "database": "PubMed", "id": "12458200", "url": "https://glygen.org/publication/PubMed/12458200" } ], "site_lbl": "Ser65" }, { "start_pos": 65, "end_pos": 65, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "phospho.ELM", "id": "P08670", "url": "http://phospho.elm.eu.org/byAccession/P08670.html" } ], "site_lbl": "Ser65" }, { "start_pos": 66, "end_pos": 66, "kinase_uniprot_canonical_ac": "Q13153-1", "kinase_gene_name": "PAK1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" }, { "database": "PubMed", "id": "11895474", "url": "https://glygen.org/publication/PubMed/11895474" } ], "site_lbl": "Ser66" }, { "start_pos": 66, "end_pos": 66, "kinase_uniprot_canonical_ac": "Q13177-1", "kinase_gene_name": "PAK2", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" }, { "database": "PubMed", "id": "11895474", "url": "https://glygen.org/publication/PubMed/11895474" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Ser66" }, { "start_pos": 66, "end_pos": 66, "kinase_uniprot_canonical_ac": "Q96GD4-1", "kinase_gene_name": "AURKB", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" }, { "database": "PubMed", "id": "12458200", "url": "https://glygen.org/publication/PubMed/12458200" } ], "site_lbl": "Ser66" }, { "start_pos": 66, "end_pos": 66, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P08670", "url": "https://www.uniprot.org/uniprot/P08670" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "phospho.ELM", "id": "P08670", "url": "http://phospho.elm.eu.org/byAccession/P08670.html" }, { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "11895474", "url": "https://glygen.org/publication/PubMed/11895474" } ], "site_lbl": "Ser66" }, { "start_pos": 72, "end_pos": 72, "kinase_uniprot_canonical_ac": "O75116-1", "kinase_gene_name": "ROCK2", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" }, { "database": "PubMed", "id": "9565595", "url": "https://glygen.org/publication/PubMed/9565595" } ], "site_lbl": "Ser72" }, { "start_pos": 72, "end_pos": 72, "kinase_uniprot_canonical_ac": "P17612-1", "kinase_gene_name": "PRKACA", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" }, { "database": "PubMed", "id": "14762106", "url": "https://glygen.org/publication/PubMed/14762106" } ], "site_lbl": "Ser72" }, { "start_pos": 72, "end_pos": 72, "kinase_uniprot_canonical_ac": "Q13464-1", "kinase_gene_name": "ROCK1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "19007248", "url": "https://glygen.org/publication/PubMed/19007248" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "20166139", "url": "https://glygen.org/publication/PubMed/20166139" }, { "database": "PubMed", "id": "9565595", "url": "https://glygen.org/publication/PubMed/9565595" }, { "database": "phospho.ELM", "id": "P08670", "url": "http://phospho.elm.eu.org/byAccession/P08670.html" } ], "site_lbl": "Ser72" }, { "start_pos": 72, "end_pos": 72, "kinase_uniprot_canonical_ac": "Q96GD4-1", "kinase_gene_name": "AURKB", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" }, { "database": "PubMed", "id": "12458200", "url": "https://glygen.org/publication/PubMed/12458200" } ], "site_lbl": "Ser72" }, { "start_pos": 72, "end_pos": 72, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by AURKB and ROCK2", "evidence": [ { "database": "UniProtKB", "id": "P08670", "url": "https://www.uniprot.org/uniprot/P08670" }, { "database": "phospho.ELM", "id": "P08670", "url": "http://phospho.elm.eu.org/byAccession/P08670.html" }, { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "9565595", "url": "https://glygen.org/publication/PubMed/9565595" }, { "database": "PubMed", "id": "11420699", "url": "https://glygen.org/publication/PubMed/11420699" }, { "database": "PubMed", "id": "12458200", "url": "https://glygen.org/publication/PubMed/12458200" }, { "database": "PubMed", "id": "12553669", "url": "https://glygen.org/publication/PubMed/12553669" }, { "database": "PubMed", "id": "15597762", "url": "https://glygen.org/publication/PubMed/15597762" }, { "database": "PubMed", "id": "15676024", "url": "https://glygen.org/publication/PubMed/15676024" }, { "database": "PubMed", "id": "21969470", "url": "https://glygen.org/publication/PubMed/21969470" }, { "database": "PubMed", "id": "30658903", "url": "https://glygen.org/publication/PubMed/30658903" }, { "database": "PubMed", "id": "30696956", "url": "https://glygen.org/publication/PubMed/30696956" }, { "database": "PubMed", "id": "31931758", "url": "https://glygen.org/publication/PubMed/31931758" }, { "database": "PubMed", "id": "32389644", "url": "https://glygen.org/publication/PubMed/32389644" }, { "database": "PubMed", "id": "33290258", "url": "https://glygen.org/publication/PubMed/33290258" }, { "database": "PubMed", "id": "14762106", "url": "https://glygen.org/publication/PubMed/14762106" } ], "site_lbl": "Ser72" }, { "start_pos": 73, "end_pos": 73, "kinase_uniprot_canonical_ac": "Q13153-1", "kinase_gene_name": "PAK1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" }, { "database": "PubMed", "id": "11895474", "url": "https://glygen.org/publication/PubMed/11895474" } ], "site_lbl": "Ser73" }, { "start_pos": 73, "end_pos": 73, "kinase_uniprot_canonical_ac": "Q13177-1", "kinase_gene_name": "PAK2", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" }, { "database": "PubMed", "id": "11895474", "url": "https://glygen.org/publication/PubMed/11895474" }, { "database": "PubMed", "id": "18578522", "url": "https://glygen.org/publication/PubMed/18578522" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "19007248", "url": "https://glygen.org/publication/PubMed/19007248" }, { "database": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "20166139", "url": "https://glygen.org/publication/PubMed/20166139" } ], "site_lbl": "Ser73" }, { "start_pos": 73, "end_pos": 73, "kinase_uniprot_canonical_ac": "Q96GD4-1", "kinase_gene_name": "AURKB", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" }, { "database": "PubMed", "id": "12458200", "url": "https://glygen.org/publication/PubMed/12458200" } ], "site_lbl": "Ser73" }, { "start_pos": 73, "end_pos": 73, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P08670", "url": "https://www.uniprot.org/uniprot/P08670" }, { "database": "PubMed", "id": "14762106", "url": "https://glygen.org/publication/PubMed/14762106" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "phospho.ELM", "id": "P08670", "url": "http://phospho.elm.eu.org/byAccession/P08670.html" }, { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" }, { "database": "PubMed", "id": "12458200", "url": "https://glygen.org/publication/PubMed/12458200" }, { "database": "PubMed", "id": "15676024", "url": "https://glygen.org/publication/PubMed/15676024" }, { "database": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" }, { "database": "PubMed", "id": "11420699", "url": "https://glygen.org/publication/PubMed/11420699" }, { "database": "PubMed", "id": "14722118", "url": "https://glygen.org/publication/PubMed/14722118" }, { "database": "PubMed", "id": "11895474", "url": "https://glygen.org/publication/PubMed/11895474" }, { "database": "PubMed", "id": "30696956", "url": "https://glygen.org/publication/PubMed/30696956" }, { "database": "PubMed", "id": "31862882", "url": "https://glygen.org/publication/PubMed/31862882" } ], "site_lbl": "Ser73" }, { "start_pos": 7, "end_pos": 7, "kinase_uniprot_canonical_ac": "P17252-1", "kinase_gene_name": "PRKCA", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" }, { "database": "PubMed", "id": "18212344", "url": "https://glygen.org/publication/PubMed/18212344" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "19664995", "url": "https://glygen.org/publication/PubMed/19664995" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "2500966", "url": "https://glygen.org/publication/PubMed/2500966" } ], "site_lbl": "Ser7" }, { "start_pos": 7, "end_pos": 7, "kinase_uniprot_canonical_ac": "P17612-1", "kinase_gene_name": "PRKACA", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" }, { "database": "PubMed", "id": "18212344", "url": "https://glygen.org/publication/PubMed/18212344" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "19664995", "url": "https://glygen.org/publication/PubMed/19664995" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "2500966", "url": "https://glygen.org/publication/PubMed/2500966" } ], "site_lbl": "Ser7" }, { "start_pos": 7, "end_pos": 7, "kinase_uniprot_canonical_ac": "Q02156-1", "kinase_gene_name": "PRKCE", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" }, { "database": "PubMed", "id": "16270034", "url": "https://glygen.org/publication/PubMed/16270034" } ], "site_lbl": "Ser7" }, { "start_pos": 7, "end_pos": 7, "kinase_uniprot_canonical_ac": "Q96GD4-1", "kinase_gene_name": "AURKB", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" }, { "database": "PubMed", "id": "12458200", "url": "https://glygen.org/publication/PubMed/12458200" } ], "site_lbl": "Ser7" }, { "start_pos": 7, "end_pos": 7, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by PKA and PKC; alternate", "evidence": [ { "database": "UniProtKB", "id": "P08670", "url": "https://www.uniprot.org/uniprot/P08670" }, { "database": "iPTMnet", "id": "B0YJC4", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/B0YJC4" }, { "database": "PubMed", "id": "27869121", "url": "" }, { "database": "phospho.ELM", "id": "P08670", "url": "http://phospho.elm.eu.org/byAccession/P08670.html" }, { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "14762106", "url": "https://glygen.org/publication/PubMed/14762106" } ], "site_lbl": "Ser7" }, { "start_pos": 83, "end_pos": 83, "kinase_uniprot_canonical_ac": "P49137-1", "kinase_gene_name": "MAPKAPK2", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" }, { "database": "PubMed", "id": "12761892", "url": "https://glygen.org/publication/PubMed/12761892" }, { "database": "phospho.ELM", "id": "P08670", "url": "http://phospho.elm.eu.org/byAccession/P08670.html" } ], "site_lbl": "Ser83" }, { "start_pos": 83, "end_pos": 83, "kinase_uniprot_canonical_ac": "P53350-1", "kinase_gene_name": "PLK1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" }, { "database": "PubMed", "id": "18056432", "url": "https://glygen.org/publication/PubMed/18056432" } ], "site_lbl": "Ser83" }, { "start_pos": 83, "end_pos": 83, "kinase_uniprot_canonical_ac": "Q13557-1", "kinase_gene_name": "CAMK2D", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" }, { "database": "PubMed", "id": "10852918", "url": "https://glygen.org/publication/PubMed/10852918" }, { "database": "PubMed", "id": "15345747", "url": "https://glygen.org/publication/PubMed/15345747" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "20166139", "url": "https://glygen.org/publication/PubMed/20166139" } ], "site_lbl": "Ser83" }, { "start_pos": 83, "end_pos": 83, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P08670", "url": "https://www.uniprot.org/uniprot/P08670" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "24275569", "url": "https://glygen.org/publication/PubMed/24275569" }, { "database": "phospho.ELM", "id": "P08670", "url": "http://phospho.elm.eu.org/byAccession/P08670.html" }, { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" }, { "database": "PubMed", "id": "16140754", "url": "https://glygen.org/publication/PubMed/16140754" }, { "database": "PubMed", "id": "9794428", "url": "https://glygen.org/publication/PubMed/9794428" }, { "database": "PubMed", "id": "29107103", "url": "https://glygen.org/publication/PubMed/29107103" }, { "database": "PubMed", "id": "31862882", "url": "https://glygen.org/publication/PubMed/31862882" }, { "database": "PubMed", "id": "31928973", "url": "https://glygen.org/publication/PubMed/31928973" }, { "database": "PubMed", "id": "32855235", "url": "https://glygen.org/publication/PubMed/32855235" }, { "database": "PubMed", "id": "33050149", "url": "https://glygen.org/publication/PubMed/33050149" }, { "database": "PubMed", "id": "35760612", "url": "" } ], "site_lbl": "Ser83" }, { "start_pos": 87, "end_pos": 87, "kinase_uniprot_canonical_ac": "Q96GD4-1", "kinase_gene_name": "AURKB", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" }, { "database": "PubMed", "id": "12458200", "url": "https://glygen.org/publication/PubMed/12458200" } ], "site_lbl": "Ser87" }, { "start_pos": 87, "end_pos": 87, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P08670", "url": "https://www.uniprot.org/uniprot/P08670" }, { "database": "PubMed", "id": "24275569", "url": "https://glygen.org/publication/PubMed/24275569" }, { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Ser87" }, { "start_pos": 8, "end_pos": 8, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P08670", "url": "https://www.uniprot.org/uniprot/P08670" }, { "database": "PubMed", "id": "14762106", "url": "https://glygen.org/publication/PubMed/14762106" }, { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" } ], "site_lbl": "Ser8" }, { "start_pos": 99, "end_pos": 99, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Thr99" }, { "start_pos": 9, "end_pos": 9, "kinase_uniprot_canonical_ac": "P17252-1", "kinase_gene_name": "PRKCA", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" }, { "database": "PubMed", "id": "19664995", "url": "https://glygen.org/publication/PubMed/19664995" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "2500966", "url": "https://glygen.org/publication/PubMed/2500966" } ], "site_lbl": "Ser9" }, { "start_pos": 9, "end_pos": 9, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by PKC", "evidence": [ { "database": "UniProtKB", "id": "P08670", "url": "https://www.uniprot.org/uniprot/P08670" }, { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" }, { "database": "PubMed", "id": "14762106", "url": "https://glygen.org/publication/PubMed/14762106" } ], "site_lbl": "Ser9" } ], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "Constitutive activation of Stat3 signaling confers resistance to apoptosis in human U266 myeloma cells.", "journal": "Immunity", "date": "1999", "authors": "Catlett-Falcone R, Landowski TH, Oshiro MM, Turkson J, Levitzki A, Savino R, Ciliberto G, Moscinski L, Fernandez-Luna JL, Nunez G, Dalton WS, Jove R", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "10023775", "url": "https://glygen.org/publication/PubMed/10023775" } ] }, { "title": "Noncanonical MMS2-encoded ubiquitin-conjugating enzyme functions in assembly of novel polyubiquitin chains for DNA repair.", "journal": "Cell", "date": "1999", "authors": "Hofmann RM, Pickart CM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9646399", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9646399" } ], "reference": [ { "type": "PubMed", "id": "10089880", "url": "https://glygen.org/publication/PubMed/10089880" } ] }, { "title": "Crystal structure of the interleukin-4/receptor alpha chain complex reveals a mosaic binding interface.", "journal": "Cell", "date": "1999", "authors": "Hage T, Sebald W, Reinemer P", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "10219247", "url": "https://glygen.org/publication/PubMed/10219247" } ] }, { "title": "Regulation of the germline immunoglobulin Cgamma1 promoter by CD40 ligand and IL-4: dual role for tandem NF-kappaB binding sites.", "journal": "Molecular immunology", "date": "1999", "authors": "Warren WD, Roberts KL, Linehan LA, Berton MT", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "10369418", "url": "https://glygen.org/publication/PubMed/10369418" } ] }, { "title": "Changes in nuclear morphology during apoptosis correlate with vimentin cleavage by different caspases located either upstream or downstream of Bcl-2 action.", "journal": "Genes to cells : devoted to molecular & cellular mechanisms", "date": "1999", "authors": "Morishima N", "evidence": [ { "database": "Reactome", "id": "R-HSA-264870", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-264870" } ], "reference": [ { "type": "PubMed", "id": "10469173", "url": "https://glygen.org/publication/PubMed/10469173" } ] }, { "title": "Characterization and dynamics of aggresome formation by a cytosolic GFP-chimera.", "journal": "The Journal of cell biology", "date": "1999", "authors": "Garcia-Mata R, Bebok Z, Sorscher EJ, Sztul ES", "evidence": [ { "database": "Reactome", "id": "R-HSA-9646399", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9646399" } ], "reference": [ { "type": "PubMed", "id": "10491388", "url": "https://glygen.org/publication/PubMed/10491388" } ] }, { "title": "Functional synergism of STAT6 with either NF-kappa B or PU.1 to mediate IL-4-induced activation of IgE germline gene transcription.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1999", "authors": "Stutz AM, Woisetschlager M", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "10510379", "url": "https://glygen.org/publication/PubMed/10510379" } ] }, { "title": "Caspase-3 and caspase-7 but not caspase-6 cleave Gas2 in vitro: implications for microfilament reorganization during apoptosis.", "journal": "Journal of cell science", "date": "1999", "authors": "Sgorbissa A, Benetti R, Marzinotto S, Schneider C, Brancolini C", "evidence": [ { "database": "Reactome", "id": "R-HSA-264870", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-264870" } ], "reference": [ { "type": "PubMed", "id": "10564664", "url": "https://glygen.org/publication/PubMed/10564664" } ] }, { "title": "Activation of eotaxin gene transcription by NF-kappa B and STAT6 in human airway epithelial cells.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1999", "authors": "Matsukura S, Stellato C, Plitt JR, Bickel C, Miura K, Georas SN, Casolaro V, Schleimer RP", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "10586089", "url": "https://glygen.org/publication/PubMed/10586089" } ] }, { "title": "Regulation of contraction in striated muscle.", "journal": "Physiological reviews", "date": "2000", "authors": "Gordon AM, Homsher E, Regnier M", "evidence": [ { "database": "Reactome", "id": "R-HSA-390522", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-390522" } ], "reference": [ { "type": "PubMed", "id": "10747208", "url": "https://glygen.org/publication/PubMed/10747208" } ] }, { "title": "Cleavage of the actin-capping protein alpha -adducin at Asp-Asp-Ser-Asp633-Ala by caspase-3 is preceded by its phosphorylation on serine 726 in cisplatin-induced apoptosis of renal epithelial cells.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "van de Water B, Tijdens IB, Verbrugge A, Huigsloot M, Dihal AA, Stevens JL, Jaken S, Mulder GJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-264870", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-264870" } ], "reference": [ { "type": "PubMed", "id": "10823823", "url": "https://glygen.org/publication/PubMed/10823823" } ] }, { "title": "Interaction of plakophilins with desmoplakin and intermediate filament proteins: an in vitro analysis.", "journal": "J. Cell Sci.", "date": "2000", "authors": "Hofmann I, Mertens C, Brettel M, Nimmrich V, Schn\u00f6lzer M, Herrmann H", "evidence": [ { "database": "UniProtKB", "id": "P08670", "url": "https://www.uniprot.org/uniprot/P08670" } ], "reference": [ { "type": "PubMed", "id": "10852826", "url": "https://glygen.org/publication/PubMed/10852826" } ] }, { "title": "Activation of Ca2+/calmodulin-dependent protein kinase II within post-synaptic dendritic spines of cultured hippocampal neurons.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Inagaki N, Nishizawa M, Arimura N, Yamamoto H, Takeuchi Y, Miyamoto E, Kaibuchi K, Inagaki M", "evidence": [ { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" } ], "reference": [ { "type": "PubMed", "id": "10852918", "url": "https://glygen.org/publication/PubMed/10852918" } ] }, { "title": "Signal transducer and activator of transcription 3 activates CCAAT enhancer-binding protein delta gene transcription in G0 growth-arrested mouse mammary epithelial cells and in involuting mouse mammary gland.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Hutt JA, O'Rourke JP, DeWille J", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "10867011", "url": "https://glygen.org/publication/PubMed/10867011" } ] }, { "title": "Identification of the cytolinker plectin as a major early in vivo substrate for caspase 8 during CD95- and tumor necrosis factor receptor-mediated apoptosis.", "journal": "Molecular and cellular biology", "date": "2000", "authors": "Stegh AH, Herrmann H, Lampel S, Weisenberger D, Andra K, Seper M, Wiche G, Krammer PH, Peter ME", "evidence": [ { "database": "Reactome", "id": "R-HSA-264870", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-264870" } ], "reference": [ { "type": "PubMed", "id": "10891503", "url": "https://glygen.org/publication/PubMed/10891503" } ] }, { "title": "The neuronal microtubule-associated protein tau is a substrate for caspase-3 and an effector of apoptosis.", "journal": "Journal of neurochemistry", "date": "2000", "authors": "Fasulo L, Ugolini G, Visintin M, Bradbury A, Brancolini C, Verzillo V, Novak M, Cattaneo A", "evidence": [ { "database": "Reactome", "id": "R-HSA-264870", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-264870" } ], "reference": [ { "type": "PubMed", "id": "10899937", "url": "https://glygen.org/publication/PubMed/10899937" } ] }, { "title": "Characterization of IL-4 and IL-13 signals dependent on the human IL-13 receptor alpha chain 1: redundancy of requirement of tyrosine residue for STAT3 activation.", "journal": "International immunology", "date": "2000", "authors": "Umeshita-Suyama R, Sugimoto R, Akaiwa M, Arima K, Yu B, Wada M, Kuwano M, Nakajima K, Hamasaki N, Izuhara K", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "11058569", "url": "https://glygen.org/publication/PubMed/11058569" } ] }, { "title": "Unique properties of lamp2a compared to other lamp2 isoforms.", "journal": "Journal of cell science", "date": "2000", "authors": "Cuervo AM, Dice JF", "evidence": [ { "database": "Reactome", "id": "R-HSA-9613829", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9613829" } ], "reference": [ { "type": "PubMed", "id": "11082038", "url": "https://glygen.org/publication/PubMed/11082038" } ] }, { "title": "A stat-responsive element in the promoter of the episialin/MUC1 gene is involved in its overexpression in carcinoma cells.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Gaemers IC, Vos HL, Volders HH, van der Valk SW, Hilkens J", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "11084045", "url": "https://glygen.org/publication/PubMed/11084045" } ] }, { "title": "Direct regulation of pituitary proopiomelanocortin by STAT3 provides a novel mechanism for immuno-neuroendocrine interfacing.", "journal": "The Journal of clinical investigation", "date": "2000", "authors": "Bousquet C, Zatelli MC, Melmed S", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "11104795", "url": "https://glygen.org/publication/PubMed/11104795" } ] }, { "title": "Suppression of signal transducer and activator of transcription 3-dependent B lymphocyte terminal differentiation by BCL-6.", "journal": "The Journal of experimental medicine", "date": "2000", "authors": "Reljic R, Wagner SD, Peakman LJ, Fearon DT", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "11120780", "url": "https://glygen.org/publication/PubMed/11120780" } ] }, { "title": "Divide-and-conquer crystallographic approach towards an atomic structure of intermediate filaments.", "journal": "J. Mol. Biol.", "date": "2001", "authors": "Strelkov S V, Herrmann H, Geisler N, Lustig A, Ivaninskii S, Zimbelmann R, Burkhard P, Aebi U", "evidence": [ { "database": "UniProtKB", "id": "P08670", "url": "https://www.uniprot.org/uniprot/P08670" } ], "reference": [ { "type": "PubMed", "id": "11243787", "url": "https://glygen.org/publication/PubMed/11243787" } ] }, { "title": "Thrombin regulates vascular smooth muscle cell growth and heat shock proteins via the JAK-STAT pathway.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Madamanchi NR, Li S, Patterson C, Runge MS", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "11278437", "url": "https://glygen.org/publication/PubMed/11278437" } ] }, { "title": "Co-operative effect of c-Src tyrosine kinase and Stat3 in activation of hepatocyte growth factor expression in mammary carcinoma cells.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Hung W, Elliott B", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "11278729", "url": "https://glygen.org/publication/PubMed/11278729" } ] }, { "title": "c-Jun and c-Fos cooperate with STAT3 in IL-6-induced transactivation of the IL-6 respone element (IRE).", "journal": "Cytokine", "date": "2001", "authors": "Schuringa JJ, Timmer H, Luttickhuizen D, Vellenga E, Kruijer W", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "11356008", "url": "https://glygen.org/publication/PubMed/11356008" } ] }, { "title": "Stat3-mediated Myc expression is required for Src transformation and PDGF-induced mitogenesis.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2001", "authors": "Bowman T, Broome MA, Sinibaldi D, Wharton W, Pledger WJ, Sedivy JM, Irby R, Yeatman T, Courtneidge SA, Jove R", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "11404481", "url": "https://glygen.org/publication/PubMed/11404481" } ] }, { "title": "Protein kinases required for segregation of vimentin filaments in mitotic process.", "journal": "Oncogene", "date": "2001", "authors": "Yasui Y, Goto H, Matsui S, Manser E, Lim L, Nagata Ki, Inagaki M", "evidence": [ { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" } ], "reference": [ { "type": "PubMed", "id": "11420699", "url": "https://glygen.org/publication/PubMed/11420699" } ] }, { "title": "Caspase cleavage of vimentin disrupts intermediate filaments and promotes apoptosis.", "journal": "Cell death and differentiation", "date": "2001", "authors": "Byun Y, Chen F, Chang R, Trivedi M, Green KJ, Cryns VL", "evidence": [ { "database": "Reactome", "id": "R-HSA-264870", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-264870" } ], "reference": [ { "type": "PubMed", "id": "11423904", "url": "https://glygen.org/publication/PubMed/11423904" } ] }, { "title": "Cooperation between STAT3 and c-jun suppresses Fas transcription.", "journal": "Molecular cell", "date": "2001", "authors": "Ivanov VN, Bhoumik A, Krasilnikov M, Raz R, Owen-Schaub LB, Levy D, Horvath CM, Ronai Z", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "11463377", "url": "https://glygen.org/publication/PubMed/11463377" } ] }, { "title": "Caspase-mediated cleavage of actin-binding and SH3-domain-containing proteins cortactin, HS1, and HIP-55 during apoptosis.", "journal": "Biochemical and biophysical research communications", "date": "2001", "authors": "Chen YR, Kori R, John B, Tan TH", "evidence": [ { "database": "Reactome", "id": "R-HSA-264870", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-264870" } ], "reference": [ { "type": "PubMed", "id": "11689006", "url": "https://glygen.org/publication/PubMed/11689006" } ] }, { "title": "Conserved segments 1A and 2B of the intermediate filament dimer: their atomic structures and role in filament assembly.", "journal": "EMBO J.", "date": "2002", "authors": "Strelkov Sergei V, Herrmann Harald, Geisler Norbert, Wedig Tatjana, Zimbelmann Ralf, Aebi Ueli, Burkhard Peter", "evidence": [ { "database": "UniProtKB", "id": "P08670", "url": "https://www.uniprot.org/uniprot/P08670" } ], "reference": [ { "type": "PubMed", "id": "11889032", "url": "https://glygen.org/publication/PubMed/11889032" } ] }, { "title": "Phosphorylation and reorganization of vimentin by p21-activated kinase (PAK).", "journal": "Genes to cells : devoted to molecular & cellular mechanisms", "date": "2002", "authors": "Goto H, Tanabe K, Manser E, Lim L, Yasui Y, Inagaki M", "evidence": [ { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" } ], "reference": [ { "type": "PubMed", "id": "11895474", "url": "https://glygen.org/publication/PubMed/11895474" } ] }, { "title": "Constitutive Stat3 activity up-regulates VEGF expression and tumor angiogenesis.", "journal": "Oncogene", "date": "2002", "authors": "Niu G, Wright KL, Huang M, Song L, Haura E, Turkson J, Zhang S, Wang T, Sinibaldi D, Coppola D, Heller R, Ellis LM, Karras J, Bromberg J, Pardoll D, Jove R, Yu H", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "11960372", "url": "https://glygen.org/publication/PubMed/11960372" } ] }, { "title": "HDAC6 is a microtubule-associated deacetylase.", "journal": "Nature", "date": "2002", "authors": "Hubbert C, Guardiola A, Shao R, Kawaguchi Y, Ito A, Nixon A, Yoshida M, Wang XF, Yao TP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9646399", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9646399" } ], "reference": [ { "type": "PubMed", "id": "12024216", "url": "https://glygen.org/publication/PubMed/12024216" } ] }, { "title": "IL-13 signal transduction in human monocytes: phosphorylation of receptor components, association with Jaks, and phosphorylation/activation of Stats.", "journal": "Journal of leukocyte biology", "date": "2002", "authors": "Roy B, Bhattacharjee A, Xu B, Ford D, Maizel AL, Cathcart MK", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "12223527", "url": "https://glygen.org/publication/PubMed/12223527" } ] }, { "title": "Expression of the suppressor of cytokine signaling-5 (SOCS5) negatively regulates IL-4-dependent STAT6 activation and Th2 differentiation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2002", "authors": "Seki Y, Hayashi K, Matsumoto A, Seki N, Tsukada J, Ransom J, Naka T, Kishimoto T, Yoshimura A, Kubo M", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "12242343", "url": "https://glygen.org/publication/PubMed/12242343" } ] }, { "title": "Aurora-B regulates the cleavage furrow-specific vimentin phosphorylation in the cytokinetic process.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Goto H, Yasui Y, Kawajiri A, Nigg EA, Terada Y, Tatsuka M, Nagata K, Inagaki M", "evidence": [ { "database": "UniProtKB", "id": "P08670", "url": "https://www.uniprot.org/uniprot/P08670" }, { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" } ], "reference": [ { "type": "PubMed", "id": "12458200", "url": "https://glygen.org/publication/PubMed/12458200" } ] }, { "title": "Vimentin intermediate filament reorganization by Cdc42: involvement of PAK and p70 S6 kinase.", "journal": "European journal of cell biology", "date": "2002", "authors": "Chan W, Kozma R, Yasui Y, Inagaki M, Leung T, Manser E, Lim L", "evidence": [ { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" } ], "reference": [ { "type": "PubMed", "id": "12553669", "url": "https://glygen.org/publication/PubMed/12553669" } ] }, { "title": "Independent and cooperative activation of chromosomal c-fos promoter by STAT3.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Yang E, Lerner L, Besser D, Darnell JE Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "12600988", "url": "https://glygen.org/publication/PubMed/12600988" } ] }, { "title": "Nestin promotes the phosphorylation-dependent disassembly of vimentin intermediate filaments during mitosis.", "journal": "Molecular biology of the cell", "date": "2003", "authors": "Chou YH, Khuon S, Herrmann H, Goldman RD", "evidence": [ { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" } ], "reference": [ { "type": "PubMed", "id": "12686602", "url": "https://glygen.org/publication/PubMed/12686602" } ] }, { "title": "Morphological assessment of the development of multinucleated giant cells in glioma by using mitosis-specific phosphorylated antibodies.", "journal": "Journal of neurosurgery", "date": "2003", "authors": "Maeda K, Mizuno M, Wakabayashi T, Takasu S, Nagasaka T, Inagaki M, Yoshida J", "evidence": [ { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" } ], "reference": [ { "type": "PubMed", "id": "12691412", "url": "https://glygen.org/publication/PubMed/12691412" } ] }, { "title": "Retaining of the assembly capability of vimentin phosphorylated by mitogen-activated protein kinase-activated protein kinase-2.", "journal": "Journal of cellular biochemistry", "date": "2003", "authors": "Cheng TJ, Tseng YF, Chang WM, Chang MD, Lai YK", "evidence": [ { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" } ], "reference": [ { "type": "PubMed", "id": "12761892", "url": "https://glygen.org/publication/PubMed/12761892" } ] }, { "title": "STATs dimerize in the absence of phosphorylation.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Braunstein J, Brutsaert S, Olson R, Schindler C", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "12832402", "url": "https://glygen.org/publication/PubMed/12832402" } ] }, { "title": "IL-4 and IL-13 induce SOCS-1 gene expression in A549 cells by three functional STAT6-binding motifs located upstream of the transcription initiation site.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2003", "authors": "Hebenstreit D, Luft P, Schmiedlechner A, Regl G, Frischauf AM, Aberger F, Duschl A, Horejs-Hoeck J", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "14634100", "url": "https://glygen.org/publication/PubMed/14634100" } ] }, { "title": "Proteomic characterization of the human centrosome by protein correlation profiling.", "journal": "Nature", "date": "2003", "authors": "Andersen Jens S, Wilkinson Christopher J, Mayor Thibault, Mortensen Peter, Nigg Erich A, Mann Matthias", "evidence": [ { "database": "UniProtKB", "id": "P08670", "url": "https://www.uniprot.org/uniprot/P08670" } ], "reference": [ { "type": "PubMed", "id": "14654843", "url": "https://glygen.org/publication/PubMed/14654843" } ] }, { "title": "The deacetylase HDAC6 regulates aggresome formation and cell viability in response to misfolded protein stress.", "journal": "Cell", "date": "2003", "authors": "Kawaguchi Y, Kovacs JJ, McLaurin A, Vance JM, Ito A, Yao TP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9646399", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9646399" } ], "reference": [ { "type": "PubMed", "id": "14675537", "url": "https://glygen.org/publication/PubMed/14675537" } ] }, { "title": "Stat3 enhances vimentin gene expression by binding to the antisilencer element and interacting with the repressor protein, ZBP-89.", "journal": "Oncogene", "date": "2004", "authors": "Wu Y, Diab I, Zhang X, Izmailova ES, Zehner ZE", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "14712222", "url": "https://glygen.org/publication/PubMed/14712222" } ] }, { "title": "Autophosphorylation of a newly identified site of Aurora-B is indispensable for cytokinesis.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Yasui Y, Urano T, Kawajiri A, Nagata K, Tatsuka M, Saya H, Furukawa K, Takahashi T, Izawa I, Inagaki M", "evidence": [ { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" } ], "reference": [ { "type": "PubMed", "id": "14722118", "url": "https://glygen.org/publication/PubMed/14722118" } ] }, { "title": "Specific in vivo phosphorylation sites determine the assembly dynamics of vimentin intermediate filaments.", "journal": "Journal of cell science", "date": "2004", "authors": "Eriksson JE, He T, Trejo-Skalli AV, Harmala-Brasken AS, Hellman J, Chou YH, Goldman RD", "evidence": [ { "database": "UniProtKB", "id": "P08670", "url": "https://www.uniprot.org/uniprot/P08670" }, { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" } ], "reference": [ { "type": "PubMed", "id": "14762106", "url": "https://glygen.org/publication/PubMed/14762106" } ] }, { "title": "SEREX identification of new tumour-associated antigens in cutaneous T-cell lymphoma.", "journal": "Br. J. Dermatol.", "date": "2004", "authors": "Hartmann T B, Thiel D, Dummer R, Schadendorf D, Eichm\u00fcller S", "evidence": [ { "database": "UniProtKB", "id": "P08670", "url": "https://www.uniprot.org/uniprot/P08670" } ], "reference": [ { "type": "PubMed", "id": "14996095", "url": "https://glygen.org/publication/PubMed/14996095" } ] }, { "title": "Stat3 activation regulates the expression of matrix metalloproteinase-2 and tumor invasion and metastasis.", "journal": "Oncogene", "date": "2004", "authors": "Xie TX, Wei D, Liu M, Gao AC, Ali-Osman F, Sawaya R, Huang S", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "15116091", "url": "https://glygen.org/publication/PubMed/15116091" } ] }, { "title": "STAT-1 is activated by IL-4 and IL-13 in multiple cell types.", "journal": "Molecular immunology", "date": "2004", "authors": "Wang IM, Lin H, Goldman SJ, Kobayashi M", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "15261459", "url": "https://glygen.org/publication/PubMed/15261459" } ] }, { "title": "Identification of proteins in activated human neutrophils susceptible to tyrosyl radical attack. A proteomic study using a tyrosylating fluorophore.", "journal": "Proteomics", "date": "2004", "authors": "Avram D, Romijn EP, Pap EH, Heck AJ, Wirtz KW", "evidence": [ { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" } ], "reference": [ { "type": "PubMed", "id": "15274135", "url": "https://glygen.org/publication/PubMed/15274135" } ] }, { "title": "Phosphoproteomic analysis of the developing mouse brain.", "journal": "Molecular & cellular proteomics : MCP", "date": "2004", "authors": "Ballif BA, Villen J, Beausoleil SA, Schwartz D, Gygi SP", "evidence": [ { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" } ], "reference": [ { "type": "PubMed", "id": "15345747", "url": "https://glygen.org/publication/PubMed/15345747" } ] }, { "title": "STAT6 transcription factor binding sites with mismatches within the canonical 5'-TTC...GAA-3' motif involved in regulation of delta- and mu-opioid receptors.", "journal": "Journal of neurochemistry", "date": "2004", "authors": "Borner C, Woltje M, Hollt V, Kraus J", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "15584925", "url": "https://glygen.org/publication/PubMed/15584925" } ] }, { "title": "Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.", "journal": "Nature biotechnology", "date": "2005", "authors": "Rush J, Moritz A, Lee KA, Guo A, Goss VL, Spek EJ, Zhang H, Zha XM, Polakiewicz RD, Comb MJ", "evidence": [ { "database": "UniProtKB", "id": "P08670", "url": "https://www.uniprot.org/uniprot/P08670" }, { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" } ], "reference": [ { "type": "PubMed", "id": "15592455", "url": "https://glygen.org/publication/PubMed/15592455" } ] }, { "title": "Aurora-B dysfunction of multinucleated giant cells in glioma detected by site-specific phosphorylated antibodies.", "journal": "Journal of neurosurgery", "date": "2004", "authors": "Fujita M, Mizuno M, Nagasaka T, Wakabayashi T, Maeda K, Ishii D, Arima T, Kawajiri A, Inagaki M, Yoshida J", "evidence": [ { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" } ], "reference": [ { "type": "PubMed", "id": "15597762", "url": "https://glygen.org/publication/PubMed/15597762" } ] }, { "title": "Aurora-B and Rho-kinase/ROCK, the two cleavage furrow kinases, independently regulate the progression of cytokinesis: possible existence of a novel cleavage furrow kinase phosphorylates ezrin/radixin/moesin (ERM).", "journal": "Genes to cells : devoted to molecular & cellular mechanisms", "date": "2005", "authors": "Yokoyama T, Goto H, Izawa I, Mizutani H, Inagaki M", "evidence": [ { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" } ], "reference": [ { "type": "PubMed", "id": "15676024", "url": "https://glygen.org/publication/PubMed/15676024" } ] }, { "title": "The intermediate filament protein vimentin is a new target for epigallocatechin gallate.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Ermakova S, Choi BY, Choi HS, Kang BS, Bode AM, Dong Z", "evidence": [ { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" } ], "reference": [ { "type": "PubMed", "id": "15713670", "url": "https://glygen.org/publication/PubMed/15713670" } ] }, { "title": "Silencing of p21-activated kinase attenuates vimentin phosphorylation on Ser-56 and reorientation of the vimentin network during stimulation of smooth muscle cells by 5-hydroxytryptamine.", "journal": "The Biochemical journal", "date": "2005", "authors": "Tang DD, Bai Y, Gunst SJ", "evidence": [ { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" } ], "reference": [ { "type": "PubMed", "id": "15766329", "url": "https://glygen.org/publication/PubMed/15766329" } ] }, { "title": "Aberrant Stat3 signaling by interleukin-4 in malignant glioma cells: involvement of IL-13Ralpha2.", "journal": "Cancer research", "date": "2005", "authors": "Rahaman SO, Vogelbaum MA, Haque SJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "15805299", "url": "https://glygen.org/publication/PubMed/15805299" } ] }, { "title": "Proteomic profiling of cellular proteins interacting with the hepatitis C virus core protein.", "journal": "Proteomics", "date": "2005", "authors": "Kang Su-Min, Shin Min-Jung, Kim Jung-Hee, Oh Jong-Won", "evidence": [ { "database": "UniProtKB", "id": "P08670", "url": "https://www.uniprot.org/uniprot/P08670" } ], "reference": [ { "type": "PubMed", "id": "15846844", "url": "https://glygen.org/publication/PubMed/15846844" } ] }, { "title": "Gene expression alterations of human peripheral blood monocytes induced by medium-term treatment with the TH2-cytokines interleukin-4 and -13.", "journal": "Cytokine", "date": "2005", "authors": "Chaitidis P, O'Donnell V, Kuban RJ, Bermudez-Fajardo A, Ungethuem U, Kuhn H", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "15869882", "url": "https://glygen.org/publication/PubMed/15869882" } ] }, { "title": "Nuclear interaction of EGFR and STAT3 in the activation of the iNOS/NO pathway.", "journal": "Cancer cell", "date": "2005", "authors": "Lo HW, Hsu SC, Ali-Seyed M, Gunduz M, Xia W, Wei Y, Bartholomeusz G, Shih JY, Hung MC", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "15950906", "url": "https://glygen.org/publication/PubMed/15950906" } ] }, { "title": "Targeting Stat3 blocks both HIF-1 and VEGF expression induced by multiple oncogenic growth signaling pathways.", "journal": "Oncogene", "date": "2005", "authors": "Xu Q, Briggs J, Park S, Niu G, Kortylewski M, Zhang S, Gritsko T, Turkson J, Kay H, Semenza GL, Cheng JQ, Jove R, Yu H", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "16007214", "url": "https://glygen.org/publication/PubMed/16007214" } ] }, { "title": "STAT3-mediated transcription of Bcl-2, Mcl-1 and c-IAP2 prevents apoptosis in polyamine-depleted cells.", "journal": "The Biochemical journal", "date": "2005", "authors": "Bhattacharya S, Ray RM, Johnson LR", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "16048438", "url": "https://glygen.org/publication/PubMed/16048438" } ] }, { "title": "Role of Stat3 in regulating p53 expression and function.", "journal": "Molecular and cellular biology", "date": "2005", "authors": "Niu G, Wright KL, Ma Y, Wright GM, Huang M, Irby R, Briggs J, Karras J, Cress WD, Pardoll D, Jove R, Chen J, Yu H", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "16107692", "url": "https://glygen.org/publication/PubMed/16107692" } ] }, { "title": "Vimentin rearrangement during African swine fever virus infection involves retrograde transport along microtubules and phosphorylation of vimentin by calcium calmodulin kinase II.", "journal": "Journal of virology", "date": "2005", "authors": "Stefanovic S, Windsor M, Nagata KI, Inagaki M, Wileman T", "evidence": [ { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" } ], "reference": [ { "type": "PubMed", "id": "16140754", "url": "https://glygen.org/publication/PubMed/16140754" } ] }, { "title": "Requirement of STAT3 activation for maximal collagenase-1 (MMP-1) induction by epidermal growth factor and malignant characteristics in T24 bladder cancer cells.", "journal": "Oncogene", "date": "2006", "authors": "Itoh M, Murata T, Suzuki T, Shindoh M, Nakajima K, Imai K, Yoshida K", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "16205632", "url": "https://glygen.org/publication/PubMed/16205632" } ] }, { "title": "Essential role of STAT3 in cytokine-driven NF-kappaB-mediated serum amyloid A gene expression.", "journal": "Genes to cells : devoted to molecular & cellular mechanisms", "date": "2005", "authors": "Hagihara K, Nishikawa T, Sugamata Y, Song J, Isobe T, Taga T, Yoshizaki K", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "16236134", "url": "https://glygen.org/publication/PubMed/16236134" } ] }, { "title": "Phosphorylation by Cdk1 induces Plk1-mediated vimentin phosphorylation during mitosis.", "journal": "The Journal of cell biology", "date": "2005", "authors": "Yamaguchi T, Goto H, Yokoyama T, Sillje H, Hanisch A, Uldschmid A, Takai Y, Oguri T, Nigg EA, Inagaki M", "evidence": [ { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" } ], "reference": [ { "type": "PubMed", "id": "16260496", "url": "https://glygen.org/publication/PubMed/16260496" } ] }, { "title": "PKCepsilon-mediated phosphorylation of vimentin controls integrin recycling and motility.", "journal": "The EMBO journal", "date": "2005", "authors": "Ivaska J, Vuoriluoto K, Huovinen T, Izawa I, Inagaki M, Parker PJ", "evidence": [ { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" } ], "reference": [ { "type": "PubMed", "id": "16270034", "url": "https://glygen.org/publication/PubMed/16270034" } ] }, { "title": "Dystonia-causing mutant torsinA inhibits cell adhesion and neurite extension through interference with cytoskeletal dynamics.", "journal": "Neurobiol. Dis.", "date": "2006", "authors": "Hewett JW, Zeng J, Niland BP, Bragg DC, Breakefield XO", "evidence": [ { "database": "UniProtKB", "id": "P08670", "url": "https://www.uniprot.org/uniprot/P08670" } ], "reference": [ { "type": "PubMed", "id": "16361107", "url": "https://glygen.org/publication/PubMed/16361107" } ] }, { "title": "Persistent activation of stat3 signaling induces survivin gene expression and confers resistance to apoptosis in human breast cancer cells.", "journal": "Clinical cancer research : an official journal of the American Association for Cancer Research", "date": "2006", "authors": "Gritsko T, Williams A, Turkson J, Kaneko S, Bowman T, Huang M, Nam S, Eweis I, Diaz N, Sullivan D, Yoder S, Enkemann S, Eschrich S, Lee JH, Beam CA, Cheng J, Minton S, Muro-Cacho CA, Jove R", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "16397018", "url": "https://glygen.org/publication/PubMed/16397018" } ] }, { "title": "SOCS1: a potent and multifaceted regulator of cytokines and cell-mediated inflammation.", "journal": "Tissue antigens", "date": "2006", "authors": "Davey GM, Heath WR, Starr R", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "16451196", "url": "https://glygen.org/publication/PubMed/16451196" } ] }, { "title": "A common phosphotyrosine signature for the Bcr-Abl kinase.", "journal": "Blood", "date": "2006", "authors": "Goss VL, Lee KA, Moritz A, Nardone J, Spek EJ, MacNeill J, Rush J, Comb MJ, Polakiewicz RD", "evidence": [ { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" } ], "reference": [ { "type": "PubMed", "id": "16497976", "url": "https://glygen.org/publication/PubMed/16497976" } ] }, { "title": "Cyclin D1 is transcriptionally regulated by and required for transformation by activated signal transducer and activator of transcription 3.", "journal": "Cancer research", "date": "2006", "authors": "Leslie K, Lang C, Devgan G, Azare J, Berishaj M, Gerald W, Kim YB, Paz K, Darnell JE, Albanese C, Sakamaki T, Pestell R, Bromberg J", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "16510571", "url": "https://glygen.org/publication/PubMed/16510571" } ] }, { "title": "Signaling mechanisms, interaction partners, and target genes of STAT6.", "journal": "Cytokine & growth factor reviews", "date": "2006", "authors": "Hebenstreit D, Wirnsberger G, Horejs-Hoeck J, Duschl A", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "16540365", "url": "https://glygen.org/publication/PubMed/16540365" } ] }, { "title": "Phosphoproteome analysis of the human mitotic spindle.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2006", "authors": "Nousiainen M, Sillje HH, Sauer G, Nigg EA, Korner R", "evidence": [ { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" } ], "reference": [ { "type": "PubMed", "id": "16565220", "url": "https://glygen.org/publication/PubMed/16565220" } ] }, { "title": "Loss of SOCS3 in T helper cells resulted in reduced immune responses and hyperproduction of interleukin 10 and transforming growth factor-beta 1.", "journal": "The Journal of experimental medicine", "date": "2006", "authors": "Kinjyo I, Inoue H, Hamano S, Fukuyama S, Yoshimura T, Koga K, Takaki H, Himeno K, Takaesu G, Kobayashi T, Yoshimura A", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "16606674", "url": "https://glygen.org/publication/PubMed/16606674" } ] }, { "title": "Interactions between epiplakin and intermediate filaments.", "journal": "J. Dermatol.", "date": "2006", "authors": "Wang Wenqing, Sumiyoshi Hideaki, Yoshioka Hidekatsu, Fujiwara Sakuhei", "evidence": [ { "database": "UniProtKB", "id": "P08670", "url": "https://www.uniprot.org/uniprot/P08670" } ], "reference": [ { "type": "PubMed", "id": "16923132", "url": "https://glygen.org/publication/PubMed/16923132" } ] }, { "title": "A probability-based approach for high-throughput protein phosphorylation analysis and site localization.", "journal": "Nature biotechnology", "date": "2006", "authors": "Beausoleil SA, Villen J, Gerber SA, Rush J, Gygi SP", "evidence": [ { "database": "UniProtKB", "id": "P08670", "url": "https://www.uniprot.org/uniprot/P08670" }, { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" } ], "reference": [ { "type": "PubMed", "id": "16964243", "url": "https://glygen.org/publication/PubMed/16964243" } ] }, { "title": "Critical role of vimentin phosphorylation at Ser-56 by p21-activated kinase in vimentin cytoskeleton signaling.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Li QF, Spinelli AM, Wang R, Anfinogenova Y, Singer HA, Tang DD", "evidence": [ { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" } ], "reference": [ { "type": "PubMed", "id": "16990256", "url": "https://glygen.org/publication/PubMed/16990256" } ] }, { "title": "Dissociation of Crk-associated substrate from the vimentin network is regulated by p21-activated kinase on ACh activation of airway smooth muscle.", "journal": "American journal of physiology. Lung cellular and molecular physiology", "date": "2007", "authors": "Wang R, Li QF, Anfinogenova Y, Tang DD", "evidence": [ { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" } ], "reference": [ { "type": "PubMed", "id": "16997882", "url": "https://glygen.org/publication/PubMed/16997882" } ] }, { "title": "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.", "journal": "Cell", "date": "2006", "authors": "Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M", "evidence": [ { "database": "UniProtKB", "id": "P08670", "url": "https://www.uniprot.org/uniprot/P08670" }, { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" } ], "reference": [ { "type": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" } ] }, { "title": "Global proteomic profiling of phosphopeptides using electron transfer dissociation tandem mass spectrometry.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2007", "authors": "Molina H, Horn DM, Tang N, Mathivanan S, Pandey A", "evidence": [ { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" } ], "reference": [ { "type": "PubMed", "id": "17287340", "url": "https://glygen.org/publication/PubMed/17287340" } ] }, { "title": "Phosphopeptide enrichment by aliphatic hydroxy acid-modified metal oxide chromatography for nano-LC-MS/MS in proteomics applications.", "journal": "Molecular & cellular proteomics : MCP", "date": "2007", "authors": "Sugiyama N, Masuda T, Shinoda K, Nakamura A, Tomita M, Ishihama Y", "evidence": [ { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" } ], "reference": [ { "type": "PubMed", "id": "17322306", "url": "https://glygen.org/publication/PubMed/17322306" } ] }, { "title": "Diverse effects of Stat1 on the regulation of hsp90alpha gene under heat shock.", "journal": "Journal of cellular biochemistry", "date": "2007", "authors": "Chen XS, Zhang Y, Wang JS, Li XY, Cheng XK, Zhang Y, Wu NH, Shen YF", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "17427945", "url": "https://glygen.org/publication/PubMed/17427945" } ] }, { "title": "IL-13 induces expression of CD36 in human monocytes through PPARgamma activation.", "journal": "European journal of immunology", "date": "2007", "authors": "Berry A, Balard P, Coste A, Olagnier D, Lagane C, Authier H, Benoit-Vical F, Lepert JC, Seguela JP, Magnaval JF, Chambon P, Metzger D, Desvergne B, Wahli W, Auwerx J, Pipy B", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "17458857", "url": "https://glygen.org/publication/PubMed/17458857" } ] }, { "title": "Estrogen induces expression of BCAS3, a novel estrogen receptor-alpha coactivator, through proline-, glutamic acid-, and leucine-rich protein-1 (PELP1).", "journal": "Mol. Endocrinol.", "date": "2007", "authors": "Gururaj AE, Peng S, Vadlamudi RK, Kumar R", "evidence": [ { "database": "UniProtKB", "id": "P08670", "url": "https://www.uniprot.org/uniprot/P08670" } ], "reference": [ { "type": "PubMed", "id": "17505058", "url": "https://glygen.org/publication/PubMed/17505058" } ] }, { "title": "Dynamic interplay between O-linked N-acetylglucosaminylation and glycogen synthase kinase-3-dependent phosphorylation.", "journal": "Molecular & cellular proteomics : MCP", "date": "2007", "authors": "Wang Z, Pandey A, Hart GW", "evidence": [ { "database": "O-GlcNAc Atlas", "id": "P08670", "url": "https://oglcnac.org/atlas/detail/P08670" } ], "reference": [ { "type": "PubMed", "id": "17507370", "url": "https://glygen.org/publication/PubMed/17507370" } ] }, { "title": "Fra-1 and Stat3 synergistically regulate activation of human MMP-9 gene.", "journal": "Molecular immunology", "date": "2008", "authors": "Song Y, Qian L, Song S, Chen L, Zhang Y, Yuan G, Zhang H, Xia Q, Hu M, Yu M, Shi M, Jiang Z, Guo N", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "17572495", "url": "https://glygen.org/publication/PubMed/17572495" } ] }, { "title": "HDAC6 controls major cell response pathways to cytotoxic accumulation of protein aggregates.", "journal": "Genes & development", "date": "2007", "authors": "Boyault C, Zhang Y, Fritah S, Caron C, Gilquin B, Kwon SH, Garrido C, Yao TP, Vourc'h C, Matthias P, Khochbin S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9646399", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9646399" } ], "reference": [ { "type": "PubMed", "id": "17785525", "url": "https://glygen.org/publication/PubMed/17785525" } ] }, { "title": "Parkin-mediated K63-linked polyubiquitination targets misfolded DJ-1 to aggresomes via binding to HDAC6.", "journal": "The Journal of cell biology", "date": "2007", "authors": "Olzmann JA, Li L, Chudaev MV, Chen J, Perez FA, Palmiter RD, Chin LS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9646399", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9646399" } ], "reference": [ { "type": "PubMed", "id": "17846173", "url": "https://glygen.org/publication/PubMed/17846173" } ] }, { "title": "Improved titanium dioxide enrichment of phosphopeptides from HeLa cells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra.", "journal": "Journal of proteome research", "date": "2007", "authors": "Yu LR, Zhu Z, Chan KC, Issaq HJ, Dimitrov DS, Veenstra TD", "evidence": [ { "database": "UniProtKB", "id": "P08670", "url": "https://www.uniprot.org/uniprot/P08670" }, { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" } ], "reference": [ { "type": "PubMed", "id": "17924679", "url": "https://glygen.org/publication/PubMed/17924679" } ] }, { "title": "Polo-like kinase 1 is involved in invasion through extracellular matrix.", "journal": "Cancer research", "date": "2007", "authors": "Rizki A, Mott JD, Bissell MJ", "evidence": [ { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" } ], "reference": [ { "type": "PubMed", "id": "18056432", "url": "https://glygen.org/publication/PubMed/18056432" } ] }, { "title": "Global survey of phosphotyrosine signaling identifies oncogenic kinases in lung cancer.", "journal": "Cell", "date": "2007", "authors": "Rikova K, Guo A, Zeng Q, Possemato A, Yu J, Haack H, Nardone J, Lee K, Reeves C, Li Y, Hu Y, Tan Z, Stokes M, Sullivan L, Mitchell J, Wetzel R, Macneill J, Ren JM, Yuan J, Bakalarski CE, Villen J, Kornhauser JM, Smith B, Li D, Zhou X, Gygi SP, Gu TL, Polakiewicz RD, Rush J, Comb MJ", "evidence": [ { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" } ], "reference": [ { "type": "PubMed", "id": "18083107", "url": "https://glygen.org/publication/PubMed/18083107" } ] }, { "title": "Hydrophilic interaction chromatography reduces the complexity of the phosphoproteome and improves global phosphopeptide isolation and detection.", "journal": "Molecular & cellular proteomics : MCP", "date": "2008", "authors": "McNulty DE, Annan RS", "evidence": [ { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" } ], "reference": [ { "type": "PubMed", "id": "18212344", "url": "https://glygen.org/publication/PubMed/18212344" } ] }, { "title": "Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.", "journal": "J. Proteome Res.", "date": "2008", "authors": "Cantin GT, Yi W, Lu B, Park SK, Xu T, Lee JD, Yates JR 3rd", "evidence": [ { "database": "UniProtKB", "id": "B0YJC4", "url": "https://www.uniprot.org/uniprot/B0YJC4" }, { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" } ], "reference": [ { "type": "PubMed", "id": "18220336", "url": "https://glygen.org/publication/PubMed/18220336" } ] }, { "title": "Molecular and structural basis of cytokine receptor pleiotropy in the interleukin-4/13 system.", "journal": "Cell", "date": "2008", "authors": "LaPorte SL, Juo ZS, Vaclavikova J, Colf LA, Qi X, Heller NM, Keegan AD, Garcia KC", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "18243101", "url": "https://glygen.org/publication/PubMed/18243101" } ] }, { "title": "Twist is transcriptionally induced by activation of STAT3 and mediates STAT3 oncogenic function.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Cheng GZ, Zhang WZ, Sun M, Wang Q, Coppola D, Mansour M, Xu LM, Costanzo C, Cheng JQ, Wang LH", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "18353781", "url": "https://glygen.org/publication/PubMed/18353781" } ] }, { "title": "Protein kinase Cepsilon binds peripherin and induces its aggregation, which is accompanied by apoptosis of neuroblastoma cells.", "journal": "J. Biol. Chem.", "date": "2008", "authors": "Sunesson Lovisa, Hellman Ulf, Larsson Christer", "evidence": [ { "database": "UniProtKB", "id": "P08670", "url": "https://www.uniprot.org/uniprot/P08670" } ], "reference": [ { "type": "PubMed", "id": "18408015", "url": "https://glygen.org/publication/PubMed/18408015" } ] }, { "title": "Regulation of Sox2 by STAT3 initiates commitment to the neural precursor cell fate.", "journal": "Stem cells and development", "date": "2008", "authors": "Foshay KM, Gallicano GI", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "18447642", "url": "https://glygen.org/publication/PubMed/18447642" } ] }, { "title": "Motif-specific sampling of phosphoproteomes.", "journal": "Journal of proteome research", "date": "2008", "authors": "Ruse CI, McClatchy DB, Lu B, Cociorva D, Motoyama A, Park SK, Yates JR 3rd", "evidence": [ { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" } ], "reference": [ { "type": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" } ] }, { "title": "Phosphoproteome analysis of the human Chang liver cells using SCX and a complementary mass spectrometric strategy.", "journal": "Proteomics", "date": "2008", "authors": "Sui S, Wang J, Yang B, Song L, Zhang J, Chen M, Liu J, Lu Z, Cai Y, Chen S, Bi W, Zhu Y, He F, Qian X", "evidence": [ { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" } ], "reference": [ { "type": "PubMed", "id": "18491316", "url": "https://glygen.org/publication/PubMed/18491316" } ] }, { "title": "TiO(2)-based phosphoproteomic analysis of the plasma membrane and the effects of phosphatase inhibitor treatment.", "journal": "Journal of proteome research", "date": "2008", "authors": "Thingholm TE, Larsen MR, Ingrell CR, Kassem M, Jensen ON", "evidence": [ { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" } ], "reference": [ { "type": "PubMed", "id": "18578522", "url": "https://glygen.org/publication/PubMed/18578522" } ] }, { "title": "The chaperone-mediated autophagy receptor organizes in dynamic protein complexes at the lysosomal membrane.", "journal": "Molecular and cellular biology", "date": "2008", "authors": "Bandyopadhyay U, Kaushik S, Varticovski L, Cuervo AM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9613829", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9613829" } ], "reference": [ { "type": "PubMed", "id": "18644871", "url": "https://glygen.org/publication/PubMed/18644871" } ] }, { "title": "Signal transducer and activator of transcription 3 is required for hypoxia-inducible factor-1alpha RNA expression in both tumor cells and tumor-associated myeloid cells.", "journal": "Molecular cancer research : MCR", "date": "2008", "authors": "Niu G, Briggs J, Deng J, Ma Y, Lee H, Kortylewski M, Kujawski M, Kay H, Cress WD, Jove R, Yu H", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "18644974", "url": "https://glygen.org/publication/PubMed/18644974" } ] }, { "title": "A mitotic GlcNAcylation/phosphorylation signaling complex alters the posttranslational state of the cytoskeletal protein vimentin.", "journal": "Molecular biology of the cell", "date": "2008", "authors": "Slawson C, Lakshmanan T, Knapp S, Hart GW", "evidence": [ { "database": "O-GlcNAc Database", "id": "P08670", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08670" } ], "reference": [ { "type": "PubMed", "id": "18653473", "url": "https://glygen.org/publication/PubMed/18653473" } ] }, { "title": "A quantitative atlas of mitotic phosphorylation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2008", "authors": "Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP", "evidence": [ { "database": "UniProtKB", "id": "P08670", "url": "https://www.uniprot.org/uniprot/P08670" }, { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" } ], "reference": [ { "type": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" } ] }, { "title": "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.", "journal": "Molecular cell", "date": "2008", "authors": "Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M", "evidence": [ { "database": "UniProtKB", "id": "P08670", "url": "https://www.uniprot.org/uniprot/P08670" }, { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" } ], "reference": [ { "type": "PubMed", "id": "18691976", "url": "https://glygen.org/publication/PubMed/18691976" } ] }, { "title": "Immobilized metal affinity chromatography revisited: pH/acid control toward high selectivity in phosphoproteomics.", "journal": "Journal of proteome research", "date": "2008", "authors": "Tsai CF, Wang YT, Chen YR, Lai CY, Lin PY, Pan KT, Chen JY, Khoo KH, Chen YJ", "evidence": [ { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" } ], "reference": [ { "type": "PubMed", "id": "18707149", "url": "https://glygen.org/publication/PubMed/18707149" } ] }, { "title": "Successive and selective release of phosphorylated peptides captured by hydroxy acid-modified metal oxide chromatography.", "journal": "Journal of proteome research", "date": "2008", "authors": "Kyono Y, Sugiyama N, Imami K, Tomita M, Ishihama Y", "evidence": [ { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" } ], "reference": [ { "type": "PubMed", "id": "18767875", "url": "https://glygen.org/publication/PubMed/18767875" } ] }, { "title": "The Serine/threonine kinase Stk33 exhibits autophosphorylation and phosphorylates the intermediate filament protein Vimentin.", "journal": "BMC biochemistry", "date": "2008", "authors": "Brauksiepe B, Mujica AO, Herrmann H, Schmidt ER", "evidence": [ { "database": "UniProtKB", "id": "P08670", "url": "https://www.uniprot.org/uniprot/P08670" } ], "reference": [ { "type": "PubMed", "id": "18811945", "url": "https://glygen.org/publication/PubMed/18811945" } ] }, { "title": "TorsinA binds the KASH domain of nesprins and participates in linkage between nuclear envelope and cytoskeleton.", "journal": "J. Cell Sci.", "date": "2008", "authors": "Nery FC, Zeng J, Niland BP, Hewett J, Farley J, Irimia D, Li Y, Wiche G, Sonnenberg A, Breakefield XO", "evidence": [ { "database": "UniProtKB", "id": "P08670", "url": "https://www.uniprot.org/uniprot/P08670" } ], "reference": [ { "type": "PubMed", "id": "18827015", "url": "https://glygen.org/publication/PubMed/18827015" } ] }, { "title": "Characterization of RhoBTB-dependent Cul3 ubiquitin ligase complexes--evidence for an autoregulatory mechanism.", "journal": "Experimental cell research", "date": "2008", "authors": "Berthold J, Schenkova K, Ramos S, Miura Y, Furukawa M, Aspenstrom P, Rivero F", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013422", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013422" } ], "reference": [ { "type": "PubMed", "id": "18835386", "url": "https://glygen.org/publication/PubMed/18835386" } ] }, { "title": "Evaluation of the low-specificity protease elastase for large-scale phosphoproteome analysis.", "journal": "Analytical chemistry", "date": "2008", "authors": "Wang B, Malik R, Nigg EA, Korner R", "evidence": [ { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" } ], "reference": [ { "type": "PubMed", "id": "19007248", "url": "https://glygen.org/publication/PubMed/19007248" } ] }, { "title": "Mechanism of interferon-gamma mediated down-regulation of interleukin-10 gene expression.", "journal": "Molecular immunology", "date": "2009", "authors": "Schaefer A, Unterberger C, Frankenberger M, Lohrum M, Staples KJ, Werner T, Stunnenberg H, Ziegler-Heitbrock L", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "19124156", "url": "https://glygen.org/publication/PubMed/19124156" } ] }, { "title": "Dominant cataract formation in association with a vimentin assembly disrupting mutation.", "journal": "Human molecular genetics", "date": "2009", "authors": "Muller M, Bhattacharya SS, Moore T, Prescott Q, Wedig T, Herrmann H, Magin TM", "evidence": [ { "database": "UniProtKB", "id": "P08670", "url": "https://www.uniprot.org/uniprot/P08670" } ], "reference": [ { "type": "PubMed", "id": "19126778", "url": "https://glygen.org/publication/PubMed/19126778" } ] }, { "title": "Regulation of the IL-23 and IL-12 balance by Stat3 signaling in the tumor microenvironment.", "journal": "Cancer cell", "date": "2009", "authors": "Kortylewski M, Xin H, Kujawski M, Lee H, Liu Y, Harris T, Drake C, Pardoll D, Yu H", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "19185846", "url": "https://glygen.org/publication/PubMed/19185846" } ] }, { "title": "The cellular distribution of serotonin transporter is impeded on serotonin-altered vimentin network.", "journal": "PLoS ONE", "date": "2009", "authors": "Ahmed BA, Bukhari IA, Jeffus BC, Harney JT, Thyparambil S, Ziu E, Fraer M, Rusch NJ, Zimniak P, Lupashin V, Tang D, Kilic F", "evidence": [ { "database": "UniProtKB", "id": "P08670", "url": "https://www.uniprot.org/uniprot/P08670" }, { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" } ], "reference": [ { "type": "PubMed", "id": "19270731", "url": "https://glygen.org/publication/PubMed/19270731" } ] }, { "title": "The RhoU/Wrch1 Rho GTPase gene is a common transcriptional target of both the gp130/STAT3 and Wnt-1 pathways.", "journal": "The Biochemical journal", "date": "2009", "authors": "Schiavone D, Dewilde S, Vallania F, Turkson J, Di Cunto F, Poli V", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "19397496", "url": "https://glygen.org/publication/PubMed/19397496" } ] }, { "title": "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.", "journal": "Analytical chemistry", "date": "2009", "authors": "Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S", "evidence": [ { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" } ], "reference": [ { "type": "PubMed", "id": "19413330", "url": "https://glygen.org/publication/PubMed/19413330" } ] }, { "title": "Phosphoproteomic analysis of distinct tumor cell lines in response to nocodazole treatment.", "journal": "Proteomics", "date": "2009", "authors": "Nagano K, Shinkawa T, Mutoh H, Kondoh O, Morimoto S, Inomata N, Ashihara M, Ishii N, Aoki Y, Haramura M", "evidence": [ { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" } ], "reference": [ { "type": "PubMed", "id": "19415658", "url": "https://glygen.org/publication/PubMed/19415658" } ] }, { "title": "Cdc42GAP, reactive oxygen species, and the vimentin network.", "journal": "American journal of physiology. Cell physiology", "date": "2009", "authors": "Li QF, Spinelli AM, Tang DD", "evidence": [ { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" } ], "reference": [ { "type": "PubMed", "id": "19494238", "url": "https://glygen.org/publication/PubMed/19494238" } ] }, { "title": "Structural changes in intermediate filament networks alter the activity of insulin-degrading enzyme.", "journal": "FASEB journal : official publication of the Federation of American Societies for Experimental Biology", "date": "2009", "authors": "Chou YH, Kuo WL, Rosner MR, Tang WJ, Goldman RD", "evidence": [ { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" } ], "reference": [ { "type": "PubMed", "id": "19584300", "url": "https://glygen.org/publication/PubMed/19584300" } ] }, { "title": "Lysine acetylation targets protein complexes and co-regulates major cellular functions.", "journal": "Science (New York, N.Y.)", "date": "2009", "authors": "Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M", "evidence": [ { "database": "UniProtKB", "id": "P08670", "url": "https://www.uniprot.org/uniprot/P08670" } ], "reference": [ { "type": "PubMed", "id": "19608861", "url": "https://glygen.org/publication/PubMed/19608861" } ] }, { "title": "Global effects of kinase inhibitors on signaling networks revealed by quantitative phosphoproteomics.", "journal": "Molecular & cellular proteomics : MCP", "date": "2009", "authors": "Pan C, Olsen JV, Daub H, Mann M", "evidence": [ { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" } ], "reference": [ { "type": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" } ] }, { "title": "Phosphorylation dynamics during early differentiation of human embryonic stem cells.", "journal": "Cell stem cell", "date": "2009", "authors": "Van Hoof D, Munoz J, Braam SR, Pinkse MW, Linding R, Heck AJ, Mummery CL, Krijgsveld J", "evidence": [ { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" } ], "reference": [ { "type": "PubMed", "id": "19664995", "url": "https://glygen.org/publication/PubMed/19664995" } ] }, { "title": "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.", "journal": "Science signaling", "date": "2009", "authors": "Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK", "evidence": [ { "database": "UniProtKB", "id": "P08670", "url": "https://www.uniprot.org/uniprot/P08670" }, { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" } ], "reference": [ { "type": "PubMed", "id": "19690332", "url": "https://glygen.org/publication/PubMed/19690332" } ] }, { "title": "Quantitative analysis of the human spindle phosphoproteome at distinct mitotic stages.", "journal": "Journal of proteome research", "date": "2009", "authors": "Malik R, Lenobel R, Santamaria A, Ries A, Nigg EA, Korner R", "evidence": [ { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" } ], "reference": [ { "type": "PubMed", "id": "19691289", "url": "https://glygen.org/publication/PubMed/19691289" } ] }, { "title": "Role of p47(phox) in regulating Cdc42GAP, vimentin, and contraction in smooth muscle cells.", "journal": "American journal of physiology. Cell physiology", "date": "2009", "authors": "Li QF, Tang DD", "evidence": [ { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" } ], "reference": [ { "type": "PubMed", "id": "19812368", "url": "https://glygen.org/publication/PubMed/19812368" } ] }, { "title": "Multiple myeloma phosphotyrosine proteomic profile associated with FGFR3 expression, ligand activation, and drug inhibition.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2009", "authors": "St-Germain JR, Taylor P, Tong J, Jin LL, Nikolic A, Stewart II, Ewing RM, Dharsee M, Li Z, Trudel S, Moran MF", "evidence": [ { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" } ], "reference": [ { "type": "PubMed", "id": "19901323", "url": "https://glygen.org/publication/PubMed/19901323" } ] }, { "title": "Exploring the human leukocyte phosphoproteome using a microfluidic reversed-phase-TiO2-reversed-phase high-performance liquid chromatography phosphochip coupled to a quadrupole time-of-flight mass spectrometer.", "journal": "Analytical chemistry", "date": "2010", "authors": "Raijmakers R, Kraiczek K, de Jong AP, Mohammed S, Heck AJ", "evidence": [ { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" } ], "reference": [ { "type": "PubMed", "id": "20058876", "url": "https://glygen.org/publication/PubMed/20058876" } ] }, { "title": "Extensive crosstalk between O-GlcNAcylation and phosphorylation regulates cytokinesis.", "journal": "Science signaling", "date": "2010", "authors": "Wang Z, Udeshi ND, Slawson C, Compton PD, Sakabe K, Cheung WD, Shabanowitz J, Hunt DF, Hart GW", "evidence": [ { "database": "UniProtKB", "id": "P08670", "url": "https://www.uniprot.org/uniprot/P08670#ptm_processing" }, { "database": "UniProtKB", "id": "P08670", "url": "https://www.uniprot.org/uniprot/P08670" }, { "database": "O-GlcNAc Database", "id": "P08670", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08670" }, { "database": "O-GlcNAc Atlas", "id": "P08670", "url": "https://oglcnac.org/atlas/detail/P08670" }, { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" }, { "database": "GlyConnect", "id": "2867", "url": "https://glyconnect.expasy.org/browser/proteins/2867" } ], "reference": [ { "type": "PubMed", "id": "20068230", "url": "https://glygen.org/publication/PubMed/20068230" } ] }, { "title": "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.", "journal": "Science signaling", "date": "2010", "authors": "Olsen JV, Vermeulen M, Santamaria A, Kumar C, Miller ML, Jensen LJ, Gnad F, Cox J, Jensen TS, Nigg EA, Brunak S, Mann M", "evidence": [ { "database": "UniProtKB", "id": "P08670", "url": "https://www.uniprot.org/uniprot/P08670" }, { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" } ], "reference": [ { "type": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ] }, { "title": "Phosphoproteome analysis of human liver tissue by long-gradient nanoflow LC coupled with multiple stage MS analysis.", "journal": "Electrophoresis", "date": "2010", "authors": "Han G, Ye M, Liu H, Song C, Sun D, Wu Y, Jiang X, Chen R, Wang C, Wang L, Zou H", "evidence": [ { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" } ], "reference": [ { "type": "PubMed", "id": "20166139", "url": "https://glygen.org/publication/PubMed/20166139" } ] }, { "title": "Atomic structure of vimentin coil 2.", "journal": "J. Struct. Biol.", "date": "2010", "authors": "Nicolet Stefan, Herrmann Harald, Aebi Ueli, Strelkov Sergei V", "evidence": [ { "database": "UniProtKB", "id": "P08670", "url": "https://www.uniprot.org/uniprot/P08670" } ], "reference": [ { "type": "PubMed", "id": "20176112", "url": "https://glygen.org/publication/PubMed/20176112" } ] }, { "title": "Phosphoproteomic analysis of primary human multiple myeloma cells.", "journal": "Journal of proteomics", "date": "2010", "authors": "Ge F, Xiao CL, Yin XF, Lu CH, Zeng HL, He QY", "evidence": [ { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" } ], "reference": [ { "type": "PubMed", "id": "20230923", "url": "https://glygen.org/publication/PubMed/20230923" } ] }, { "title": "Glycopeptide-specific monoclonal antibodies suggest new roles for O-GlcNAc.", "journal": "Nature chemical biology", "date": "2010", "authors": "Teo CF, Ingale S, Wolfert MA, Elsayed GA, Not LG, Chatham JC, Wells L, Boons GJ", "evidence": [ { "database": "O-GlcNAc Database", "id": "P08670", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08670" } ], "reference": [ { "type": "PubMed", "id": "20305658", "url": "https://glygen.org/publication/PubMed/20305658" } ] }, { "title": "Diverse targets of the transcription factor STAT3 contribute to T cell pathogenicity and homeostasis.", "journal": "Immunity", "date": "2010", "authors": "Durant L, Watford WT, Ramos HL, Laurence A, Vahedi G, Wei L, Takahashi H, Sun HW, Kanno Y, Powrie F, O'Shea JJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "20493732", "url": "https://glygen.org/publication/PubMed/20493732" } ] }, { "title": "Identification of regulators of chaperone-mediated autophagy.", "journal": "Molecular cell", "date": "2010", "authors": "Bandyopadhyay U, Sridhar S, Kaushik S, Kiffin R, Cuervo AM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9613829", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9613829" } ], "reference": [ { "type": "PubMed", "id": "20797626", "url": "https://glygen.org/publication/PubMed/20797626" } ] }, { "title": "Vimentin is a novel AKT1 target mediating motility and invasion.", "journal": "Oncogene", "date": "2011", "authors": "Zhu QS, Rosenblatt K, Huang KL, Lahat G, Brobey R, Bolshakov S, Nguyen T, Ding Z, Belousov R, Bill K, Luo X, Lazar A, Dicker A, Mills GB, Hung MC, Lev D", "evidence": [ { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" } ], "reference": [ { "type": "PubMed", "id": "20856200", "url": "https://glygen.org/publication/PubMed/20856200" } ] }, { "title": "STAT3-induced S1PR1 expression is crucial for persistent STAT3 activation in tumors.", "journal": "Nature medicine", "date": "2010", "authors": "Lee H, Deng J, Kujawski M, Yang C, Liu Y, Herrmann A, Kortylewski M, Horne D, Somlo G, Forman S, Jove R, Yu H", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "21102457", "url": "https://glygen.org/publication/PubMed/21102457" } ] }, { "title": "Microautophagy of cytosolic proteins by late endosomes.", "journal": "Developmental cell", "date": "2011", "authors": "Sahu R, Kaushik S, Clement CC, Cannizzo ES, Scharf B, Follenzi A, Potolicchio I, Nieves E, Cuervo AM, Santambrogio L", "evidence": [ { "database": "Reactome", "id": "R-HSA-9615710", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9615710" } ], "reference": [ { "type": "PubMed", "id": "21238931", "url": "https://glygen.org/publication/PubMed/21238931" } ] }, { "title": "alphaMbeta(2) integrin activation prevents alternative activation of human and murine macrophages and impedes foam cell formation.", "journal": "Circulation research", "date": "2011", "authors": "Yakubenko VP, Bhattacharjee A, Pluskota E, Cathcart MK", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "21252155", "url": "https://glygen.org/publication/PubMed/21252155" } ] }, { "title": "Chaperone-mediated autophagy at a glance.", "journal": "Journal of cell science", "date": "2011", "authors": "Kaushik S, Bandyopadhyay U, Sridhar S, Kiffin R, Martinez-Vicente M, Kon M, Orenstein SJ, Wong E, Cuervo AM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9613829", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9613829" } ], "reference": [ { "type": "PubMed", "id": "21282471", "url": "https://glygen.org/publication/PubMed/21282471" } ] }, { "title": "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.", "journal": "Science signaling", "date": "2011", "authors": "Rigbolt KT, Prokhorova TA, Akimov V, Henningsen J, Johansen PT, Kratchmarova I, Kassem M, Mann M, Olsen JV, Blagoev B", "evidence": [ { "database": "UniProtKB", "id": "P08670", "url": "https://www.uniprot.org/uniprot/P08670" }, { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" } ], "reference": [ { "type": "PubMed", "id": "21406692", "url": "https://glygen.org/publication/PubMed/21406692" } ] }, { "title": "Cdk5 mediates vimentin Ser56 phosphorylation during GTP-induced secretion by neutrophils.", "journal": "Journal of cellular physiology", "date": "2012", "authors": "Lee KY, Liu L, Jin Y, Fu SB, Rosales JL", "evidence": [ { "database": "UniProtKB", "id": "P08670", "url": "https://www.uniprot.org/uniprot/P08670" }, { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" } ], "reference": [ { "type": "PubMed", "id": "21465480", "url": "https://glygen.org/publication/PubMed/21465480" } ] }, { "title": "TRIM8 regulates Nanog via Hsp90beta-mediated nuclear translocation of STAT3 in embryonic stem cells.", "journal": "Biochimica et biophysica acta", "date": "2011", "authors": "Okumura F, Okumura AJ, Matsumoto M, Nakayama KI, Hatakeyama S", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "21689689", "url": "https://glygen.org/publication/PubMed/21689689" } ] }, { "title": "STAT3 protein promotes T-cell survival and inhibits interleukin-2 production through up-regulation of Class O Forkhead transcription factors.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Oh HM, Yu CR, Golestaneh N, Amadi-Obi A, Lee YS, Eseonu A, Mahdi RM, Egwuagu CE", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "21730069", "url": "https://glygen.org/publication/PubMed/21730069" } ] }, { "title": "Combining high-energy C-trap dissociation and electron transfer dissociation for protein O-GlcNAc modification site assignment.", "journal": "Journal of proteome research", "date": "2011", "authors": "Zhao P, Viner R, Teo CF, Boons GJ, Horn D, Wells L", "evidence": [ { "database": "O-GlcNAc Database", "id": "P08670", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08670" } ], "reference": [ { "type": "PubMed", "id": "21740066", "url": "https://glygen.org/publication/PubMed/21740066" } ] }, { "title": "A novel role of vimentin filaments: binding and stabilization of collagen mRNAs.", "journal": "Molecular and cellular biology", "date": "2011", "authors": "Challa AA, Stefanovic B", "evidence": [ { "database": "UniProtKB", "id": "P08670", "url": "https://www.uniprot.org/uniprot/P08670" } ], "reference": [ { "type": "PubMed", "id": "21746880", "url": "https://glygen.org/publication/PubMed/21746880" } ] }, { "title": "Signal transducers and activators of transcription 3 (STAT3) directly regulates cytokine-induced fascin expression and is required for breast cancer cell migration.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Snyder M, Huang XY, Zhang JJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "21937440", "url": "https://glygen.org/publication/PubMed/21937440" } ] }, { "title": "FAK is required for the assembly of podosome rosettes.", "journal": "The Journal of cell biology", "date": "2011", "authors": "Pan YR, Chen CL, Chen HC", "evidence": [ { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" } ], "reference": [ { "type": "PubMed", "id": "21969470", "url": "https://glygen.org/publication/PubMed/21969470" } ] }, { "title": "Cytokine induction of tumor necrosis factor receptor 2 is mediated by STAT3 in colon cancer cells.", "journal": "Molecular cancer research : MCR", "date": "2011", "authors": "Hamilton KE, Simmons JG, Ding S, Van Landeghem L, Lund PK", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "21994466", "url": "https://glygen.org/publication/PubMed/21994466" } ] }, { "title": "Peptide sequences that target cytosolic proteins for lysosomal proteolysis.", "journal": "Trends in biochemical sciences", "date": "1990", "authors": "Dice JF", "evidence": [ { "database": "Reactome", "id": "R-HSA-9615710", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9615710" } ], "reference": [ { "type": "PubMed", "id": "2204156", "url": "https://glygen.org/publication/PubMed/2204156" } ] }, { "title": "Necdin, a negative growth regulator, is a novel STAT3 target gene down-regulated in human cancer.", "journal": "PloS one", "date": "2011", "authors": "Haviland R, Eschrich S, Bloom G, Ma Y, Minton S, Jove R, Cress WD", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "22046235", "url": "https://glygen.org/publication/PubMed/22046235" } ] }, { "title": "Stabilization of vimentin coil2 fragment via an engineered disulfide.", "journal": "J. Struct. Biol.", "date": "2012", "authors": "Chernyatina A A, Strelkov S V", "evidence": [ { "database": "UniProtKB", "id": "P08670", "url": "https://www.uniprot.org/uniprot/P08670" } ], "reference": [ { "type": "PubMed", "id": "22119849", "url": "https://glygen.org/publication/PubMed/22119849" } ] }, { "title": "GlcNAcylation of histone H2B facilitates its monoubiquitination.", "journal": "Nature", "date": "2011", "authors": "Fujiki R, Hashiba W, Sekine H, Yokoyama A, Chikanishi T, Ito S, Imai Y, Kim J, He HH, Igarashi K, Kanno J, Ohtake F, Kitagawa H, Roeder RG, Brown M, Kato S", "evidence": [ { "database": "O-GlcNAc Database", "id": "P08670", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08670" } ], "reference": [ { "type": "PubMed", "id": "22121020", "url": "https://glygen.org/publication/PubMed/22121020" } ] }, { "title": "Roles of STAT3 and ZEB1 proteins in E-cadherin down-regulation and human colorectal cancer epithelial-mesenchymal transition.", "journal": "The Journal of biological chemistry", "date": "2012", "authors": "Xiong H, Hong J, Du W, Lin YW, Ren LL, Wang YC, Su WY, Wang JL, Cui Y, Wang ZH, Fang JY", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "22205702", "url": "https://glygen.org/publication/PubMed/22205702" } ] }, { "title": "The Jak/STAT pathway.", "journal": "Cold Spring Harbor perspectives in biology", "date": "2012", "authors": "Harrison DA", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "22383755", "url": "https://glygen.org/publication/PubMed/22383755" } ] }, { "title": "Nucleotide sequence of cDNA covering the complete coding part of the human vimentin gene.", "journal": "Nucleic Acids Res.", "date": "1990", "authors": "Honore B, Madsen P, Basse B, Andersen A, Walbum E, Celis JE, Leffers H", "evidence": [ { "database": "UniProtKB", "id": "P08670", "url": "https://www.uniprot.org/uniprot/P08670" } ], "reference": [ { "type": "PubMed", "id": "2251132", "url": "https://glygen.org/publication/PubMed/2251132" } ] }, { "title": "STAT1 gene expression is enhanced by nuclear EGFR and HER2 via cooperation with STAT3.", "journal": "Molecular carcinogenesis", "date": "2013", "authors": "Han W, Carpenter RL, Cao X, Lo HW", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "22693070", "url": "https://glygen.org/publication/PubMed/22693070" } ] }, { "title": "Interleukin-10-induced neutrophil gelatinase-associated lipocalin production in macrophages with consequences for tumor growth.", "journal": "Molecular and cellular biology", "date": "2012", "authors": "Jung M, Weigert A, Tausendschon M, Mora J, Oren B, Sola A, Hotter G, Muta T, Brune B", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "22851691", "url": "https://glygen.org/publication/PubMed/22851691" } ] }, { "title": "Resveratrol-induced changes of the human adipocyte secretion profile.", "journal": "J. Proteome Res.", "date": "2012", "authors": "Rosenow Anja, Noben Jean-Paul, Jocken Johan, Kallendrusch Sonja, Fischer-Posovszky Pamela, Mariman Edwin C M, Renes Johan", "evidence": [ { "database": "UniProtKB", "id": "B0YJC4", "url": "https://www.uniprot.org/uniprot/B0YJC4" } ], "reference": [ { "type": "PubMed", "id": "22905912", "url": "https://glygen.org/publication/PubMed/22905912" } ] }, { "title": "STAT1 activation by venous malformations mutant Tie2-R849W antagonizes VEGF-A-mediated angiogenic response partly via reduced bFGF production.", "journal": "Angiogenesis", "date": "2013", "authors": "Huang YH, Wu MP, Pan SC, Su WC, Chen YW, Wu LW", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "23086340", "url": "https://glygen.org/publication/PubMed/23086340" } ] }, { "title": "IL-4 and IL-13 employ discrete signaling pathways for target gene expression in alternatively activated monocytes/macrophages.", "journal": "Free radical biology & medicine", "date": "2013", "authors": "Bhattacharjee A, Shukla M, Yakubenko VP, Mulya A, Kundu S, Cathcart MK", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "23124025", "url": "https://glygen.org/publication/PubMed/23124025" } ] }, { "title": "STAT3 is involved in esophageal carcinogenesis through regulation of Oct-1.", "journal": "Carcinogenesis", "date": "2013", "authors": "Wang Z, Zhu S, Shen M, Liu J, Wang M, Li C, Wang Y, Deng A, Mei Q", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "23172665", "url": "https://glygen.org/publication/PubMed/23172665" } ] }, { "title": "Toward a comprehensive characterization of a human cancer cell phosphoproteome.", "journal": "Journal of proteome research", "date": "2013", "authors": "Zhou H, Di Palma S, Preisinger C, Peng M, Polat AN, Heck AJ, Mohammed S", "evidence": [ { "database": "UniProtKB", "id": "P08670", "url": "https://www.uniprot.org/uniprot/P08670" }, { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" } ], "reference": [ { "type": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" } ] }, { "title": "Isolation of a human vimentin cDNA with a long 3'-noncoding region from a human osteosarcoma cell line (MG-63).", "journal": "Gene", "date": "1990", "authors": "Gupta AK, Aubin JE, Waye MM", "evidence": [ { "database": "UniProtKB", "id": "P08670", "url": "https://www.uniprot.org/uniprot/P08670" } ], "reference": [ { "type": "PubMed", "id": "2323579", "url": "https://glygen.org/publication/PubMed/2323579" } ] }, { "title": "Z-band alternatively spliced PDZ motif protein (ZASP) is the major O-linked beta-N-acetylglucosamine-substituted protein in human heart myofibrils.", "journal": "The Journal of biological chemistry", "date": "2013", "authors": "Leung MC, Hitchen PG, Ward DG, Messer AE, Marston SB", "evidence": [ { "database": "O-GlcNAc Database", "id": "P08670", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08670" } ], "reference": [ { "type": "PubMed", "id": "23271734", "url": "https://glygen.org/publication/PubMed/23271734" } ] }, { "title": "Proteome wide purification and identification of O-GlcNAc-modified proteins using click chemistry and mass spectrometry.", "journal": "Journal of proteome research", "date": "2013", "authors": "Hahne H, Sobotzki N, Nyberg T, Helm D, Borodkin VS, van Aalten DM, Agnew B, Kuster B", "evidence": [ { "database": "O-GlcNAc Database", "id": "P08670", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08670" }, { "database": "O-GlcNAc Atlas", "id": "P08670", "url": "https://oglcnac.org/atlas/detail/P08670" } ], "reference": [ { "type": "PubMed", "id": "23301498", "url": "https://glygen.org/publication/PubMed/23301498" } ] }, { "title": "cAMP-stimulated phosphorylation of diaphanous 1 regulates protein stability and interaction with binding partners in adrenocortical cells.", "journal": "Mol. Biol. Cell", "date": "2013", "authors": "Li D, Dammer EB, Lucki NC, Sewer MB", "evidence": [ { "database": "UniProtKB", "id": "P08670", "url": "https://www.uniprot.org/uniprot/P08670" } ], "reference": [ { "type": "PubMed", "id": "23325789", "url": "https://glygen.org/publication/PubMed/23325789" } ] }, { "title": "Mutant B-RAF-Mcl-1 survival signaling depends on the STAT3 transcription factor.", "journal": "Oncogene", "date": "2014", "authors": "Becker TM, Boyd SC, Mijatov B, Gowrishankar K, Snoyman S, Pupo GM, Scolyer RA, Mann GJ, Kefford RF, Zhang XD, Rizos H", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "23455323", "url": "https://glygen.org/publication/PubMed/23455323" } ] }, { "title": "Reduction of oxidative stress during recovery accelerates normalization of primary cilia length that is altered after ischemic injury in murine kidneys.", "journal": "American journal of physiology. Renal physiology", "date": "2013", "authors": "Kim JI, Kim J, Jang HS, Noh MR, Lipschutz JH, Park KM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9646399", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9646399" } ], "reference": [ { "type": "PubMed", "id": "23515720", "url": "https://glygen.org/publication/PubMed/23515720" } ] }, { "title": "Tissue inhibitor of metalloproteinase 1 is preferentially expressed in Th1 and Th17 T-helper cell subsets and is a direct STAT target gene.", "journal": "PloS one", "date": "2013", "authors": "Adamson A, Ghoreschi K, Rittler M, Chen Q, Sun HW, Vahedi G, Kanno Y, Stetler-Stevenson WG, O'Shea JJ, Laurence A", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "23555662", "url": "https://glygen.org/publication/PubMed/23555662" } ] }, { "title": "Proteomic analysis and abrogated expression of O-GlcNAcylated proteins associated with primary breast cancer.", "journal": "Proteomics", "date": "2013", "authors": "Champattanachai V, Netsirisawan P, Chaiyawat P, Phueaouan T, Charoenwattanasatien R, Chokchaichamnankit D, Punyarit P, Srisomsap C, Svasti J", "evidence": [ { "database": "O-GlcNAc Database", "id": "P08670", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08670" } ], "reference": [ { "type": "PubMed", "id": "23576270", "url": "https://glygen.org/publication/PubMed/23576270" } ] }, { "title": "STAT3 regulates MMP3 in heme-induced endothelial cell apoptosis.", "journal": "PloS one", "date": "2013", "authors": "Liu M, Wilson NO, Hibbert JM, Stiles JK", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "23967200", "url": "https://glygen.org/publication/PubMed/23967200" } ] }, { "title": "The signal transducers Stat1 and Stat3 and their novel target Jmjd3 drive the expression of inflammatory genes in microglia.", "journal": "Journal of molecular medicine (Berlin, Germany)", "date": "2014", "authors": "Przanowski P, Dabrowski M, Ellert-Miklaszewska A, Kloss M, Mieczkowski J, Kaza B, Ronowicz A, Hu F, Piotrowski A, Kettenmann H, Komorowski J, Kaminska B", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "24097101", "url": "https://glygen.org/publication/PubMed/24097101" } ] }, { "title": "Inhibition of endocytic vesicle fusion by Plk1-mediated phosphorylation of vimentin during mitosis.", "journal": "Cell cycle (Georgetown, Tex.)", "date": "2014", "authors": "Ikawa K, Satou A, Fukuhara M, Matsumura S, Sugiyama N, Goto H, Fukuda M, Inagaki M, Ishihama Y, Toyoshima F", "evidence": [ { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" } ], "reference": [ { "type": "PubMed", "id": "24196446", "url": "https://glygen.org/publication/PubMed/24196446" } ] }, { "title": "Histone deacetylase 6-mediated selective autophagy regulates COPD-associated cilia dysfunction.", "journal": "The Journal of clinical investigation", "date": "2013", "authors": "Lam HC, Cloonan SM, Bhashyam AR, Haspel JA, Singh A, Sathirapongsasuti JF, Cervo M, Yao H, Chung AL, Mizumura K, An CH, Shan B, Franks JM, Haley KJ, Owen CA, Tesfaigzi Y, Washko GR, Quackenbush J, Silverman EK, Rahman I, Kim HP, Mahmood A, Biswal SS, Ryter SW, Choi AM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9646399", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9646399" } ], "reference": [ { "type": "PubMed", "id": "24200693", "url": "https://glygen.org/publication/PubMed/24200693" } ] }, { "title": "An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.", "journal": "Journal of proteomics", "date": "2014", "authors": "Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H", "evidence": [ { "database": "UniProtKB", "id": "P08670", "url": "https://www.uniprot.org/uniprot/P08670" }, { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" } ], "reference": [ { "type": "PubMed", "id": "24275569", "url": "https://glygen.org/publication/PubMed/24275569" } ] }, { "title": "DNA-PK target identification reveals novel links between DNA repair signaling and cytoskeletal regulation.", "journal": "PloS one", "date": "2013", "authors": "Kotula E, Faigle W, Berthault N, Dingli F, Loew D, Sun JS, Dutreix M, Quanz M", "evidence": [ { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" } ], "reference": [ { "type": "PubMed", "id": "24282534", "url": "https://glygen.org/publication/PubMed/24282534" } ] }, { "title": "Hsp90-dependent assembly of the DBC2/RhoBTB2-Cullin3 E3-ligase complex.", "journal": "PloS one", "date": "2014", "authors": "Manjarrez JR, Sun L, Prince T, Matts RL", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013422", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013422" } ], "reference": [ { "type": "PubMed", "id": "24608665", "url": "https://glygen.org/publication/PubMed/24608665" } ] }, { "title": "Vimentin rather than keratin expression in some hormone-independent breast cancer cell lines and in oncogene-transformed mammary epithelial cells.", "journal": "Cancer Res.", "date": "1989", "authors": "Sommers C L, Walker-Jones D, Heckford S E, Worland P, Valverius E, Clark R, McCormick F, Stampfer M, Abularach S, Gelmann E P", "evidence": [ { "database": "UniProtKB", "id": "P08670", "url": "https://www.uniprot.org/uniprot/P08670" } ], "reference": [ { "type": "PubMed", "id": "2472876", "url": "https://glygen.org/publication/PubMed/2472876" } ] }, { "title": "STAT3 Target Genes Relevant to Human Cancers.", "journal": "Cancers", "date": "2014", "authors": "Carpenter RL, Lo HW", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "24743777", "url": "https://glygen.org/publication/PubMed/24743777" } ] }, { "title": "Interaction of plectin with keratins 5 and 14: dependence on several plectin domains and keratin quaternary structure.", "journal": "J. Invest. Dermatol.", "date": "2014", "authors": "Bouameur Jamal-Eddine, Favre Bertrand, Fontao Lionel, Lingasamy Prakash, Begr\u00e9 Nadja, Borradori Luca", "evidence": [ { "database": "UniProtKB", "id": "P08670", "url": "https://www.uniprot.org/uniprot/P08670" } ], "reference": [ { "type": "PubMed", "id": "24940650", "url": "https://glygen.org/publication/PubMed/24940650" } ] }, { "title": "Domain- and sequence-specific phosphorylation of vimentin induces disassembly of the filament structure.", "journal": "Biochemistry", "date": "1989", "authors": "Ando S, Tanabe K, Gonda Y, Sato C, Inagaki M", "evidence": [ { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" } ], "reference": [ { "type": "PubMed", "id": "2500966", "url": "https://glygen.org/publication/PubMed/2500966" } ] }, { "title": "Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "2014", "authors": "Impens F, Radoshevich L, Cossart P, Ribet D", "evidence": [ { "database": "UniProtKB", "id": "P08670", "url": "https://www.uniprot.org/uniprot/P08670" } ], "reference": [ { "type": "PubMed", "id": "25114211", "url": "https://glygen.org/publication/PubMed/25114211" } ] }, { "title": "Liver is the major source of elevated serum lipocalin-2 levels after bacterial infection or partial hepatectomy: a critical role for IL-6/STAT3.", "journal": "Hepatology (Baltimore, Md.)", "date": "2015", "authors": "Xu MJ, Feng D, Wu H, Wang H, Chan Y, Kolls J, Borregaard N, Porse B, Berger T, Mak TW, Cowland JB, Kong X, Gao B", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "25234944", "url": "https://glygen.org/publication/PubMed/25234944" } ] }, { "title": "Dinitrosopiperazine-mediated phosphorylated-proteins are involved in nasopharyngeal carcinoma metastasis.", "journal": "International journal of molecular sciences", "date": "2014", "authors": "Tan G, Tang X, Huang D, Li Y, Liu N, Peng Z, Zhang Z, Duan C, Lu J, Yan G, Tang F", "evidence": [ { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" } ], "reference": [ { "type": "PubMed", "id": "25375189", "url": "https://glygen.org/publication/PubMed/25375189" } ] }, { "title": "Target-selective protein S-nitrosylation by sequence motif recognition.", "journal": "Cell", "date": "2014", "authors": "Jia J, Arif A, Terenzi F, Willard B, Plow EF, Hazen SL, Fox PL", "evidence": [ { "database": "UniProtKB", "id": "P08670", "url": "https://www.uniprot.org/uniprot/P08670" } ], "reference": [ { "type": "PubMed", "id": "25417112", "url": "https://glygen.org/publication/PubMed/25417112" } ] }, { "title": "Degradation of lipid droplet-associated proteins by chaperone-mediated autophagy facilitates lipolysis.", "journal": "Nature cell biology", "date": "2015", "authors": "Kaushik S, Cuervo AM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9615710", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9615710" } ], "reference": [ { "type": "PubMed", "id": "25961502", "url": "https://glygen.org/publication/PubMed/25961502" } ] }, { "title": "Lysosomal mTORC2/PHLPP1/Akt Regulate Chaperone-Mediated Autophagy.", "journal": "Molecular cell", "date": "2015", "authors": "Arias E, Koga H, Diaz A, Mocholi E, Patel B, Cuervo AM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9613829", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9613829" } ], "reference": [ { "type": "PubMed", "id": "26118642", "url": "https://glygen.org/publication/PubMed/26118642" } ] }, { "title": "Sporadic and familial congenital cataracts: mutational spectrum and new diagnoses using next-generation sequencing.", "journal": "Hum. Mutat.", "date": "2016", "authors": "Ma Alan S, Grigg John R, Ho Gladys, Prokudin Ivan, Farnsworth Elizabeth, Holman Katherine, Cheng Anson, Billson Frank A, Martin Frank, Fraser Clare, Mowat David, Smith James, Christodoulou John, Flaherty Maree, Bennetts Bruce, Jamieson Robyn V", "evidence": [ { "database": "UniProtKB", "id": "P08670", "url": "https://www.uniprot.org/uniprot/P08670" } ], "reference": [ { "type": "PubMed", "id": "26694549", "url": "https://glygen.org/publication/PubMed/26694549" } ] }, { "title": "Two new isoforms of the human hepatoma-derived growth factor interact with components of the cytoskeleton.", "journal": "Biol. Chem.", "date": "2016", "authors": "N\u00fc\u00dfe Jessica, Mirastschijski Ursula, Waespy Mario, Oetjen Janina, Brandes Nadine, Rebello Osmond, Paroni Federico, Kelm S\u00f8rge, Dietz Frank", "evidence": [ { "database": "UniProtKB", "id": "P08670", "url": "https://www.uniprot.org/uniprot/P08670" } ], "reference": [ { "type": "PubMed", "id": "26845719", "url": "https://glygen.org/publication/PubMed/26845719" } ] }, { "title": "Comparative analysis of Cu (I)-catalyzed alkyne-azide cycloaddition (CuAAC) and strain-promoted alkyne-azide cycloaddition (SPAAC) in O-GlcNAc proteomics.", "journal": "Electrophoresis", "date": "2016", "authors": "Li S, Zhu H, Wang J, Wang X, Li X, Ma C, Wen L, Yu B, Wang Y, Li J, Wang PG", "evidence": [ { "database": "O-GlcNAc Database", "id": "P08670", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08670" } ], "reference": [ { "type": "PubMed", "id": "26853435", "url": "https://glygen.org/publication/PubMed/26853435" } ] }, { "title": "Atypical Rho GTPases of the RhoBTB Subfamily: Roles in Vesicle Trafficking and Tumorigenesis.", "journal": "Cells", "date": "2016", "authors": "Ji W, Rivero F", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013422", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013422" } ], "reference": [ { "type": "PubMed", "id": "27314390", "url": "https://glygen.org/publication/PubMed/27314390" } ] }, { "title": "Suppression of Vimentin Phosphorylation by the Avian Reovirus p17 through Inhibition of CDK1 and Plk1 Impacting the G2/M Phase of the Cell Cycle.", "journal": "PloS one", "date": "2016", "authors": "Chiu HC, Huang WR, Liao TL, Wu HY, Munir M, Shih WL, Liu HJ", "evidence": [ { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" } ], "reference": [ { "type": "PubMed", "id": "27603133", "url": "https://glygen.org/publication/PubMed/27603133" } ] }, { "title": "Characterization and Genetic Analyses of New Genes Coding for NOD2 Interacting Proteins.", "journal": "PLoS ONE", "date": "2016", "authors": "Thiebaut R, Esmiol S, Lecine P, Mahfouz B, Hermant A, Nicoletti C, Parnis S, Perroy J, Borg JP, Pascoe L, Hugot JP, Ollendorff V", "evidence": [ { "database": "UniProtKB", "id": "P08670", "url": "https://www.uniprot.org/uniprot/P08670" } ], "reference": [ { "type": "PubMed", "id": "27812135", "url": "https://glygen.org/publication/PubMed/27812135" } ] }, { "title": "A role for a 70-kilodalton heat shock protein in lysosomal degradation of intracellular proteins.", "journal": "Science (New York, N.Y.)", "date": "1989", "authors": "Chiang HL, Terlecky SR, Plant CP, Dice JF", "evidence": [ { "database": "Reactome", "id": "R-HSA-9615710", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9615710" } ], "reference": [ { "type": "PubMed", "id": "2799391", "url": "https://glygen.org/publication/PubMed/2799391" } ] }, { "title": "High glucose levels boost the aggressiveness of highly metastatic cholangiocarcinoma cells via O-GlcNAcylation.", "journal": "Scientific reports", "date": "2017", "authors": "Phoomak C, Vaeteewoottacharn K, Silsirivanit A, Saengboonmee C, Seubwai W, Sawanyawisuth K, Wongkham C, Wongkham S", "evidence": [ { "database": "O-GlcNAc Database", "id": "P08670", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08670" } ], "reference": [ { "type": "PubMed", "id": "28262738", "url": "https://glygen.org/publication/PubMed/28262738" } ] }, { "title": "Targeted Exome Sequencing of Congenital Cataracts Related Genes: Broadening the Mutation Spectrum and Genotype-Phenotype Correlations in 27 Chinese Han Families.", "journal": "Scientific reports", "date": "2017", "authors": "Zhai Y, Li J, Yu W, Zhu S, Yu Y, Wu M, Sun G, Gong X, Yao K", "evidence": [ { "database": "UniProtKB", "id": "P08670", "url": "https://www.uniprot.org/uniprot/P08670" } ], "reference": [ { "type": "PubMed", "id": "28450710", "url": "https://glygen.org/publication/PubMed/28450710" } ] }, { "title": "Quantitative proteomics identifies altered O-GlcNAcylation of structural, synaptic and memory-associated proteins in Alzheimer's disease.", "journal": "The Journal of pathology", "date": "2017", "authors": "Wang S, Yang F, Petyuk VA, Shukla AK, Monroe ME, Gritsenko MA, Rodland KD, Smith RD, Qian WJ, Gong CX, Liu T", "evidence": [ { "database": "O-GlcNAc Database", "id": "P08670", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08670" } ], "reference": [ { "type": "PubMed", "id": "28657654", "url": "https://glygen.org/publication/PubMed/28657654" } ] }, { "title": "Long noncoding RNA LINC00675 enhances phosphorylation of vimentin on Ser83 to suppress gastric cancer progression.", "journal": "Cancer letters", "date": "2018", "authors": "Zeng S, Xie X, Xiao YF, Tang B, Hu CJ, Wang SM, Wu YY, Dong H, Li BS, Yang SM", "evidence": [ { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" } ], "reference": [ { "type": "PubMed", "id": "29107103", "url": "https://glygen.org/publication/PubMed/29107103" } ] }, { "title": "Artificial Cysteine S-Glycosylation Induced by Per-O-Acetylated Unnatural Monosaccharides during Metabolic Glycan Labeling.", "journal": "Angewandte Chemie (International ed. in English)", "date": "2018", "authors": "Qin W, Qin K, Fan X, Peng L, Hong W, Zhu Y, Lv P, Du Y, Huang R, Han M, Cheng B, Liu Y, Zhou W, Wang C, Chen X", "evidence": [ { "database": "O-GlcNAc Database", "id": "P08670", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08670" }, { "database": "O-GlcNAc Atlas", "id": "P08670", "url": "https://oglcnac.org/atlas/detail/P08670" } ], "reference": [ { "type": "PubMed", "id": "29237092", "url": "https://glygen.org/publication/PubMed/29237092" } ] }, { "title": "Mapping and Quantification of Over 2000 O-linked Glycopeptides in Activated Human T Cells with Isotope-Targeted Glycoproteomics (Isotag).", "journal": "Molecular & cellular proteomics : MCP", "date": "2018", "authors": "Woo CM, Lund PJ, Huang AC, Davis MM, Bertozzi CR, Pitteri SJ", "evidence": [ { "database": "O-GlcNAc Database", "id": "P08670", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08670" }, { "database": "O-GlcNAc Atlas", "id": "P08670", "url": "https://oglcnac.org/atlas/detail/P08670" }, { "database": "GlyGen", "id": "GLY_000142", "url": "https://data.glygen.org/GLY_000142" } ], "reference": [ { "type": "PubMed", "id": "29351928", "url": "https://glygen.org/publication/PubMed/29351928" } ] }, { "title": "Phosphoproteomics Analysis Identifies Novel Candidate Substrates of the Nonreceptor Tyrosine Kinase, Src-related Kinase Lacking C-terminal Regulatory Tyrosine and N-terminal Myristoylation Sites (SRMS).", "journal": "Molecular & cellular proteomics : MCP", "date": "2018", "authors": "Goel RK, Paczkowska M, Reimand J, Napper S, Lukong KE", "evidence": [ { "database": "UniProtKB", "id": "P08670", "url": "https://www.uniprot.org/uniprot/P08670" } ], "reference": [ { "type": "PubMed", "id": "29496907", "url": "https://glygen.org/publication/PubMed/29496907" } ] }, { "title": "Site-specific glycosylation regulates the form and function of the intermediate filament cytoskeleton.", "journal": "eLife", "date": "2018", "authors": "Tarbet HJ, Dolat L, Smith TJ, Condon BM, O'Brien ET 3rd, Valdivia RH, Boyce M", "evidence": [ { "database": "O-GlcNAc Database", "id": "P08670", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08670" } ], "reference": [ { "type": "PubMed", "id": "29513221", "url": "https://glygen.org/publication/PubMed/29513221" } ] }, { "title": "The coming of age of chaperone-mediated autophagy.", "journal": "Nature reviews. Molecular cell biology", "date": "2018", "authors": "Kaushik S, Cuervo AM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9613829", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9613829" } ], "reference": [ { "type": "PubMed", "id": "29626215", "url": "https://glygen.org/publication/PubMed/29626215" } ] }, { "title": "Quantitative Profiling of Protein O-GlcNAcylation Sites by an Isotope-Tagged Cleavable Linker.", "journal": "ACS chemical biology", "date": "2018", "authors": "Qin K, Zhu Y, Qin W, Gao J, Shao X, Wang YL, Zhou W, Wang C, Chen X", "evidence": [ { "database": "O-GlcNAc Database", "id": "P08670", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08670" }, { "database": "O-GlcNAc Atlas", "id": "P08670", "url": "https://oglcnac.org/atlas/detail/P08670" } ], "reference": [ { "type": "PubMed", "id": "30059200", "url": "https://glygen.org/publication/PubMed/30059200" } ] }, { "title": "MicroRNA miR-509 Regulates ERK1/2, the Vimentin Network, and Focal Adhesions by Targeting Plk1.", "journal": "Scientific reports", "date": "2018", "authors": "Liao G, Wang R, Rezey AC, Gerlach BD, Tang DD", "evidence": [ { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" } ], "reference": [ { "type": "PubMed", "id": "30135525", "url": "https://glygen.org/publication/PubMed/30135525" } ] }, { "title": "Vimentin and Non-Muscle Myosin IIA are Members of the Neural Precursor Cell Expressed Developmentally Down-Regulated 9 (NEDD9) Interactome in Head and Neck Squamous Cell Carcinoma Cells.", "journal": "Translational oncology", "date": "2019", "authors": "Semelakova M, Grauzam S, Betadthunga P, Tiedeken J, Coaxum S, Neskey DM, Rosenzweig SA", "evidence": [ { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" } ], "reference": [ { "type": "PubMed", "id": "30267961", "url": "https://glygen.org/publication/PubMed/30267961" } ] }, { "title": "A triarylphosphine-trimethylpiperidine reagent for the one-step derivatization and enrichment of protein post-translational modifications and identification by mass spectrometry.", "journal": "Chemical communications (Cambridge, England)", "date": "2018", "authors": "Huo B, Zhang W, Zhao X, Dong H, Yu Y, Wang J, Qian X, Qin W", "evidence": [ { "database": "O-GlcNAc Database", "id": "P08670", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08670" } ], "reference": [ { "type": "PubMed", "id": "30379171", "url": "https://glygen.org/publication/PubMed/30379171" } ] }, { "title": "An Isotope-Coded Photocleavable Probe for Quantitative Profiling of Protein O-GlcNAcylation.", "journal": "ACS chemical biology", "date": "2019", "authors": "Li J, Li Z, Duan X, Qin K, Dang L, Sun S, Cai L, Hsieh-Wilson LC, Wu L, Yi W", "evidence": [ { "database": "O-GlcNAc Database", "id": "P08670", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08670" }, { "database": "O-GlcNAc Atlas", "id": "P08670", "url": "https://oglcnac.org/atlas/detail/P08670" } ], "reference": [ { "type": "PubMed", "id": "30620550", "url": "https://glygen.org/publication/PubMed/30620550" } ] }, { "title": "Vimentin disruption by lipoxidation and electrophiles: Role of the cysteine residue and filament dynamics.", "journal": "Redox biology", "date": "2019-05", "authors": "M\u00f3nico Andreia, Duarte Sofia, Pajares Mar\u00eda A, P\u00e9rez-Sala Dolores", "evidence": [ { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" } ], "reference": [ { "type": "PubMed", "id": "30658903", "url": "https://glygen.org/publication/PubMed/30658903" } ] }, { "title": "Src and SHP2 coordinately regulate the dynamics and organization of vimentin filaments during cell migration.", "journal": "Oncogene", "date": "2019", "authors": "Yang CY, Chang PW, Hsu WH, Chang HC, Chen CL, Lai CC, Chiu WT, Chen HC", "evidence": [ { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" } ], "reference": [ { "type": "PubMed", "id": "30696956", "url": "https://glygen.org/publication/PubMed/30696956" } ] }, { "title": "Retraction: The Cellular Distribution of Serotonin Transporter Is Impeded on Serotonin-Altered Vimentin Network.", "journal": "PLoS ONE", "date": "2019", "authors": "", "evidence": [ { "database": "UniProtKB", "id": "P08670", "url": "https://www.uniprot.org/uniprot/P08670" } ], "reference": [ { "type": "PubMed", "id": "30707744", "url": "https://glygen.org/publication/PubMed/30707744" } ] }, { "title": "RhoBTB1 protects against hypertension and arterial stiffness by restraining phosphodiesterase 5 activity.", "journal": "The Journal of clinical investigation", "date": "2019", "authors": "Mukohda M, Fang S, Wu J, Agbor LN, Nair AR, Ibeawuchi SC, Hu C, Liu X, Lu KT, Guo DF, Davis DR, Keen HL, Quelle FW, Sigmund CD", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013422", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013422" } ], "reference": [ { "type": "PubMed", "id": "30896450", "url": "https://glygen.org/publication/PubMed/30896450" } ] }, { "title": "Aspartate Residues Far from the Active Site Drive O-GlcNAc Transferase Substrate Selection.", "journal": "Journal of the American Chemical Society", "date": "2019", "authors": "Joiner CM, Levine ZG, Aonbangkhen C, Woo CM, Walker S", "evidence": [ { "database": "O-GlcNAc Database", "id": "P08670", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08670" }, { "database": "O-GlcNAc Atlas", "id": "P08670", "url": "https://oglcnac.org/atlas/detail/P08670" } ], "reference": [ { "type": "PubMed", "id": "31373491", "url": "https://glygen.org/publication/PubMed/31373491" } ] }, { "title": "RhoBTB1 interacts with ROCKs and inhibits invasion.", "journal": "The Biochemical journal", "date": "2019", "authors": "Haga RB, Garg R, Collu F, Borda D'Agua B, Menendez ST, Colomba A, Fraternali F, Ridley AJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013422", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013422" } ], "reference": [ { "type": "PubMed", "id": "31431478", "url": "https://glygen.org/publication/PubMed/31431478" } ] }, { "title": "Next-generation unnatural monosaccharides reveal that ESRRB O-GlcNAcylation regulates pluripotency of mouse embryonic stem cells.", "journal": "Nature communications", "date": "2019", "authors": "Hao Y, Fan X, Shi Y, Zhang C, Sun DE, Qin K, Qin W, Zhou W, Chen X", "evidence": [ { "database": "O-GlcNAc Database", "id": "P08670", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08670" }, { "database": "O-GlcNAc Atlas", "id": "P08670", "url": "https://oglcnac.org/atlas/detail/P08670" } ], "reference": [ { "type": "PubMed", "id": "31492838", "url": "https://glygen.org/publication/PubMed/31492838" } ] }, { "title": "RNF208, an estrogen-inducible E3 ligase, targets soluble Vimentin to suppress metastasis in triple-negative breast cancers.", "journal": "Nature communications", "date": "2019", "authors": "Pang K, Park J, Ahn SG, Lee J, Park Y, Ooshima A, Mizuno S, Yamashita S, Park KS, Lee SY, Jeong J, Ushijima T, Yang KM, Kim SJ", "evidence": [ { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" } ], "reference": [ { "type": "PubMed", "id": "31862882", "url": "https://glygen.org/publication/PubMed/31862882" } ] }, { "title": "Mapping the proximity interaction network of the Rho-family GTPases reveals signalling pathways and regulatory mechanisms.", "journal": "Nature cell biology", "date": "2020", "authors": "Bagci H, Sriskandarajah N, Robert A, Boulais J, Elkholi IE, Tran V, Lin ZY, Thibault MP, Dube N, Faubert D, Hipfner DR, Gingras AC, Cote JF", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013422", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013422" } ], "reference": [ { "type": "PubMed", "id": "31871319", "url": "https://glygen.org/publication/PubMed/31871319" } ] }, { "title": "F-Actin Interactome Reveals Vimentin as a Key Regulator of Actin Organization and Cell Mechanics in Mitosis.", "journal": "Developmental cell", "date": "2020-01-27", "authors": "Serres Murielle P, Samwer Matthias, Truong Quang Binh An, Lavoie Genevi\u00e8ve, Perera Upamali, G\u00f6rlich Dirk, Charras Guillaume, Petronczki Mark, Roux Philippe P, Paluch Ewa K", "evidence": [ { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" } ], "reference": [ { "type": "PubMed", "id": "31928973", "url": "https://glygen.org/publication/PubMed/31928973" } ] }, { "title": "Hypoxic induction of vasculogenic mimicry in hepatocellular carcinoma: role of HIF-1 \u03b1, RhoA/ROCK and Rac1/PAK signaling.", "journal": "BMC cancer", "date": "2020-01-13", "authors": "Zhang Ji-Gang, Zhou He-Ming, Zhang Xue, Mu Wan, Hu Juan-Ni, Liu Gao-Lin, Li Qin", "evidence": [ { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" } ], "reference": [ { "type": "PubMed", "id": "31931758", "url": "https://glygen.org/publication/PubMed/31931758" } ] }, { "title": "Quantitative SUMO proteomics identifies PIAS1 substrates involved in cell migration and motility.", "journal": "Nature communications", "date": "2020", "authors": "Li C, McManus FP, Plutoni C, Pascariu CM, Nelson T, Alberici Delsin LE, Emery G, Thibault P", "evidence": [ { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" } ], "reference": [ { "type": "PubMed", "id": "32047143", "url": "https://glygen.org/publication/PubMed/32047143" } ] }, { "title": "Cooperative roles of PAK1 and filamin A in regulation of vimentin assembly and cell extension formation.", "journal": "Biochimica et biophysica acta. Molecular cell research", "date": "2020-09", "authors": "Ding Isabel, Ostrowska-Podhorodecka Zofia, Lee Wilson, Liu Richard S C, Carneiro Karina, Janmey Paul A, McCulloch Christopher A", "evidence": [ { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" } ], "reference": [ { "type": "PubMed", "id": "32389644", "url": "https://glygen.org/publication/PubMed/32389644" } ] }, { "title": "Methylation-directed glycosylation of chromatin factors represses retrotransposon promoters.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2020", "authors": "Boulard M, Rucli S, Edwards JR, Bestor TH", "evidence": [ { "database": "O-GlcNAc Database", "id": "P08670", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08670" } ], "reference": [ { "type": "PubMed", "id": "32522876", "url": "https://glygen.org/publication/PubMed/32522876" } ] }, { "title": "Artemisinins target the intermediate filament protein vimentin for human cytomegalovirus inhibition.", "journal": "The Journal of biological chemistry", "date": "2020-10-30", "authors": "Roy Sujayita, Kapoor Arun, Zhu Fei, Mukhopadhyay Rupkatha, Ghosh Ayan Kumar, Lee Hyun, Mazzone Jennifer, Posner Gary H, Arav-Boger Ravit", "evidence": [ { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" } ], "reference": [ { "type": "PubMed", "id": "32855235", "url": "https://glygen.org/publication/PubMed/32855235" } ] }, { "title": "Methods for Enrichment and Assignment of N-Acetylglucosamine Modification Sites.", "journal": "Molecular & cellular proteomics : MCP", "date": "2021", "authors": "Maynard JC, Chalkley RJ", "evidence": [ { "database": "O-GlcNAc Atlas", "id": "P08670", "url": "https://oglcnac.org/atlas/detail/P08670" } ], "reference": [ { "type": "PubMed", "id": "32938750", "url": "https://glygen.org/publication/PubMed/32938750" } ] }, { "title": "Unidirectional Regulation of Vimentin Intermediate Filaments to Caveolin-1.", "journal": "International journal of molecular sciences", "date": "2020-10-09", "authors": "Shi Xuemeng, Fan Changyuan, Jiu Yaming", "evidence": [ { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" } ], "reference": [ { "type": "PubMed", "id": "33050149", "url": "https://glygen.org/publication/PubMed/33050149" } ] }, { "title": "Proteomic profiling and genome-wide mapping of O-GlcNAc chromatin-associated proteins reveal an O-GlcNAc-regulated genotoxic stress response.", "journal": "Nature communications", "date": "2020", "authors": "Liu Y, Chen Q, Zhang N, Zhang K, Dou T, Cao Y, Liu Y, Li K, Hao X, Xie X, Li W, Ren Y, Zhang J", "evidence": [ { "database": "O-GlcNAc Database", "id": "P08670", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08670" } ], "reference": [ { "type": "PubMed", "id": "33214551", "url": "https://glygen.org/publication/PubMed/33214551" } ] }, { "title": "Bnip3 interacts with vimentin, an intermediate filament protein, and regulates autophagy of hepatic stellate cells.", "journal": "Aging", "date": "2020-12-03", "authors": "Liu Jie, Xie Yuyu, Cui Zhangbo, Xia Tian, Wan Lu, Zhou Haifeng, Zhang Peng, Zhang Yijie, Guan Fei, Liu Wenqi, Shi Chunwei", "evidence": [ { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" } ], "reference": [ { "type": "PubMed", "id": "33290258", "url": "https://glygen.org/publication/PubMed/33290258" } ] }, { "title": "A new tandem enrichment strategy for the simultaneous profiling of O-GlcNAcylation and phosphorylation in RNA-binding proteome.", "journal": "The Analyst", "date": "2021", "authors": "Fan Z, Li J, Liu T, Zhang Z, Qin W, Qian X", "evidence": [ { "database": "O-GlcNAc Database", "id": "P08670", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08670" }, { "database": "O-GlcNAc Atlas", "id": "P08670", "url": "https://oglcnac.org/atlas/detail/P08670" } ], "reference": [ { "type": "PubMed", "id": "33465208", "url": "https://glygen.org/publication/PubMed/33465208" } ] }, { "title": "Nucleotide sequence of the human vimentin gene and regulation of its transcription in tissues and cultured cells.", "journal": "Gene", "date": "1988", "authors": "Perreau J, Lilienbaum A, Vasseur M, Paulin D", "evidence": [ { "database": "UniProtKB", "id": "P08670", "url": "https://www.uniprot.org/uniprot/P08670" } ], "reference": [ { "type": "PubMed", "id": "3371665", "url": "https://glygen.org/publication/PubMed/3371665" } ] }, { "title": "O-GlcNAc modification regulates MTA1 transcriptional activity during breast cancer cell genotoxic adaptation.", "journal": "Biochimica et biophysica acta. General subjects", "date": "2021", "authors": "Xie X, Wu Q, Zhang K, Liu Y, Zhang N, Chen Q, Wang L, Li W, Zhang J, Liu Y", "evidence": [ { "database": "O-GlcNAc Database", "id": "P08670", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08670" } ], "reference": [ { "type": "PubMed", "id": "34019948", "url": "https://glygen.org/publication/PubMed/34019948" } ] }, { "title": "Coding sequence and growth regulation of the human vimentin gene.", "journal": "Mol. Cell. Biol.", "date": "1986", "authors": "Ferrari S, Battini R, Kaczmarek L, Rittling S, Calabretta B, de Riel J K, Philiponis V, Wei J F, Baserga R", "evidence": [ { "database": "UniProtKB", "id": "P08670", "url": "https://www.uniprot.org/uniprot/P08670" } ], "reference": [ { "type": "PubMed", "id": "3467175", "url": "https://glygen.org/publication/PubMed/3467175" } ] }, { "title": "Comparative O-GlcNAc Proteomic Analysis Reveals a Role of O-GlcNAcylated SAM68 in Lung Cancer Aggressiveness.", "journal": "Cancers", "date": "2022", "authors": "Lin CH, Liao CC, Wang SY, Peng CY, Yeh YC, Chen MY, Chou TY", "evidence": [ { "database": "O-GlcNAc Database", "id": "P08670", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08670" } ], "reference": [ { "type": "PubMed", "id": "35008409", "url": "https://glygen.org/publication/PubMed/35008409" } ] }, { "title": "O-GlcNAcylation promotes fatty acid synthase activity under nutritional stress as a pro-survival mechanism in cancer cells.", "journal": "Proteomics", "date": "2022", "authors": "Wong YK, Wang J, Lim TK, Lin Q, Yap CT, Shen HM", "evidence": [ { "database": "O-GlcNAc Database", "id": "P08670", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08670" } ], "reference": [ { "type": "PubMed", "id": "35083852", "url": "https://glygen.org/publication/PubMed/35083852" } ] }, { "title": "Simultaneously Identifying and Distinguishing Glycoproteins with O-GlcNAc and O-GalNAc (the Tn Antigen) in Human Cancer Cells.", "journal": "Analytical chemistry", "date": "2022", "authors": "Xu S, Zheng J, Xiao H, Wu R", "evidence": [ { "database": "O-GlcNAc Database", "id": "P08670", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08670" } ], "reference": [ { "type": "PubMed", "id": "35132862", "url": "https://glygen.org/publication/PubMed/35132862" } ] }, { "title": "An Optimized Isotopic Photocleavable Tagging Strategy for Site-Specific and Quantitative Profiling of Protein O-GlcNAcylation in Colorectal Cancer Metastasis.", "journal": "ACS chemical biology", "date": "2022", "authors": "Liu J, Hao Y, Wang C, Jin Y, Yang Y, Gu J, Chen X", "evidence": [ { "database": "O-GlcNAc Database", "id": "P08670", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08670" } ], "reference": [ { "type": "PubMed", "id": "35254053", "url": "https://glygen.org/publication/PubMed/35254053" } ] }, { "title": "Endo-M Mediated Chemoenzymatic Approach Enables Reversible Glycopeptide Labeling for O-GlcNAcylation Analysis.", "journal": "Angewandte Chemie (International ed. in English)", "date": "2022", "authors": "Chen Y, Tang F, Qin H, Yue X, Nie Y, Huang W, Ye M", "evidence": [ { "database": "O-GlcNAc Database", "id": "P08670", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08670" } ], "reference": [ { "type": "PubMed", "id": "35289036", "url": "https://glygen.org/publication/PubMed/35289036" } ] }, { "title": "Design and Preparation of Novel Nitro-Oxide-Grafted Nanospheres with Enhanced Hydrogen Bonding Interaction for O-GlcNAc Analysis.", "journal": "ACS applied materials & interfaces", "date": "2022-10-26", "authors": "Wu Ci, Shi Song, Hou Chunyan, Luo Yang, Byers Stephen, Ma Junfeng", "evidence": [ { "database": "O-GlcNAc Database", "id": "P08670", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08670" } ], "reference": [ { "type": "PubMed", "id": "36240223", "url": "https://glygen.org/publication/PubMed/36240223" } ] }, { "title": "Extracellular arginine availability modulates eIF2\u03b1 O-GlcNAcylation and heme oxygenase 1 translation for cellular homeostasis.", "journal": "Journal of biomedical science", "date": "2023-05-22", "authors": "Hung Yu-Wen, Ouyang Ching, Ping Xiaoli, Qi Yue, Wang Yi-Chang, Kung Hsing-Jien, Ann David K", "evidence": [ { "database": "O-GlcNAc Database", "id": "P08670", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08670" } ], "reference": [ { "type": "PubMed", "id": "37217939", "url": "https://glygen.org/publication/PubMed/37217939" } ] }, { "title": "ENAH-202 promotes cancer progression in oral squamous cell carcinoma by regulating ZNF502/VIM axis.", "journal": "Cancer medicine", "date": "2023-11", "authors": "Zhang Xinyue, Chen Xi, Sun Dongyuan, Song Ning, Li Minmin, Zheng Wentian, Yu Yang, Ding Gang, Jiang Yingying", "evidence": [ { "database": "RefSeq", "id": "NP_003371", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003371" } ], "reference": [ { "type": "PubMed", "id": "37902191", "url": "https://glygen.org/publication/PubMed/37902191" } ] }, { "title": "FAM171B stabilizes vimentin and enhances CCL2-mediated TAM infiltration to promote bladder cancer progression.", "journal": "Journal of experimental & clinical cancer research : CR", "date": "2023-11-02", "authors": "Hu Wei-Min, Li Ming, Ning Jin-Zhuo, Tang Yu-Qi, Song Tian-Bao, Li Lin-Zhi, Zou Fan, Cheng Fan, Yu Wei-Min", "evidence": [ { "database": "RefSeq", "id": "NP_003371", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003371" } ], "reference": [ { "type": "PubMed", "id": "37915048", "url": "https://glygen.org/publication/PubMed/37915048" } ] }, { "title": "Interaction of species A rotavirus VP4 with the cellular proteins vimentin and actin related protein 2 discovered by a proximity interactome assay.", "journal": "Journal of virology", "date": "2023-12-21", "authors": "Hao Pengfei, Qu Qiaoqiao, Pang Zhaoxia, Li Letian, Du Shouwen, Shang Limin, Jin Chaozhi, Xu Wang, Ha Zhuo, Jiang Yuhang, Chen Jing, Gao Zihan, Jin Ningyi, Wang Jian, Li Chang", "evidence": [ { "database": "RefSeq", "id": "NP_003371", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003371" } ], "reference": [ { "type": "PubMed", "id": "37991368", "url": "https://glygen.org/publication/PubMed/37991368" } ] }, { "title": "Phosphorylated vimentin at Ser72 is associated with epithelial-mesenchymal transition in lupus nephritis.", "journal": "International journal of rheumatic diseases", "date": "2023-12-11", "authors": "Wang Daji, Zhang Fan, He Jing, Li Chuyi, Liu Xingjiao, Zhang Meng, Huang Haihui, Xiong Zuying, Duan Hongxia, Huang Xiaoyan, Wang Meiying", "evidence": [ { "database": "RefSeq", "id": "NP_003371", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003371" } ], "reference": [ { "type": "PubMed", "id": "38078507", "url": "https://glygen.org/publication/PubMed/38078507" } ] }, { "title": "Circular RNA cVIM promotes hepatic stellate cell activation in liver fibrosis via miR-122-5p/miR-9-5p-mediated TGF-\u03b2 signaling cascade.", "journal": "Communications biology", "date": "2024-01-19", "authors": "Zhou Zhenxu, Zhang Rongrong, Li Xinmiao, Zhang Weizhi, Zhan Yating, Lang Zhichao, Tao Qiqi, Yu Jinglu, Yu Suhui, Yu Zhengping, Zheng Jianjian", "evidence": [ { "database": "RefSeq", "id": "NP_003371", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003371" } ], "reference": [ { "type": "PubMed", "id": "38243118", "url": "https://glygen.org/publication/PubMed/38243118" } ] }, { "title": "Microfilament reorganization during apoptosis: the role of Gas2, a possible substrate for ICE-like proteases.", "journal": "The EMBO journal", "date": "1995", "authors": "Brancolini C, Benedetti M, Schneider C", "evidence": [ { "database": "Reactome", "id": "R-HSA-264870", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-264870" } ], "reference": [ { "type": "PubMed", "id": "7489707", "url": "https://glygen.org/publication/PubMed/7489707" } ] }, { "title": "Interferon activation of the transcription factor Stat91 involves dimerization through SH2-phosphotyrosyl peptide interactions.", "journal": "Cell", "date": "1994", "authors": "Shuai K, Horvath CM, Huang LH, Qureshi SA, Cowburn D, Darnell JE Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "7510216", "url": "https://glygen.org/publication/PubMed/7510216" } ] }, { "title": "Molecular cloning of APRF, a novel IFN-stimulated gene factor 3 p91-related transcription factor involved in the gp130-mediated signaling pathway.", "journal": "Cell", "date": "1994", "authors": "Akira S, Nishio Y, Inoue M, Wang XJ, Wei S, Matsusaka T, Yoshida K, Sudo T, Naruto M, Kishimoto T", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "7512451", "url": "https://glygen.org/publication/PubMed/7512451" } ] }, { "title": "IL-13 selectively induces vascular cell adhesion molecule-1 expression in human endothelial cells.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1995", "authors": "Bochner BS, Klunk DA, Sterbinsky SA, Coffman RL, Schleimer RP", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "7529288", "url": "https://glygen.org/publication/PubMed/7529288" } ] }, { "title": "Direct evidence of a heterotrimeric complex of human interleukin-4 with its receptors.", "journal": "Protein science : a publication of the Protein Society", "date": "1995", "authors": "Hoffman RC, Castner BJ, Gerhart M, Gibson MG, Rasmussen BD, March CJ, Weatherbee J, Tsang M, Gustchina A, Schalk-Hihi C, et al.", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "7795521", "url": "https://glygen.org/publication/PubMed/7795521" } ] }, { "title": "Components of a Stat recognition code: evidence for two layers of molecular selectivity.", "journal": "Immunity", "date": "1995", "authors": "Schindler U, Wu P, Rothe M, Brasseur M, McKnight SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "7796300", "url": "https://glygen.org/publication/PubMed/7796300" } ] }, { "title": "Transcriptional regulation of the junB promoter: analysis of STAT-mediated signal transduction.", "journal": "Oncogene", "date": "1995", "authors": "Coffer P, Lutticken C, van Puijenbroek A, Klop-de Jonge M, Horn F, Kruijer W", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "7898939", "url": "https://glygen.org/publication/PubMed/7898939" } ] }, { "title": "Interleukin 13, an interleukin 4-like cytokine that acts on monocytes and B cells, but not on T cells.", "journal": "Immunology today", "date": "1994", "authors": "Zurawski G, de Vries JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "7907877", "url": "https://glygen.org/publication/PubMed/7907877" } ] }, { "title": "Visualization and function of vimentin phosphorylation by cdc2 kinase during mitosis.", "journal": "The Journal of biological chemistry", "date": "1994", "authors": "Tsujimura K, Ogawara M, Takeuchi Y, Imajoh-Ohmi S, Ha MH, Inagaki M", "evidence": [ { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" } ], "reference": [ { "type": "PubMed", "id": "7983050", "url": "https://glygen.org/publication/PubMed/7983050" } ] }, { "title": "An interleukin-4-induced transcription factor: IL-4 Stat.", "journal": "Science (New York, N.Y.)", "date": "1994", "authors": "Hou J, Schindler U, Henzel WJ, Ho TC, Brasseur M, McKnight SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "8085155", "url": "https://glygen.org/publication/PubMed/8085155" } ] }, { "title": "Essential role of Stat6 in IL-4 signalling.", "journal": "Nature", "date": "1996", "authors": "Takeda K, Tanaka T, Shi W, Matsumoto M, Minami M, Kashiwamura S, Nakanishi K, Yoshida N, Kishimoto T, Akira S", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "8602263", "url": "https://glygen.org/publication/PubMed/8602263" } ] }, { "title": "STAT3 participates in transcriptional activation of the C-reactive protein gene by interleukin-6.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Zhang D, Sun M, Samols D, Kushner I", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "8621622", "url": "https://glygen.org/publication/PubMed/8621622" } ] }, { "title": "A receptor for the selective uptake and degradation of proteins by lysosomes.", "journal": "Science (New York, N.Y.)", "date": "1996", "authors": "Cuervo AM, Dice JF", "evidence": [ { "database": "Reactome", "id": "R-HSA-9613829", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9613829" } ], "reference": [ { "type": "PubMed", "id": "8662539", "url": "https://glygen.org/publication/PubMed/8662539" } ] }, { "title": "Cloning and characterization of a specific interleukin (IL)-13 binding protein structurally related to the IL-5 receptor alpha chain.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Caput D, Laurent P, Kaghad M, Lelias JM, Lefort S, Vita N, Ferrara P", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "8663118", "url": "https://glygen.org/publication/PubMed/8663118" } ] }, { "title": "The lipopolysaccharide-binding protein is a secretory class 1 acute-phase protein whose gene is transcriptionally activated by APRF/STAT/3 and other cytokine-inducible nuclear proteins.", "journal": "Molecular and cellular biology", "date": "1996", "authors": "Schumann RR, Kirschning CJ, Unbehaun A, Aberle HP, Knope HP, Lamping N, Ulevitch RJ, Herrmann F", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "8668165", "url": "https://glygen.org/publication/PubMed/8668165" } ] }, { "title": "Global and local determinants for the kinetics of interleukin-4/interleukin-4 receptor alpha chain interaction. A biosensor study employing recombinant interleukin-4-binding protein.", "journal": "European journal of biochemistry", "date": "1996", "authors": "Shen BJ, Hage T, Sebald W", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "8797861", "url": "https://glygen.org/publication/PubMed/8797861" } ] }, { "title": "Requirements for interleukin-4-induced gene expression and functional characterization of Stat6.", "journal": "Molecular and cellular biology", "date": "1996", "authors": "Mikita T, Campbell D, Wu P, Williamson K, Schindler U", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "8816495", "url": "https://glygen.org/publication/PubMed/8816495" } ] }, { "title": "Cloning of the human IL-13R alpha1 chain and reconstitution with the IL4R alpha of a functional IL-4/IL-13 receptor complex.", "journal": "FEBS letters", "date": "1997", "authors": "Miloux B, Laurent P, Bonnin O, Lupker J, Caput D, Vita N, Ferrara P", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "9013879", "url": "https://glygen.org/publication/PubMed/9013879" } ] }, { "title": "Biochemical and cellular effects of roscovitine, a potent and selective inhibitor of the cyclin-dependent kinases cdc2, cdk2 and cdk5.", "journal": "European journal of biochemistry", "date": "1997", "authors": "Meijer L, Borgne A, Mulner O, Chong JP, Blow JJ, Inagaki N, Inagaki M, Delcros JG, Moulinoux JP", "evidence": [ { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" } ], "reference": [ { "type": "PubMed", "id": "9030781", "url": "https://glygen.org/publication/PubMed/9030781" } ] }, { "title": "A population of rat liver lysosomes responsible for the selective uptake and degradation of cytosolic proteins.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Cuervo AM, Dice JF, Knecht E", "evidence": [ { "database": "Reactome", "id": "R-HSA-9613829", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9613829" } ], "reference": [ { "type": "PubMed", "id": "9038169", "url": "https://glygen.org/publication/PubMed/9038169" } ] }, { "title": "Two-dimensional electrophoretic analysis of human breast carcinoma proteins: mapping of proteins that bind to the SH3 domain of mixed lineage kinase MLK2.", "journal": "Electrophoresis", "date": "1997", "authors": "Rasmussen R K, Ji H, Eddes J S, Moritz R L, Reid G E, Simpson R J, Dorow D S", "evidence": [ { "database": "UniProtKB", "id": "P08670", "url": "https://www.uniprot.org/uniprot/P08670" } ], "reference": [ { "type": "PubMed", "id": "9150946", "url": "https://glygen.org/publication/PubMed/9150946" } ] }, { "title": "An intralysosomal hsp70 is required for a selective pathway of lysosomal protein degradation.", "journal": "The Journal of cell biology", "date": "1997", "authors": "Agarraberes FA, Terlecky SR, Dice JF", "evidence": [ { "database": "Reactome", "id": "R-HSA-9613829", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9613829" } ], "reference": [ { "type": "PubMed", "id": "9151685", "url": "https://glygen.org/publication/PubMed/9151685" } ] }, { "title": "Domain-specific phosphorylation of vimentin and glial fibrillary acidic protein by PKN.", "journal": "Biochem. Biophys. Res. Commun.", "date": "1997", "authors": "Matsuzawa K, Kosako H, Inagaki N, Shibata H, Mukai H, Ono Y, Amano M, Kaibuchi K, Matsuura Y, Azuma I, Inagaki M", "evidence": [ { "database": "UniProtKB", "id": "P08670", "url": "https://www.uniprot.org/uniprot/P08670" } ], "reference": [ { "type": "PubMed", "id": "9175763", "url": "https://glygen.org/publication/PubMed/9175763" } ] }, { "title": "Caspase-3-generated fragment of gelsolin: effector of morphological change in apoptosis.", "journal": "Science (New York, N.Y.)", "date": "1997", "authors": "Kothakota S, Azuma T, Reinhard C, Klippel A, Tang J, Chu K, McGarry TJ, Kirschner MW, Koths K, Kwiatkowski DJ, Williams LT", "evidence": [ { "database": "Reactome", "id": "R-HSA-264870", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-264870" } ], "reference": [ { "type": "PubMed", "id": "9323209", "url": "https://glygen.org/publication/PubMed/9323209" } ] }, { "title": "Role of the pyrrolidine ring of proline in determining the substrate specificity of cdc2 kinase or cdk5.", "journal": "Journal of biochemistry", "date": "1997", "authors": "Ando S, Ikuhara T, Kamata T, Sasaki Y, Hisanaga S, Kishimoto T, Ito H, Inagaki M", "evidence": [ { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" } ], "reference": [ { "type": "PubMed", "id": "9378721", "url": "https://glygen.org/publication/PubMed/9378721" } ] }, { "title": "Phosphorylation of vimentin by Rho-associated kinase at a unique amino-terminal site that is specifically phosphorylated during cytokinesis.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Goto H, Kosako H, Tanabe K, Yanagida M, Sakurai M, Amano M, Kaibuchi K, Inagaki M", "evidence": [ { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" } ], "reference": [ { "type": "PubMed", "id": "9565595", "url": "https://glygen.org/publication/PubMed/9565595" } ] }, { "title": "Caspase-3 is required for alpha-fodrin cleavage but dispensable for cleavage of other death substrates in apoptosis.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Janicke RU, Ng P, Sprengart ML, Porter AG", "evidence": [ { "database": "Reactome", "id": "R-HSA-264870", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-264870" } ], "reference": [ { "type": "PubMed", "id": "9624143", "url": "https://glygen.org/publication/PubMed/9624143" } ] }, { "title": "Mutational analysis of the STAT6 SH2 domain.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Mikita T, Daniel C, Wu P, Schindler U", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "9651359", "url": "https://glygen.org/publication/PubMed/9651359" } ] }, { "title": "The role of IL-13 and its receptor in allergy and inflammatory responses.", "journal": "The Journal of allergy and clinical immunology", "date": "1998", "authors": "de Vries JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "9723655", "url": "https://glygen.org/publication/PubMed/9723655" } ] }, { "title": "Interferon-gamma-induced factor binding to the interleukin-4-responsive element of CD23b promoter in human tonsillar mononuclear cells: role in transient up-regulation of the interleukin-4-induced CD23b mRNA.", "journal": "Molecular immunology", "date": "1998", "authors": "Park HJ, So EY, Lee CE", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "9736340", "url": "https://glygen.org/publication/PubMed/9736340" } ] }, { "title": "Soluble VCAM-1 induces chemotaxis of Jurkat and synovial fluid T cells bearing high affinity very late antigen-4.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1998", "authors": "Kitani A, Nakashima N, Izumihara T, Inagaki M, Baoui X, Yu S, Matsuda T, Matsuyama T", "evidence": [ { "database": "iPTMnet", "id": "P08670", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08670" } ], "reference": [ { "type": "PubMed", "id": "9794428", "url": "https://glygen.org/publication/PubMed/9794428" } ] }, { "title": "Induction of 15-lipoxygenase expression by IL-13 requires tyrosine phosphorylation of Jak2 and Tyk2 in human monocytes.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Roy B, Cathcart MK", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "9822675", "url": "https://glygen.org/publication/PubMed/9822675" } ] }, { "title": "Aggresomes: a cellular response to misfolded proteins.", "journal": "The Journal of cell biology", "date": "1998", "authors": "Johnston JA, Ward CL, Kopito RR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9646399", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9646399" } ], "reference": [ { "type": "PubMed", "id": "9864362", "url": "https://glygen.org/publication/PubMed/9864362" } ] }, { "title": "STAT3 is required for the gp130-mediated full activation of the c-myc gene.", "journal": "The Journal of experimental medicine", "date": "1999", "authors": "Kiuchi N, Nakajima K, Ichiba M, Fukada T, Narimatsu M, Mizuno K, Hibi M, Hirano T", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "9874564", "url": "https://glygen.org/publication/PubMed/9874564" } ] }, { "title": "Caspase-3-induced gelsolin fragmentation contributes to actin cytoskeletal collapse, nucleolysis, and apoptosis of vascular smooth muscle cells exposed to proinflammatory cytokines.", "journal": "European journal of cell biology", "date": "1998", "authors": "Geng YJ, Azuma T, Tang JX, Hartwig JH, Muszynski M, Wu Q, Libby P, Kwiatkowski DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-264870", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-264870" } ], "reference": [ { "type": "PubMed", "id": "9930654", "url": "https://glygen.org/publication/PubMed/9930654" } ] } ], "pathway": [ { "id": "hsa:7431", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:7431", "resource": "KEGG Pathway" }, { "id": "R-HSA-264870", "name": "Caspase-mediated cleavage of cytoskeletal proteins", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-264870", "resource": "Reactome", "description": "Caspase-mediated cleavage of cytoskeletal proteins" }, { "id": "R-HSA-390522", "name": "Striated Muscle Contraction", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-390522", "resource": "Reactome", "description": "Striated Muscle Contraction" }, { "id": "R-HSA-6785807", "name": "Interleukin-4 and Interleukin-13 signaling", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807", "resource": "Reactome", "description": "Interleukin-4 and Interleukin-13 signaling" }, { "id": "R-HSA-9013422", "name": "RHOBTB1 GTPase cycle", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013422", "resource": "Reactome", "description": "RHOBTB1 GTPase cycle" }, { "id": "R-HSA-9613829", "name": "Chaperone Mediated Autophagy", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9613829", "resource": "Reactome", "description": "Chaperone Mediated Autophagy" }, { "id": "R-HSA-9615710", "name": "Late endosomal microautophagy", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9615710", "resource": "Reactome", "description": "Late endosomal microautophagy" }, { "id": "R-HSA-9646399", "name": "Aggrephagy", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9646399", "resource": "Reactome", "description": "Aggrephagy" } ], "orthologs": [ { "uniprot_canonical_ac": "P20152-1", "protein_name": "Vimentin", "gene_name": "Vim", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MSTRSVSSSSYRRMFGGSGTSSRPSSNRSYVTTSTRTYSLGSALRPSTSRSLYSSSPGGAYVTRSSAVRLRSSVPGVRLLQDSVDFSLADAINTEFKNTRTNEKVELQELNDRFANYIDKVRFLEQQNKILLAELEQLKGQGKSRLGDLYEEEMRELRRQVDQLTNDKARVEVERDNLAEDIMRLREKLQEEMLQREEAESTLQSFRQDVDNASLARLDLERKVESLQEEIAFLKKLHDEEIQELQAQIQEQHVQIDVDVSKPDLTAALRDVRQQYESVAAKNLQEAEEWYKSKFADLSEAANRNNDALRQAKQESNEYRRQVQSLTCEVDALKGTNESLERQMREMEENFALEAANYQDTIGRLQDEIQNMKEEMARHLREYQDLLNVKMALDIEIATYRKLLEGEESRISLPLPTFSSLNLRETNLESLPLVDTHSKRTLLIKTVETRDGQVINETSQHHDDLE", "length": 466 }, "evidence": [ { "id": "45917393", "url": "http://www.informatics.jax.org/homology/45917393", "database": "MGI" }, { "id": "P08670", "url": "https://omabrowser.org/oma/group/P08670/", "database": "OMA" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "P31000-1", "protein_name": "Vimentin", "gene_name": "Vim", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MSTRSVSSSSYRRMFGGSGTSSRPSSNRSYVTTSTRTYSLGSALRPSTSRSLYSSSPGGAYVTRSSAVRLRSSMPGVRLLQDSVDFSLADAINTEFKNTRTNEKVELQELNDRFANYIDKVRFLEQQNKILLAELEQLKGQGKSRLGDLYEEEMRELRRQVDQLTNDKARVEVERDNLAEDIMRLREKLQEEMLQREEAESTLQSFRQDVDNASLARLDLERKVESLQEEIAFLKKLHDEEIQELQAQIQEQHVQIDVDVSKPDLTAALRDVRQQYESVAAKNLQEAEEWYKSKFADLSEAANRNNDALRQAKQESNEYRRQVQSLTCEVDALKGTNESLERQMREMEENFALEAANYQDTIGRLQDEIQNMKEEMARHLREYQDLLNVKMALDIEIATYRKLLEGEESRISLPLPNFSSLNLRETNLESLPLVDTHSKRTLLIKTVETRDGQVINETSQHHDDLE", "length": 466 }, "evidence": [ { "id": "45917393", "url": "http://www.informatics.jax.org/homology/45917393", "database": "MGI" } ], "common_name": "Rat" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 16, "go_terms": [ { "name": "intermediate filament", "id": "GO:0005882", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005882", "evidence": [ { "database": "UniProtKB", "id": "P08670", "url": "https://www.uniprot.org/uniprot/P08670" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "P08670", "url": "https://www.uniprot.org/uniprot/P08670" } ], "pmid": "" }, { "name": "peroxisome", "id": "GO:0005777", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005777", "evidence": [ { "database": "UniProtKB", "id": "P08670", "url": "https://www.uniprot.org/uniprot/P08670" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "P08670", "url": "https://www.uniprot.org/uniprot/P08670" } ], "pmid": "" }, { "name": "cytoskeleton", "id": "GO:0005856", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005856", "evidence": [ { "database": "UniProtKB", "id": "P08670", "url": "https://www.uniprot.org/uniprot/P08670" } ], "pmid": "" }, { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "P08670", "url": "https://www.uniprot.org/uniprot/P08670" } ], "pmid": "" }, { "name": "focal adhesion", "id": "GO:0005925", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005925", "evidence": [ { "database": "UniProtKB", "id": "P08670", "url": "https://www.uniprot.org/uniprot/P08670" } ], "pmid": "" }, { "name": "axon", "id": "GO:0030424", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030424", "evidence": [ { "database": "UniProtKB", "id": "P08670", "url": "https://www.uniprot.org/uniprot/P08670" } ], "pmid": "" }, { "name": "cell leading edge", "id": "GO:0031252", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031252", "evidence": [ { "database": "UniProtKB", "id": "P08670", "url": "https://www.uniprot.org/uniprot/P08670" } ], "pmid": "" }, { "name": "extracellular exosome", "id": "GO:0070062", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070062", "evidence": [ { "database": "UniProtKB", "id": "P08670", "url": "https://www.uniprot.org/uniprot/P08670" } ], "pmid": "" }, { "name": "microtubule organizing center", "id": "GO:0005815", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005815", "evidence": [ { "database": "UniProtKB", "id": "P08670", "url": "https://www.uniprot.org/uniprot/P08670" } ], "pmid": "" }, { "name": "nuclear matrix", "id": "GO:0016363", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016363", "evidence": [ { "database": "UniProtKB", "id": "P08670", "url": "https://www.uniprot.org/uniprot/P08670" } ], "pmid": "" }, { "name": "phagocytic vesicle", "id": "GO:0045335", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045335", "evidence": [ { "database": "UniProtKB", "id": "P08670", "url": "https://www.uniprot.org/uniprot/P08670" } ], "pmid": "" }, { "name": "intermediate filament cytoskeleton", "id": "GO:0045111", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045111", "evidence": [ { "database": "UniProtKB", "id": "P08670", "url": "https://www.uniprot.org/uniprot/P08670" } ], "pmid": "" }, { "name": "polysome", "id": "GO:0005844", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005844", "evidence": [ { "database": "UniProtKB", "id": "P08670", "url": "https://www.uniprot.org/uniprot/P08670" } ], "pmid": "" }, { "name": "ribonucleoprotein complex", "id": "GO:1990904", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1990904", "evidence": [ { "database": "UniProtKB", "id": "P08670", "url": "https://www.uniprot.org/uniprot/P08670" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 8, "go_terms": [ { "name": "keratin filament binding", "id": "GO:1990254", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1990254", "evidence": [ { "database": "UniProtKB", "id": "P08670", "url": "https://www.uniprot.org/uniprot/P08670" } ], "pmid": "" }, { "name": "molecular adaptor activity", "id": "GO:0060090", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060090", "evidence": [ { "database": "UniProtKB", "id": "P08670", "url": "https://www.uniprot.org/uniprot/P08670" } ], "pmid": "" }, { "name": "structural constituent of cytoskeleton", "id": "GO:0005200", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005200", "evidence": [ { "database": "UniProtKB", "id": "P08670", "url": "https://www.uniprot.org/uniprot/P08670" } ], "pmid": "" }, { "name": "protein domain specific binding", "id": "GO:0019904", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019904", "evidence": [ { "database": "UniProtKB", "id": "P08670", "url": "https://www.uniprot.org/uniprot/P08670" } ], "pmid": "" }, { "name": "identical protein binding", "id": "GO:0042802", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042802", "evidence": [ { "database": "UniProtKB", "id": "P08670", "url": "https://www.uniprot.org/uniprot/P08670" } ], "pmid": "" }, { "name": "double-stranded RNA binding", "id": "GO:0003725", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003725", "evidence": [ { "database": "UniProtKB", "id": "P08670", "url": "https://www.uniprot.org/uniprot/P08670" } ], "pmid": "" }, { "name": "scaffold protein binding", "id": "GO:0097110", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0097110", "evidence": [ { "database": "UniProtKB", "id": "P08670", "url": "https://www.uniprot.org/uniprot/P08670" } ], "pmid": "" }, { "name": "structural constituent of eye lens", "id": "GO:0005212", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005212", "evidence": [ { "database": "UniProtKB", "id": "P08670", "url": "https://www.uniprot.org/uniprot/P08670" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 13, "go_terms": [ { "name": "neuron projection development", "id": "GO:0031175", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031175", "evidence": [ { "database": "UniProtKB", "id": "P08670", "url": "https://www.uniprot.org/uniprot/P08670" } ], "pmid": "" }, { "name": "regulation of mRNA stability", "id": "GO:0043488", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043488", "evidence": [ { "database": "UniProtKB", "id": "P08670", "url": "https://www.uniprot.org/uniprot/P08670" } ], "pmid": "" }, { "name": "negative regulation of neuron projection development", "id": "GO:0010977", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010977", "evidence": [ { "database": "UniProtKB", "id": "P08670", "url": "https://www.uniprot.org/uniprot/P08670" } ], "pmid": "" }, { "name": "cellular response to lipopolysaccharide", "id": "GO:0071222", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071222", "evidence": [ { "database": "UniProtKB", "id": "P08670", "url": "https://www.uniprot.org/uniprot/P08670" } ], "pmid": "" }, { "name": "positive regulation of collagen biosynthetic process", "id": "GO:0032967", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032967", "evidence": [ { "database": "UniProtKB", "id": "P08670", "url": "https://www.uniprot.org/uniprot/P08670" } ], "pmid": "" }, { "name": "Bergmann glial cell differentiation", "id": "GO:0060020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060020", "evidence": [ { "database": "UniProtKB", "id": "P08670", "url": "https://www.uniprot.org/uniprot/P08670" } ], "pmid": "" }, { "name": "SMAD protein signal transduction", "id": "GO:0060395", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060395", "evidence": [ { "database": "UniProtKB", "id": "P08670", "url": "https://www.uniprot.org/uniprot/P08670" } ], "pmid": "" }, { "name": "positive regulation of translation", "id": "GO:0045727", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045727", "evidence": [ { "database": "UniProtKB", "id": "P08670", "url": "https://www.uniprot.org/uniprot/P08670" } ], "pmid": "" }, { "name": "intermediate filament organization", "id": "GO:0045109", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045109", "evidence": [ { "database": "UniProtKB", "id": "P08670", "url": "https://www.uniprot.org/uniprot/P08670" } ], "pmid": "" }, { "name": "cellular response to type II interferon", "id": "GO:0071346", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071346", "evidence": [ { "database": "UniProtKB", "id": "P08670", "url": "https://www.uniprot.org/uniprot/P08670" } ], "pmid": "" }, { "name": "cellular response to muramyl dipeptide", "id": "GO:0071225", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071225", "evidence": [ { "database": "UniProtKB", "id": "P08670", "url": "https://www.uniprot.org/uniprot/P08670" } ], "pmid": "" }, { "name": "astrocyte development", "id": "GO:0014002", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0014002", "evidence": [ { "database": "UniProtKB", "id": "P08670", "url": "https://www.uniprot.org/uniprot/P08670" } ], "pmid": "" }, { "name": "lens fiber cell development", "id": "GO:0070307", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070307", "evidence": [ { "database": "UniProtKB", "id": "P08670", "url": "https://www.uniprot.org/uniprot/P08670" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 212, "end_pos": 214, "annotation": "n_glycosylation_sequon" }, { "start_pos": 337, "end_pos": 339, "annotation": "n_glycosylation_sequon" }, { "start_pos": 417, "end_pos": 419, "annotation": "n_glycosylation_sequon" }, { "start_pos": 456, "end_pos": 458, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "Filament disassembly during mitosis is promoted by phosphorylation at Ser-55 as well as by nestin (By similarity). One of the most prominent phosphoproteins in various cells of mesenchymal origin. Phosphorylation is enhanced during cell division, at which time vimentin filaments are significantly reorganized. Phosphorylation by PKN1 inhibits the formation of filaments. Phosphorylated at Ser-56 by CDK5 during neutrophil secretion in the cytoplasm (PubMed:21465480). Phosphorylated by STK33 (PubMed:18811945). Phosphorylated on tyrosine residues by SRMS (PubMed:29496907).", "evidence": [ { "database": "UniProtKB", "id": "P08670", "url": "https://www.uniprot.org/uniprot/P08670" }, { "database": "PubMed", "id": "21465480", "url": "https://glygen.org/publication/PubMed/21465480" }, { "database": "PubMed", "id": "18811945", "url": "https://glygen.org/publication/PubMed/18811945" }, { "database": "PubMed", "id": "29496907", "url": "https://glygen.org/publication/PubMed/29496907" } ] }, { "annotation": "O-glycosylated during cytokinesis at sites identical or close to phosphorylation sites, this interferes with the phosphorylation status.", "evidence": [ { "database": "UniProtKB", "id": "P08670", "url": "https://www.uniprot.org/uniprot/P08670" }, { "database": "PubMed", "id": "20068230", "url": "https://glygen.org/publication/PubMed/20068230" } ] }, { "annotation": "S-nitrosylation is induced by interferon-gamma and oxidatively-modified low-densitity lipoprotein (LDL(ox)) possibly implicating the iNOS-S100A8/9 transnitrosylase complex.", "evidence": [ { "database": "UniProtKB", "id": "P08670", "url": "https://www.uniprot.org/uniprot/P08670" }, { "database": "PubMed", "id": "25417112", "url": "https://glygen.org/publication/PubMed/25417112" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [ 5, 7, 20, 22, 25, 26, 27, 29, 32, 33, 34, 35, 37, 39, 47, 48, 49, 51, 55, 56, 63, 94, 214, 327, 419, 420, 458 ], "snv_sites": [ 20, 22, 25, 27, 33, 35, 47, 48, 49, 51, 55, 56, 85, 94, 130, 179, 308, 352, 390, 420, 444, 458 ], "glycation_sites": [], "phosphorylation_sites": [ 2, 5, 7, 8, 9, 10, 20, 22, 25, 26, 27, 29, 30, 32, 33, 34, 38, 39, 42, 47, 48, 49, 51, 53, 55, 56, 61, 65, 66, 72, 73, 83, 87, 99, 117, 144, 205, 214, 226, 261, 266, 299, 325, 327, 400, 409, 412, 419, 420, 426, 430, 436, 438, 446, 458, 459 ], "sequon_annotation_sites": [ { "start_pos": 212, "end_pos": 214 }, { "start_pos": 337, "end_pos": 339 }, { "start_pos": 417, "end_pos": 419 }, { "start_pos": 456, "end_pos": 458 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 34 }, { "field": "total_sites", "count": 27 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 2 }, { "field": "o_linked_glycan_sites", "count": 30 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 3 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 31 }, { "field": "total_sites", "count": 27 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 2 }, { "field": "o_linked_glycan_sites", "count": 27 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 103 }, { "field": "total_sites", "count": 56 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 33 }, { "field": "total_sites", "count": 22 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 6 }, { "field": "total_sites", "count": 6 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 27 }, { "field": "total_sites", "count": 19 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 286 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }