{ "uniprot_canonical_ac": "P08571-1", "uniprot_ac": "P08571", "uniprot_id": "CD14_HUMAN", "mass": { "chemical_mass": 40076.0, "monoisotopic_mass": 40076.0 }, "refseq": { "ac": "NP_000582", "name": "monocyte differentiation antigen CD14 precursor", "summary": "The protein encoded by this gene is a surface antigen that is preferentially expressed on monocytes/macrophages. It cooperates with other proteins to mediate the innate immune response to bacterial lipopolysaccharide, and to viruses. This gene has been identified as a target candidate in the treatment of SARS-CoV-2-infected patients to potentially lessen or inhibit a severe inflammatory response. Alternative splicing results in multiple transcript variants encoding the same protein. [provided by RefSeq, Aug 2020].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000582" }, "gene_names": [ { "name": "CD14", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P08571", "id": "P08571" }, { "name": "CD14", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000582", "id": "NP_000582" } ], "protein_names": [ { "name": "Monocyte differentiation antigen CD14", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P08571" }, { "name": "Myeloid cell-specific leucine-rich glycoprotein", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P08571" }, { "name": "monocyte differentiation antigen CD14 precursor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000582", "id": "NP_000582" }, { "name": "monocyte differentiation antigen CD14; myeloid cell-specific leucine-rich glycoprotein", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000582", "id": "NP_000582" } ], "function": [ { "annotation": "Coreceptor for bacterial lipopolysaccharide (PubMed:1698311, PubMed:23264655). In concert with LBP, binds to monomeric lipopolysaccharide and delivers it to the LY96/TLR4 complex, thereby mediating the innate immune response to bacterial lipopolysaccharide (LPS) (PubMed:20133493, PubMed:23264655, PubMed:22265692). Acts via MyD88, TIRAP and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response (PubMed:8612135). Acts as a coreceptor for TLR2:TLR6 heterodimer in response to diacylated lipopeptides and for TLR2:TLR1 heterodimer in response to triacylated lipopeptides, these clusters trigger signaling from the cell surface and subsequently are targeted to the Golgi in a lipid-raft dependent pathway (PubMed:16880211). Binds electronegative LDL (LDL(-)) and mediates the cytokine release induced by LDL(-) (PubMed:23880187).", "evidence": [ { "database": "UniProtKB", "id": "P08571", "url": "https://www.uniprot.org/uniprot/P08571#function" }, { "database": "PubMed", "id": "1698311", "url": "https://glygen.org/publication/PubMed/1698311" }, { "database": "PubMed", "id": "23880187", "url": "https://glygen.org/publication/PubMed/23880187" }, { "database": "PubMed", "id": "23264655", "url": "https://glygen.org/publication/PubMed/23264655" }, { "database": "PubMed", "id": "20133493", "url": "https://glygen.org/publication/PubMed/20133493" }, { "database": "PubMed", "id": "16880211", "url": "https://glygen.org/publication/PubMed/16880211" }, { "database": "PubMed", "id": "22265692", "url": "https://glygen.org/publication/PubMed/22265692" }, { "database": "PubMed", "id": "8612135", "url": "https://glygen.org/publication/PubMed/8612135" } ] }, { "annotation": "Decreased expression of TIGIT on CD14 + monocytes correlates with clinical features and laboratory parameters of patients with primary Sjogren's syndrome.", "evidence": [ { "database": "RefSeq", "id": "NP_000582", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000582" }, { "database": "PubMed", "id": "37749409", "url": "https://glygen.org/publication/PubMed/37749409" } ] }, { "annotation": "Increased circulating levels of MIP-1alpha and CD14 are associated with the presence of severe stenosis and hypoechoic plaques in patients with carotid atherosclerosis.", "evidence": [ { "database": "RefSeq", "id": "NP_000582", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000582" }, { "database": "PubMed", "id": "37478026", "url": "https://glygen.org/publication/PubMed/37478026" } ] }, { "annotation": "Multifaceted role of CD14 in innate immunity and tissue homeostasis. Review article", "evidence": [ { "database": "RefSeq", "id": "NP_000582", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000582" }, { "database": "PubMed", "id": "37661484", "url": "https://glygen.org/publication/PubMed/37661484" } ] }, { "annotation": "Severity of Schistosoma haematobium co-infection with malaria in school-children is potentially modulated by host CD14 gene variants. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_000582", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000582" }, { "database": "PubMed", "id": "37684680", "url": "https://glygen.org/publication/PubMed/37684680" } ] }, { "annotation": "The protein encoded by this gene is a surface antigen that is preferentially expressed on monocytes/macrophages. It cooperates with other proteins to mediate the innate immune response to bacterial lipopolysaccharide, and to viruses. This gene has been identified as a target candidate in the treatment of SARS-CoV-2-infected patients to potentially lessen or inhibit a severe inflammatory response. Alternative splicing results in multiple transcript variants encoding the same protein. [provided by RefSeq, Aug 2020].", "evidence": [ { "database": "RefSeq", "id": "NP_000582", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000582" } ] }, { "annotation": "The role of CD14 and CSF1R in osteoarthritis and gastritis.", "evidence": [ { "database": "RefSeq", "id": "NP_000582", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000582" }, { "database": "PubMed", "id": "37904379", "url": "https://glygen.org/publication/PubMed/37904379" } ] } ], "disease": [], "snv": [ { "evidence": [ { "id": "rs201079641", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs201079641" }, { "id": "rs201079641", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs201079641" }, { "id": "rs201079641", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs201079641" }, { "id": "rs201079641", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs201079641" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 153, "end_pos": 153, "sequence_org": "S", "sequence_mut": "*", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVS->NV*).", "chr_id": "5", "chr_pos": "140632526", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "0.0002", "site_lbl": "S153", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs201079641", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs201079641" }, { "id": "rs201079641", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs201079641" }, { "id": "rs201079641", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs201079641" }, { "id": "rs201079641", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs201079641" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 153, "end_pos": 153, "sequence_org": "S", "sequence_mut": "L", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVS->NVL).", "chr_id": "5", "chr_pos": "140632526", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "0.0002", "site_lbl": "S153", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1428254886", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1428254886" }, { "id": "rs1428254886", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1428254886#frequency_tab" }, { "id": "rs1428254886", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1428254886" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 153, "end_pos": 153, "sequence_org": "S", "sequence_mut": "P", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVS->NVP).", "chr_id": "5", "chr_pos": "140632527", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S153", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P08571", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P08571" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 267, "end_pos": 267, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "P", "sequence_mut": "H", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (NPS->NHS).", "chr_id": "5", "chr_pos": "140632184", "ref_nt": "G", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "P267", "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs1335535803", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1335535803" }, { "id": "rs1335535803", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1335535803#frequency_tab" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 267, "end_pos": 267, "sequence_org": "P", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NPS->NSS).", "chr_id": "5", "chr_pos": "140632185", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "P267", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P08571", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P08571" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 282, "end_pos": 282, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "N", "sequence_mut": "H", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NLS->HLS).", "chr_id": "5", "chr_pos": "140632140", "ref_nt": "T", "alt_nt": "G", "minor_allelic_frequency": "", "site_lbl": "N282", "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs1340779935", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1340779935" }, { "id": "rs1340779935", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1340779935#frequency_tab" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 282, "end_pos": 282, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLS->KLS).", "chr_id": "5", "chr_pos": "140632138", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N282", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P08571", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P08571" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 284, "end_pos": 284, "subjects_tested": "412", "subjects_positive": "1", "frequency": "0.2", "sequence_org": "S", "sequence_mut": "*", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NLS->NL*).", "chr_id": "5", "chr_pos": "140632133", "ref_nt": "G", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "S284", "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "P08571", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P08571" }, { "id": "rs771360803", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs771360803" }, { "id": "rs771360803", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs771360803" }, { "id": "rs771360803", "database": "NCI-TCGA", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs771360803" }, { "id": "rs771360803", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs771360803" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 284, "end_pos": 284, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "S", "sequence_mut": "L", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NLS->NLL).", "chr_id": "5", "chr_pos": "140632133", "ref_nt": "G", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "S284", "disease": [ { "disease_id": "DOID:4159", "recommended_name": { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "skin cancer", "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells." }, "synonyms": [ { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "CA - skin cancer", "description": "" }, { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "malignant neoplasm of skin", "description": "" }, { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "melanoma and Non-melanoma skin cancer", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease", "ebi", "germline" ] }, { "evidence": [ { "id": "P08571", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P08571" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 303, "end_pos": 303, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "D", "sequence_mut": "N", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (DLS->NLS).", "chr_id": "5", "chr_pos": "140632077", "ref_nt": "C", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "D303", "disease": [ { "disease_id": "DOID:1793", "recommended_name": { "id": "DOID:1793", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1793", "name": "pancreatic cancer", "description": "An endocrine gland cancer located_in the pancreas." }, "synonyms": [ { "id": "DOID:1793", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1793", "name": "Ca body of pancreas", "description": "" }, { "id": "DOID:1793", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1793", "name": "Ca head of pancreas", "description": "" }, { "id": "DOID:1793", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1793", "name": "Ca tail of pancreas", "description": "" }, { "id": "DOID:1793", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1793", "name": "malignant neoplasm of body of pancreas", "description": "" }, { "id": "DOID:1793", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1793", "name": "malignant neoplasm of head of pancreas", "description": "" }, { "id": "DOID:1793", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1793", "name": "malignant neoplasm of tail of pancreas", "description": "" }, { "id": "DOID:1793", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1793", "name": "pancreas neoplasm", "description": "" }, { "id": "DOID:1793", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1793", "name": "pancreatic neoplasm", "description": "" }, { "id": "DOID:1793", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1793", "name": "pancreatic tumor", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs1422855101", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1422855101" }, { "id": "rs1422855101", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1422855101" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 325, "end_pos": 325, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->NLI).", "chr_id": "5", "chr_pos": "140632010", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T325", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1303071864", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1303071864" }, { "id": "rs1303071864", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1303071864#frequency_tab" }, { "id": "rs1303071864", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1303071864" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 347, "end_pos": 347, "sequence_org": "G", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NSG->NSS).", "chr_id": "5", "chr_pos": "140631945", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "G347", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P08571", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P08571" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 364, "end_pos": 364, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "T", "sequence_mut": "I", "comment": "Somatic mutation passed 1 out of 6 filters: o-glyco-site-loss (T->I).", "chr_id": "5", "chr_pos": "140631893", "ref_nt": "G", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "T364", "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs373361139", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs373361139" }, { "id": "rs373361139", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs373361139" }, { "id": "rs373361139", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs373361139#frequency_tab" }, { "id": "rs373361139", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs373361139" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 37, "end_pos": 37, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NFS->DFS).", "chr_id": "5", "chr_pos": "140632875", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N37", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs763753720", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs763753720" }, { "id": "rs763753720", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs763753720" }, { "id": "rs763753720", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs763753720" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 37, "end_pos": 37, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NFS->KFS).", "chr_id": "5", "chr_pos": "140632873", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N37", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1260368078", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1260368078" }, { "id": "rs1260368078", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1260368078" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 39, "end_pos": 39, "sequence_org": "S", "sequence_mut": "C", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NFS->NFC).", "chr_id": "5", "chr_pos": "140632868", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S39", "keywords": [ "ebi", "germline" ] } ], "mutagenesis": [], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "77.21", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000170458", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000170458" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "84.26", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000170458", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000170458" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "87.67", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000170458", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000170458" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "76.93", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000170458", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000170458" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "98.2", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000170458", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000170458" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "94.03", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000170458", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000170458" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "79.84", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000170458", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000170458" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "88.11", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000170458", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000170458" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "86.14", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000170458", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000170458" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "94.59", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000170458", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000170458" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "98.08", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000170458", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000170458" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "83.21", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000170458", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000170458" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "91.03", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000170458", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000170458" } ] } ], "expression_disease": [ { "significant": "No", "trend": "down", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "P08571", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P08571" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "No", "trend": "up", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "P08571", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P08571" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "P08571", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P08571" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "No", "trend": "down", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "P08571", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P08571" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "P08571", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P08571" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "P08571", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P08571" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "P08571", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P08571" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "P08571", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P08571" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "P08571", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P08571" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "P08571", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P08571" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "P08571", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P08571" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "P08571", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P08571" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P08571", "url": "https://www.uniprot.org/uniprot/P08571" } ], "common_name": "Human" } ], "gene": [ { "name": "CD14", "url": "https://www.uniprot.org/uniprot/P08571", "locus": { "chromosome": "5", "start_pos": 140631728, "end_pos": 140633700, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000170458", "url": "https://www.ensembl.org/id/ENSG00000170458" } ] } } ], "crossref": [ { "id": "ENSG00000170458", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000170458", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "P08571", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P08571", "database": "BioMuta", "categories": [ "Variation" ] }, { "id": "CHEMBL2384897", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL2384897", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "CD14", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=CD14", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "929", "url": "https://www.ncbi.nlm.nih.gov/gene/929", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "774", "url": "https://glyconnect.expasy.org/browser/proteins/774", "database": "GlyConnect", "categories": [ "Glycoproteomics", "Glycan" ] }, { "id": "1628", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=1628", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "P08571", "url": "https://www.ebi.ac.uk/intact/interactors/id:P08571*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR001611", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001611", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR016337", "url": "https://www.ebi.ac.uk/interpro/entry/IPR016337", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR032675", "url": "https://www.ebi.ac.uk/interpro/entry/IPR032675", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:929", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:929", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "158120", "url": "http://www.omim.org/entry/158120", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_P08571", "url": "https://www.nextprot.org/entry/NX_P08571", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "SSSCQWP", "url": "https://omabrowser.org/oma/group/SSSCQWP/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5257257at2759", "url": "http://www.orthodb.org/?query=5257257at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR10630", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10630", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR10630:SF3", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10630:SF3", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "4GLP", "url": "https://www.rcsb.org/structure/4GLP", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF13516", "url": "http://pfam.xfam.org/family/PF13516", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "P08571", "url": "https://pharos.nih.gov/targets/P08571", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR:000054476", "url": "https://proconsortium.org/app/entry/PR:000054476", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054477", "url": "https://proconsortium.org/app/entry/PR:000054477", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054478", "url": "https://proconsortium.org/app/entry/PR:000054478", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054479", "url": "https://proconsortium.org/app/entry/PR:000054479", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054480", "url": "https://proconsortium.org/app/entry/PR:000054480", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054481", "url": "https://proconsortium.org/app/entry/PR:000054481", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR_P08571", "url": "http://purl.obolibrary.org/obo/PR_P08571", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-1236974", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1236974", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-140534", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140534", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-166016", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166016", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-166020", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166020", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-166058", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166058", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-166166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166166", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-168179", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-168179", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-168188", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-168188", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-2562578", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2562578", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-5602498", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5602498", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-5603041", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5603041", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-5686938", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5686938", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-6798695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6798695", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-936964", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-936964", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-937041", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-937041", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-937072", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-937072", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-975163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975163", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9820960", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9820960", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9833110", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833110", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_000582", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000582", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "P08571", "url": "DISABLED", "database": "UniCarbKB", "categories": [ "Glycoproteomics" ] }, { "id": "D6RD81", "url": "https://www.uniprot.org/uniprot/D6RD81", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "D6RD81-1", "url": "https://www.uniprot.org/uniprot/D6RD81-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "D6RFL4", "url": "https://www.uniprot.org/uniprot/D6RFL4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "D6RFL4-1", "url": "https://www.uniprot.org/uniprot/D6RFL4-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E7EVL5", "url": "https://www.uniprot.org/uniprot/E7EVL5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E7EVL5-1", "url": "https://www.uniprot.org/uniprot/E7EVL5-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P08571", "url": "https://www.uniprot.org/uniprot/P08571", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P08571-1", "url": "https://www.uniprot.org/uniprot/P08571-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MERASCLLLLLLPLVHVSATTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLKPGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSDNPGLGERGLMAALCPHKFPAIQNLALRNTGMETPTGVCAALAAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLRVLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSMNSGVVPACARSTLSVGVSGTLVLLQGARGFA", "length": 375, "header": "sp|P08571-1|CD14_HUMAN Isoform 1 of Monocyte differentiation antigen CD14 OS=Homo sapiens OX=9606 GN=CD14 PE=1 SV=2 CANONICAL=P08571-1" }, "isoforms": [ { "isoform_ac": "D6RD81-1", "url": "", "sequence": { "sequence": "MERASCLLLLLLPLVHVSATTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAV", "length": 55, "header": "tr|D6RD81-1|D6RD81_HUMAN Computationally mapped isoform of Monocyte differentiation antigen CD14 OS=Homo sapiens OX=9606 GN=CD14 PE=4 SV=1 CANONICAL=P08571-1" }, "locus": { "chromosome": "5", "start_pos": 140633071, "end_pos": 140631859, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000512545.1", "url": "https://www.ensembl.org/id/ENST00000512545.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000425447.1", "url": "https://www.ensembl.org/id/ENSP00000425447.1" } ] } }, { "isoform_ac": "D6RFL4-1", "url": "", "sequence": { "sequence": "MERASCLLLLLLPLVHVSATTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLKPGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSDNPGLGERGLM", "length": 213, "header": "tr|D6RFL4-1|D6RFL4_HUMAN Computationally mapped isoform of Monocyte differentiation antigen CD14 OS=Homo sapiens OX=9606 GN=CD14 PE=1 SV=1 CANONICAL=P08571-1" }, "locus": { "chromosome": "5", "start_pos": 140633071, "end_pos": 140631859, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000498971.6", "url": "https://www.ensembl.org/id/ENST00000498971.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000426543.1", "url": "https://www.ensembl.org/id/ENSP00000426543.1" } ] } }, { "isoform_ac": "E7EVL5-1", "url": "", "sequence": { "sequence": "MERASCLLLLLLPLVHVSATTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADADPRQ", "length": 81, "header": "tr|E7EVL5-1|E7EVL5_HUMAN Computationally mapped isoform of Monocyte differentiation antigen CD14 OS=Homo sapiens OX=9606 GN=CD14 PE=1 SV=1 CANONICAL=P08571-1" }, "locus": { "chromosome": "5", "start_pos": 140633071, "end_pos": 140631859, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000519715.1", "url": "https://www.ensembl.org/id/ENST00000519715.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000430884.1", "url": "https://www.ensembl.org/id/ENSP00000430884.1" } ] } }, { "isoform_ac": "P08571-1", "url": "", "sequence": { "sequence": "MERASCLLLLLLPLVHVSATTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLKPGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSDNPGLGERGLMAALCPHKFPAIQNLALRNTGMETPTGVCAALAAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLRVLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSMNSGVVPACARSTLSVGVSGTLVLLQGARGFA", "length": 375, "header": "sp|P08571-1|CD14_HUMAN Isoform 1 of Monocyte differentiation antigen CD14 OS=Homo sapiens OX=9606 GN=CD14 PE=1 SV=2 CANONICAL=P08571-1" }, "locus": { "chromosome": "5", "start_pos": 140633071, "end_pos": 140631859, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000302014.11", "url": "https://www.ensembl.org/id/ENST00000302014.11" }, { "database": "Ensembl Peptide", "id": "ENSP00000304236.6", "url": "https://www.ensembl.org/id/ENSP00000304236.6" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G02402FF", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 151, "start_aa": "Asn", "end_pos": 151, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn151", "evidence": [ { "id": "774", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/774" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G05724UK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 151, "start_aa": "Asn", "end_pos": 151, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn151", "evidence": [ { "id": "774", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/774" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G06110VR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 151, "start_aa": "Asn", "end_pos": 151, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn151", "evidence": [ { "id": "774", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/774" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G06356OH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 151, "start_aa": "Asn", "end_pos": 151, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn151", "evidence": [ { "id": "774", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/774" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G20312EM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 151, "start_aa": "Asn", "end_pos": 151, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn151", "evidence": [ { "id": "774", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/774" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G22140GZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 151, "start_aa": "Asn", "end_pos": 151, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn151", "evidence": [ { "id": "774", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/774" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G23294PN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 151, "start_aa": "Asn", "end_pos": 151, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn151", "evidence": [ { "id": "774", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/774" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G23863VK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 151, "start_aa": "Asn", "end_pos": 151, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn151", "evidence": [ { "id": "774", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/774" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G33609NS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 151, "start_aa": "Asn", "end_pos": 151, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn151", "evidence": [ { "id": "774", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/774" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G37868ZX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 151, "start_aa": "Asn", "end_pos": 151, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn151", "evidence": [ { "id": "774", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/774" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G39188ZX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 151, "start_aa": "Asn", "end_pos": 151, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn151", "evidence": [ { "id": "774", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/774" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G42358LZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 151, "start_aa": "Asn", "end_pos": 151, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn151", "evidence": [ { "id": "774", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/774" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G42962KI", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 151, "start_aa": "Asn", "end_pos": 151, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn151", "evidence": [ { "id": "774", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/774" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G44215PV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 151, "start_aa": "Asn", "end_pos": 151, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn151", "evidence": [ { "id": "774", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/774" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G45495MK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 151, "start_aa": "Asn", "end_pos": 151, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn151", "evidence": [ { "id": "774", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/774" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 151, "start_aa": "Asn", "end_pos": 151, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn151", "evidence": [ { "id": "774", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/774" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G50045TK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 151, "start_aa": "Asn", "end_pos": 151, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn151", "evidence": [ { "id": "774", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/774" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G55220VL", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 151, "start_aa": "Asn", "end_pos": 151, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn151", "evidence": [ { "id": "774", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/774" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G57818FI", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 151, "start_aa": "Asn", "end_pos": 151, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn151", "evidence": [ { "id": "774", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/774" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G59626AS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 151, "start_aa": "Asn", "end_pos": 151, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn151", "evidence": [ { "id": "P08571", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G66538GV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 151, "start_aa": "Asn", "end_pos": 151, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn151", "evidence": [ { "id": "774", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/774" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G72291OX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 151, "start_aa": "Asn", "end_pos": 151, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn151", "evidence": [ { "id": "774", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/774" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G72735IY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 151, "start_aa": "Asn", "end_pos": 151, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn151", "evidence": [ { "id": "774", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/774" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G80966KZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 151, "start_aa": "Asn", "end_pos": 151, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn151", "evidence": [ { "id": "774", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/774" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G82020ZR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 151, "start_aa": "Asn", "end_pos": 151, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn151", "evidence": [ { "id": "774", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/774" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G82463GQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 151, "start_aa": "Asn", "end_pos": 151, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn151", "evidence": [ { "id": "774", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/774" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G84452RH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 151, "start_aa": "Asn", "end_pos": 151, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn151", "evidence": [ { "id": "774", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/774" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G84820NF", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 151, "start_aa": "Asn", "end_pos": 151, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn151", "evidence": [ { "id": "774", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/774" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 151, "start_aa": "Asn", "end_pos": 151, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn151", "evidence": [ { "id": "P08571", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08571#ptm_processing" }, { "id": "16335952", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16335952" }, { "id": "23090970", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23090970" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" }, { "id": "24190977", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24190977" } ] }, { "glytoucan_ac": "G60177UT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 282, "start_aa": "Asn", "end_pos": 282, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn282", "evidence": [ { "id": "774", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/774" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G64527OM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 282, "start_aa": "Asn", "end_pos": 282, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn282", "evidence": [ { "id": "774", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/774" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G66676MI", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 282, "start_aa": "Asn", "end_pos": 282, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn282", "evidence": [ { "id": "774", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/774" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G70101JE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 282, "start_aa": "Asn", "end_pos": 282, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn282", "evidence": [ { "id": "774", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/774" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 282, "start_aa": "Asn", "end_pos": 282, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn282", "evidence": [ { "id": "P08571", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08571#ptm_processing" }, { "id": "16335952", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16335952" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 323, "start_aa": "Asn", "end_pos": 323, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn323", "evidence": [ { "id": "P08571", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08571#ptm_processing" }, { "id": "19159218", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19159218" } ] }, { "glytoucan_ac": "G27391WQ", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 336, "start_aa": "Thr", "end_pos": 336, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr336", "evidence": [ { "id": "P08571", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G29068FM", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 336, "start_aa": "Thr", "end_pos": 336, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr336", "evidence": [ { "id": "P08571", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G29931IJ", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 336, "start_aa": "Thr", "end_pos": 336, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr336", "evidence": [ { "id": "774", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/774" }, { "id": "19838169", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19838169" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 336, "start_aa": "Thr", "end_pos": 336, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr336", "evidence": [ { "id": "P08571", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GalNAcylation", "site_category": "reported", "site_seq": "T", "relation": "attached", "comment": "O-linked (GalNAc...) threonine O-GalNAcylation", "start_pos": 336, "start_aa": "Thr", "end_pos": 336, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr336", "evidence": [ { "id": "P08571", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08571#ptm_processing" }, { "id": "19838169", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19838169" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 362, "start_aa": "Ser", "end_pos": 362, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser362", "evidence": [ { "id": "P08571", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 364, "start_aa": "Thr", "end_pos": 364, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr364", "evidence": [ { "id": "P08571", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 37, "start_aa": "Asn", "end_pos": 37, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn37", "evidence": [ { "id": "P08571", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08571#ptm_processing" } ] } ], "phosphorylation": [], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported_with_glycan", "glycoprotein_reported", "glycoprotein_predicted" ], "publication": [ { "title": "Lipopolysaccharide-coated erythrocytes activate human neutrophils via CD14 while subsequent binding is through CD11b/CD18.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1999", "authors": "Troelstra A, de Graaf-Miltenburg LA, van Bommel T, Verhoef J, Van Kessel KP, Van Strijp JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-166016", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166016" } ], "reference": [ { "type": "PubMed", "id": "10201950", "url": "https://glygen.org/publication/PubMed/10201950" } ] }, { "title": "Peptidoglycan- and lipoteichoic acid-induced cell activation is mediated by toll-like receptor 2.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Schwandner R, Dziarski R, Wesche H, Rothe M, Kirschning CJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-168188", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-168188" } ], "reference": [ { "type": "PubMed", "id": "10364168", "url": "https://glygen.org/publication/PubMed/10364168" } ] }, { "title": "Cell activation and apoptosis by bacterial lipoproteins through toll-like receptor-2.", "journal": "Science (New York, N.Y.)", "date": "1999", "authors": "Aliprantis AO, Yang RB, Mark MR, Suggett S, Devaux B, Radolf JD, Klimpel GR, Godowski P, Zychlinsky A", "evidence": [ { "database": "Reactome", "id": "R-HSA-168188", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-168188" } ], "reference": [ { "type": "PubMed", "id": "10426996", "url": "https://glygen.org/publication/PubMed/10426996" } ] }, { "title": "ECSIT is an evolutionarily conserved intermediate in the Toll/IL-1 signal transduction pathway.", "journal": "Genes & development", "date": "1999", "authors": "Kopp E, Medzhitov R, Carothers J, Xiao C, Douglas I, Janeway CA, Ghosh S", "evidence": [ { "database": "Reactome", "id": "R-HSA-166058", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166058" } ], "reference": [ { "type": "PubMed", "id": "10465784", "url": "https://glygen.org/publication/PubMed/10465784" } ] }, { "title": "Human toll-like receptors mediate cellular activation by Mycobacterium tuberculosis.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1999", "authors": "Means TK, Wang S, Lien E, Yoshimura A, Golenbock DT, Fenton MJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-168188", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-168188" } ], "reference": [ { "type": "PubMed", "id": "10490993", "url": "https://glygen.org/publication/PubMed/10490993" } ] }, { "title": "Differential roles of TLR2 and TLR4 in recognition of gram-negative and gram-positive bacterial cell wall components.", "journal": "Immunity", "date": "1999", "authors": "Takeuchi O, Hoshino K, Kawai T, Sanjo H, Takada H, Ogawa T, Takeda K, Akira S", "evidence": [ { "database": "Reactome", "id": "R-HSA-168188", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-168188" } ], "reference": [ { "type": "PubMed", "id": "10549626", "url": "https://glygen.org/publication/PubMed/10549626" } ] }, { "title": "TAK1 mitogen-activated protein kinase kinase kinase is activated by autophosphorylation within its activation loop.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Kishimoto K, Matsumoto K, Ninomiya-Tsuji J", "evidence": [ { "database": "Reactome", "id": "R-HSA-937072", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-937072" } ], "reference": [ { "type": "PubMed", "id": "10702308", "url": "https://glygen.org/publication/PubMed/10702308" } ] }, { "title": "TAB2, a novel adaptor protein, mediates activation of TAK1 MAPKKK by linking TAK1 to TRAF6 in the IL-1 signal transduction pathway.", "journal": "Molecular cell", "date": "2000", "authors": "Takaesu G, Kishida S, Hiyama A, Yamaguchi K, Shibuya H, Irie K, Ninomiya-Tsuji J, Matsumoto K", "evidence": [ { "database": "Reactome", "id": "R-HSA-937072", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-937072" } ], "reference": [ { "type": "PubMed", "id": "10882101", "url": "https://glygen.org/publication/PubMed/10882101" } ] }, { "title": "Activation of the IkappaB kinase complex by TRAF6 requires a dimeric ubiquitin-conjugating enzyme complex and a unique polyubiquitin chain.", "journal": "Cell", "date": "2000", "authors": "Deng L, Wang C, Spencer E, Yang L, Braun A, You J, Slaughter C, Pickart C, Chen ZJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-937072", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-937072" } ], "reference": [ { "type": "PubMed", "id": "11057907", "url": "https://glygen.org/publication/PubMed/11057907" } ] }, { "title": "Cutting edge: functional interactions between toll-like receptor (TLR) 2 and TLR1 or TLR6 in response to phenol-soluble modulin.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2001", "authors": "Hajjar AM, O'Mahony DS, Ozinsky A, Underhill DM, Aderem A, Klebanoff SJ, Wilson CB", "evidence": [ { "database": "Reactome", "id": "R-HSA-168188", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-168188" } ], "reference": [ { "type": "PubMed", "id": "11123271", "url": "https://glygen.org/publication/PubMed/11123271" } ] }, { "title": "Lipopolysaccharide is in close proximity to each of the proteins in its membrane receptor complex. transfer from CD14 to TLR4 and MD-2.", "journal": "J. Biol. Chem.", "date": "2001", "authors": "da Silva Correia J, Soldau K, Christen U, Tobias PS, Ulevitch RJ", "evidence": [ { "database": "UniProtKB", "id": "P08571", "url": "https://www.uniprot.org/uniprot/P08571" }, { "database": "Reactome", "id": "R-HSA-166016", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166016" } ], "reference": [ { "type": "PubMed", "id": "11274165", "url": "https://glygen.org/publication/PubMed/11274165" } ] }, { "title": "CX3C chemokine mimicry by respiratory syncytial virus G glycoprotein.", "journal": "Nature immunology", "date": "2001-08", "authors": "Tripp R A, Jones L P, Haynes L M, Zheng H, Murphy P M, Anderson L J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9820960", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9820960" } ], "reference": [ { "type": "PubMed", "id": "11477410", "url": "https://glygen.org/publication/PubMed/11477410" } ] }, { "title": "Fibrinogen stimulates macrophage chemokine secretion through toll-like receptor 4.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2001", "authors": "Smiley ST, King JA, Hancock WW", "evidence": [ { "database": "Reactome", "id": "R-HSA-5686938", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5686938" } ], "reference": [ { "type": "PubMed", "id": "11509636", "url": "https://glygen.org/publication/PubMed/11509636" } ] }, { "title": "Mal (MyD88-adapter-like) is required for Toll-like receptor-4 signal transduction.", "journal": "Nature", "date": "2001", "authors": "Fitzgerald KA, Palsson-McDermott EM, Bowie AG, Jefferies CA, Mansell AS, Brady G, Brint E, Dunne A, Gray P, Harte MT, McMurray D, Smith DE, Sims JE, Bird TA, O'Neill LA", "evidence": [ { "database": "Reactome", "id": "R-HSA-166058", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166058" } ], "reference": [ { "type": "PubMed", "id": "11544529", "url": "https://glygen.org/publication/PubMed/11544529" } ] }, { "title": "Recognition of double-stranded RNA and activation of NF-kappaB by Toll-like receptor 3.", "journal": "Nature", "date": "2001", "authors": "Alexopoulou L, Holt AC, Medzhitov R, Flavell RA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833110", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833110" } ], "reference": [ { "type": "PubMed", "id": "11607032", "url": "https://glygen.org/publication/PubMed/11607032" } ] }, { "title": "Surfactant protein A inhibits peptidoglycan-induced tumor necrosis factor-alpha secretion in U937 cells and alveolar macrophages by direct interaction with toll-like receptor 2.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Murakami S, Iwaki D, Mitsuzawa H, Sano H, Takahashi H, Voelker DR, Akino T, Kuroki Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-5686938", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5686938" } ], "reference": [ { "type": "PubMed", "id": "11724772", "url": "https://glygen.org/publication/PubMed/11724772" } ] }, { "title": "IRAK-4: a novel member of the IRAK family with the properties of an IRAK-kinase.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2002", "authors": "Li S, Strelow A, Fontana EJ, Wesche H", "evidence": [ { "database": "Reactome", "id": "R-HSA-166058", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166058" } ], "reference": [ { "type": "PubMed", "id": "11960013", "url": "https://glygen.org/publication/PubMed/11960013" } ] }, { "title": "Release of chromatin protein HMGB1 by necrotic cells triggers inflammation.", "journal": "Nature", "date": "2002", "authors": "Scaffidi P, Misteli T, Bianchi ME", "evidence": [ { "database": "Reactome", "id": "R-HSA-5686938", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5686938" } ], "reference": [ { "type": "PubMed", "id": "12110890", "url": "https://glygen.org/publication/PubMed/12110890" } ] }, { "title": "Identification of threonine 66 as a functionally critical residue of the interleukin-1 receptor-associated kinase.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Ross K, Yang L, Dower S, Volpe F, Guesdon F", "evidence": [ { "database": "Reactome", "id": "R-HSA-166058", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166058" } ], "reference": [ { "type": "PubMed", "id": "12138165", "url": "https://glygen.org/publication/PubMed/12138165" } ] }, { "title": "Distinct molecular mechanism for initiating TRAF6 signalling.", "journal": "Nature", "date": "2002", "authors": "Ye H, Arron JR, Lamothe B, Cirilli M, Kobayashi T, Shevde NK, Segal D, Dzivenu OK, Vologodskaia M, Yim M, Du K, Singh S, Pike JW, Darnay BG, Choi Y, Wu H", "evidence": [ { "database": "Reactome", "id": "R-HSA-166058", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166058" } ], "reference": [ { "type": "PubMed", "id": "12140561", "url": "https://glygen.org/publication/PubMed/12140561" } ] }, { "title": "Tipping the balance between necrosis and apoptosis in human and murine cells treated with interferon and dsRNA.", "journal": "Cell death and differentiation", "date": "2002", "authors": "Kalai M, Van Loo G, Vanden Berghe T, Meeus A, Burm W, Saelens X, Vandenabeele P", "evidence": [ { "database": "Reactome", "id": "R-HSA-140534", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140534" } ], "reference": [ { "type": "PubMed", "id": "12181749", "url": "https://glygen.org/publication/PubMed/12181749" } ] }, { "title": "Protective role of phospholipid oxidation products in endotoxin-induced tissue damage.", "journal": "Nature", "date": "2002", "authors": "Bochkov VN, Kadl A, Huber J, Gruber F, Binder BR, Leitinger N", "evidence": [ { "database": "Reactome", "id": "R-HSA-5686938", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5686938" } ], "reference": [ { "type": "PubMed", "id": "12214235", "url": "https://glygen.org/publication/PubMed/12214235" } ] }, { "title": "Interleukin-1 (IL-1) receptor-associated kinase-dependent IL-1-induced signaling complexes phosphorylate TAK1 and TAB2 at the plasma membrane and activate TAK1 in the cytosol.", "journal": "Molecular and cellular biology", "date": "2002", "authors": "Jiang Z, Ninomiya-Tsuji J, Qian Y, Matsumoto K, Li X", "evidence": [ { "database": "Reactome", "id": "R-HSA-937072", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-937072" } ], "reference": [ { "type": "PubMed", "id": "12242293", "url": "https://glygen.org/publication/PubMed/12242293" } ] }, { "title": "IRAK-4 as the central TIR signaling mediator in innate immunity.", "journal": "Trends in immunology", "date": "2002", "authors": "Suzuki N, Suzuki S, Yeh WC", "evidence": [ { "database": "Reactome", "id": "R-HSA-166058", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166058" } ], "reference": [ { "type": "PubMed", "id": "12297423", "url": "https://glygen.org/publication/PubMed/12297423" } ] }, { "title": "Essential role for TIRAP in activation of the signalling cascade shared by TLR2 and TLR4.", "journal": "Nature", "date": "2002", "authors": "Yamamoto M, Sato S, Hemmi H, Sanjo H, Uematsu S, Kaisho T, Hoshino K, Takeuchi O, Kobayashi M, Fujita T, Takeda K, Akira S", "evidence": [ { "database": "Reactome", "id": "R-HSA-166058", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166058" } ], "reference": [ { "type": "PubMed", "id": "12447441", "url": "https://glygen.org/publication/PubMed/12447441" } ] }, { "title": "The adaptor molecule TIRAP provides signalling specificity for Toll-like receptors.", "journal": "Nature", "date": "2002", "authors": "Horng T, Barton GM, Flavell RA, Medzhitov R", "evidence": [ { "database": "Reactome", "id": "R-HSA-166058", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166058" } ], "reference": [ { "type": "PubMed", "id": "12447442", "url": "https://glygen.org/publication/PubMed/12447442" } ] }, { "title": "Cutting edge: a novel Toll/IL-1 receptor domain-containing adapter that preferentially activates the IFN-beta promoter in the Toll-like receptor signaling.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2002", "authors": "Yamamoto M, Sato S, Mori K, Hoshino K, Takeuchi O, Takeda K, Akira S", "evidence": [ { "database": "Reactome", "id": "R-HSA-166016", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166016" } ], "reference": [ { "type": "PubMed", "id": "12471095", "url": "https://glygen.org/publication/PubMed/12471095" } ] }, { "title": "Poly(I-C)-induced Toll-like receptor 3 (TLR3)-mediated activation of NFkappa B and MAP kinase is through an interleukin-1 receptor-associated kinase (IRAK)-independent pathway employing the signaling components TLR3-TRAF6-TAK1-TAB2-PKR .", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Jiang Z, Zamanian-Daryoush M, Nie H, Silva AM, Williams BR, Li X", "evidence": [ { "database": "Reactome", "id": "R-HSA-937072", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-937072" } ], "reference": [ { "type": "PubMed", "id": "12609980", "url": "https://glygen.org/publication/PubMed/12609980" } ] }, { "title": "Insights into the regulatory mechanism for caspase-8 activation.", "journal": "Molecular cell", "date": "2003", "authors": "Donepudi M, Mac Sweeney A, Briand C, Grutter MG", "evidence": [ { "database": "Reactome", "id": "R-HSA-140534", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140534" } ], "reference": [ { "type": "PubMed", "id": "12620240", "url": "https://glygen.org/publication/PubMed/12620240" } ] }, { "title": "Pyogenic bacterial infections in humans with IRAK-4 deficiency.", "journal": "Science (New York, N.Y.)", "date": "2003", "authors": "Picard C, Puel A, Bonnet M, Ku CL, Bustamante J, Yang K, Soudais C, Dupuis S, Feinberg J, Fieschi C, Elbim C, Hitchcock R, Lammas D, Davies G, Al-Ghonaium A, Al-Rayes H, Al-Jumaah S, Al-Hajjar S, Al-Mohsen IZ, Frayha HH, Rucker R, Hawn TR, Aderem A, Tufenkeji H, Haraguchi S, Day NK, Good RA, Gougerot-Pocidalo MA, Ozinsky A, Casanova JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-5603041", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5603041" } ], "reference": [ { "type": "PubMed", "id": "12637671", "url": "https://glygen.org/publication/PubMed/12637671" } ] }, { "title": "IKKepsilon and TBK1 are essential components of the IRF3 signaling pathway.", "journal": "Nature immunology", "date": "2003", "authors": "Fitzgerald KA, McWhirter SM, Faia KL, Rowe DC, Latz E, Golenbock DT, Coyle AJ, Liao SM, Maniatis T", "evidence": [ { "database": "Reactome", "id": "R-HSA-936964", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-936964" } ], "reference": [ { "type": "PubMed", "id": "12692549", "url": "https://glygen.org/publication/PubMed/12692549" } ] }, { "title": "Bruton's tyrosine kinase is a Toll/interleukin-1 receptor domain-binding protein that participates in nuclear factor kappaB activation by Toll-like receptor 4.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Jefferies CA, Doyle S, Brunner C, Dunne A, Brint E, Wietek C, Walch E, Wirth T, O'Neill LA", "evidence": [ { "database": "Reactome", "id": "R-HSA-166058", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166058" } ], "reference": [ { "type": "PubMed", "id": "12724322", "url": "https://glygen.org/publication/PubMed/12724322" } ] }, { "title": "Caspase-activation pathways in apoptosis and immunity.", "journal": "Immunological reviews", "date": "2003", "authors": "Creagh EM, Conroy H, Martin SJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2562578", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2562578" } ], "reference": [ { "type": "PubMed", "id": "12752666", "url": "https://glygen.org/publication/PubMed/12752666" } ] }, { "title": "Direct binding of Toll-like receptor 2 to zymosan, and zymosan-induced NF-kappa B activation and TNF-alpha secretion are down-regulated by lung collectin surfactant protein A.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2003", "authors": "Sato M, Sano H, Iwaki D, Kudo K, Konishi M, Takahashi H, Takahashi T, Imaizumi H, Asai Y, Kuroki Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-5686938", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5686938" } ], "reference": [ { "type": "PubMed", "id": "12817025", "url": "https://glygen.org/publication/PubMed/12817025" } ] }, { "title": "Role of adaptor TRIF in the MyD88-independent toll-like receptor signaling pathway.", "journal": "Science (New York, N.Y.)", "date": "2003", "authors": "Yamamoto M, Sato S, Hemmi H, Hoshino K, Kaisho T, Sanjo H, Takeuchi O, Sugiyama M, Okabe M, Takeda K, Akira S", "evidence": [ { "database": "Reactome", "id": "R-HSA-166166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166166" } ], "reference": [ { "type": "PubMed", "id": "12855817", "url": "https://glygen.org/publication/PubMed/12855817" } ] }, { "title": "LPS-TLR4 signaling to IRF-3/7 and NF-kappaB involves the toll adapters TRAM and TRIF.", "journal": "The Journal of experimental medicine", "date": "2003", "authors": "Fitzgerald KA, Rowe DC, Barnes BJ, Caffrey DR, Visintin A, Latz E, Monks B, Pitha PM, Golenbock DT", "evidence": [ { "database": "Reactome", "id": "R-HSA-166166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166166" } ], "reference": [ { "type": "PubMed", "id": "14517278", "url": "https://glygen.org/publication/PubMed/14517278" } ] }, { "title": "TRAM is specifically involved in the Toll-like receptor 4-mediated MyD88-independent signaling pathway.", "journal": "Nature immunology", "date": "2003", "authors": "Yamamoto M, Sato S, Hemmi H, Uematsu S, Hoshino K, Kaisho T, Takeuchi O, Takeda K, Akira S", "evidence": [ { "database": "Reactome", "id": "R-HSA-166016", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166016" } ], "reference": [ { "type": "PubMed", "id": "14556004", "url": "https://glygen.org/publication/PubMed/14556004" } ] }, { "title": "Sequential autophosphorylation steps in the interleukin-1 receptor-associated kinase-1 regulate its availability as an adapter in interleukin-1 signaling.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Kollewe C, Mackensen AC, Neumann D, Knop J, Cao P, Li S, Wesche H, Martin MU", "evidence": [ { "database": "Reactome", "id": "R-HSA-166058", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166058" } ], "reference": [ { "type": "PubMed", "id": "14625308", "url": "https://glygen.org/publication/PubMed/14625308" } ] }, { "title": "Identification of Ser-386 of interferon regulatory factor 3 as critical target for inducible phosphorylation that determines activation.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Mori M, Yoneyama M, Ito T, Takahashi K, Inagaki F, Fujita T", "evidence": [ { "database": "Reactome", "id": "R-HSA-936964", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-936964" } ], "reference": [ { "type": "PubMed", "id": "14703513", "url": "https://glygen.org/publication/PubMed/14703513" } ] }, { "title": "Mechanisms of the TRIF-induced interferon-stimulated response element and NF-kappaB activation and apoptosis pathways.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Han KJ, Su X, Xu LG, Bin LH, Zhang J, Shu HB", "evidence": [ { "database": "Reactome", "id": "R-HSA-2562578", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2562578" } ], "reference": [ { "type": "PubMed", "id": "14739303", "url": "https://glygen.org/publication/PubMed/14739303" } ] }, { "title": "Innate antiviral responses by means of TLR7-mediated recognition of single-stranded RNA.", "journal": "Science (New York, N.Y.)", "date": "2004", "authors": "Diebold SS, Kaisho T, Hemmi H, Akira S, Reis e Sousa C", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833110", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833110" } ], "reference": [ { "type": "PubMed", "id": "14976261", "url": "https://glygen.org/publication/PubMed/14976261" } ] }, { "title": "Relationship between structures and biological activities of mycoplasmal diacylated lipopeptides and their recognition by toll-like receptors 2 and 6.", "journal": "Infection and immunity", "date": "2004", "authors": "Okusawa T, Fujita M, Nakamura J, Into T, Yasuda M, Yoshimura A, Hara Y, Hasebe A, Golenbock DT, Morita M, Kuroki Y, Ogawa T, Shibata K", "evidence": [ { "database": "Reactome", "id": "R-HSA-168188", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-168188" } ], "reference": [ { "type": "PubMed", "id": "14977973", "url": "https://glygen.org/publication/PubMed/14977973" } ] }, { "title": "The roles of two IkappaB kinase-related kinases in lipopolysaccharide and double stranded RNA signaling and viral infection.", "journal": "The Journal of experimental medicine", "date": "2004", "authors": "Hemmi H, Takeuchi O, Sato S, Yamamoto M, Kaisho T, Sanjo H, Kawai T, Hoshino K, Takeda K, Akira S", "evidence": [ { "database": "Reactome", "id": "R-HSA-936964", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-936964" } ], "reference": [ { "type": "PubMed", "id": "15210742", "url": "https://glygen.org/publication/PubMed/15210742" } ] }, { "title": "Inferences, questions and possibilities in Toll-like receptor signalling.", "journal": "Nature", "date": "2004", "authors": "Beutler B", "evidence": [ { "database": "Reactome", "id": "R-HSA-168179", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-168179" } ], "reference": [ { "type": "PubMed", "id": "15241424", "url": "https://glygen.org/publication/PubMed/15241424" } ] }, { "title": "MD-2: the Toll 'gatekeeper' in endotoxin signalling.", "journal": "Trends in biochemical sciences", "date": "2004", "authors": "Gangloff M, Gay NJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-166016", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166016" } ], "reference": [ { "type": "PubMed", "id": "15276183", "url": "https://glygen.org/publication/PubMed/15276183" } ] }, { "title": "TAB2 and TAB3 activate the NF-kappaB pathway through binding to polyubiquitin chains.", "journal": "Molecular cell", "date": "2004", "authors": "Kanayama A, Seth RB, Sun L, Ea CK, Hong M, Shaito A, Chiu YH, Deng L, Chen ZJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-937072", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-937072" } ], "reference": [ { "type": "PubMed", "id": "15327770", "url": "https://glygen.org/publication/PubMed/15327770" } ] }, { "title": "Toll-like receptors in innate immunity.", "journal": "International immunology", "date": "2005", "authors": "Takeda K, Akira S", "evidence": [ { "database": "Reactome", "id": "R-HSA-166058", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166058" } ], "reference": [ { "type": "PubMed", "id": "15585605", "url": "https://glygen.org/publication/PubMed/15585605" } ] }, { "title": "Endotoxin recognition and signal transduction by the TLR4/MD2-complex.", "journal": "Microbes and infection", "date": "2004", "authors": "Fitzgerald KA, Rowe DC, Golenbock DT", "evidence": [ { "database": "Reactome", "id": "R-HSA-166016", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166016" } ], "reference": [ { "type": "PubMed", "id": "15596121", "url": "https://glygen.org/publication/PubMed/15596121" } ] }, { "title": "Binding of lipopeptide to CD14 induces physical proximity of CD14, TLR2 and TLR1.", "journal": "European journal of immunology", "date": "2005", "authors": "Manukyan M, Triantafilou K, Triantafilou M, Mackie A, Nilsen N, Espevik T, Wiesmuller KH, Ulmer AJ, Heine H", "evidence": [ { "database": "Reactome", "id": "R-HSA-168179", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-168179" } ], "reference": [ { "type": "PubMed", "id": "15714590", "url": "https://glygen.org/publication/PubMed/15714590" } ] }, { "title": "Apoptosis induced by the toll-like receptor adaptor TRIF is dependent on its receptor interacting protein homotypic interaction motif.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2005", "authors": "Kaiser WJ, Offermann MK", "evidence": [ { "database": "Reactome", "id": "R-HSA-2562578", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2562578" } ], "reference": [ { "type": "PubMed", "id": "15814722", "url": "https://glygen.org/publication/PubMed/15814722" } ] }, { "title": "Bruton's Tyrosine Kinase is involved in innate and adaptive immunity.", "journal": "Histology and histopathology", "date": "2005", "authors": "Brunner C, Muller B, Wirth T", "evidence": [ { "database": "Reactome", "id": "R-HSA-166058", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166058" } ], "reference": [ { "type": "PubMed", "id": "15944945", "url": "https://glygen.org/publication/PubMed/15944945" } ] }, { "title": "A novel splice variant of interleukin-1 receptor (IL-1R)-associated kinase 1 plays a negative regulatory role in Toll/IL-1R-induced inflammatory signaling.", "journal": "Molecular and cellular biology", "date": "2005", "authors": "Rao N, Nguyen S, Ngo K, Fung-Leung WP", "evidence": [ { "database": "Reactome", "id": "R-HSA-166058", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166058" } ], "reference": [ { "type": "PubMed", "id": "16024789", "url": "https://glygen.org/publication/PubMed/16024789" } ] }, { "title": "Rip1 mediates the Trif-dependent toll-like receptor 3- and 4-induced NF-{kappa}B activation but does not contribute to interferon regulatory factor 3 activation.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Cusson-Hermance N, Khurana S, Lee TH, Fitzgerald KA, Kelliher MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-937041", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-937041" } ], "reference": [ { "type": "PubMed", "id": "16115877", "url": "https://glygen.org/publication/PubMed/16115877" } ] }, { "title": "Essential function for the kinase TAK1 in innate and adaptive immune responses.", "journal": "Nature immunology", "date": "2005", "authors": "Sato S, Sanjo H, Takeda K, Ninomiya-Tsuji J, Yamamoto M, Kawai T, Matsumoto K, Takeuchi O, Akira S", "evidence": [ { "database": "Reactome", "id": "R-HSA-937072", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-937072" } ], "reference": [ { "type": "PubMed", "id": "16186825", "url": "https://glygen.org/publication/PubMed/16186825" } ] }, { "title": "Surfactant proteins SP-A and SP-D: structure, function and receptors.", "journal": "Molecular immunology", "date": "2006", "authors": "Kishore U, Greenhough TJ, Waters P, Shrive AK, Ghai R, Kamran MF, Bernal AL, Reid KB, Madan T, Chakraborty T", "evidence": [ { "database": "Reactome", "id": "R-HSA-5686938", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5686938" } ], "reference": [ { "type": "PubMed", "id": "16213021", "url": "https://glygen.org/publication/PubMed/16213021" } ] }, { "title": "TAK1, but not TAB1 or TAB2, plays an essential role in multiple signaling pathways in vivo.", "journal": "Genes & development", "date": "2005", "authors": "Shim JH, Xiao C, Paschal AE, Bailey ST, Rao P, Hayden MS, Lee KY, Bussey C, Steckel M, Tanaka N, Yamada G, Akira S, Matsumoto K, Ghosh S", "evidence": [ { "database": "Reactome", "id": "R-HSA-937072", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-937072" } ], "reference": [ { "type": "PubMed", "id": "16260493", "url": "https://glygen.org/publication/PubMed/16260493" } ] }, { "title": "TLR4 mediates human retinal pigment epithelial endotoxin binding and cytokine expression.", "journal": "Investigative ophthalmology & visual science", "date": "2005", "authors": "Elner SG, Petty HR, Elner VM, Yoshida A, Bian ZM, Yang D, Kindzelskii AL", "evidence": [ { "database": "Reactome", "id": "R-HSA-166016", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166016" } ], "reference": [ { "type": "PubMed", "id": "16303959", "url": "https://glygen.org/publication/PubMed/16303959" } ] }, { "title": "Critical role of TRAF3 in the Toll-like receptor-dependent and -independent antiviral response.", "journal": "Nature", "date": "2006", "authors": "Oganesyan G, Saha SK, Guo B, He JQ, Shahangian A, Zarnegar B, Perry A, Cheng G", "evidence": [ { "database": "Reactome", "id": "R-HSA-936964", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-936964" } ], "reference": [ { "type": "PubMed", "id": "16306936", "url": "https://glygen.org/publication/PubMed/16306936" } ] }, { "title": "Specificity in Toll-like receptor signalling through distinct effector functions of TRAF3 and TRAF6.", "journal": "Nature", "date": "2006", "authors": "Hacker H, Redecke V, Blagoev B, Kratchmarova I, Hsu LC, Wang GG, Kamps MP, Raz E, Wagner H, Hacker G, Mann M, Karin M", "evidence": [ { "database": "Reactome", "id": "R-HSA-936964", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-936964" } ], "reference": [ { "type": "PubMed", "id": "16306937", "url": "https://glygen.org/publication/PubMed/16306937" } ] }, { "title": "Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.", "journal": "Journal of proteome research", "date": "2005", "authors": "Liu T, Qian WJ, Gritsenko MA, Camp DG 2nd, Monroe ME, Moore RJ, Smith RD", "evidence": [ { "database": "UniProtKB", "id": "P08571", "url": "https://www.uniprot.org/uniprot/P08571#ptm_processing" }, { "database": "UniProtKB", "id": "P08571", "url": "https://www.uniprot.org/uniprot/P08571" } ], "reference": [ { "type": "PubMed", "id": "16335952", "url": "https://glygen.org/publication/PubMed/16335952" } ] }, { "title": "MyD88 adapter-like (Mal) is phosphorylated by Bruton's tyrosine kinase during TLR2 and TLR4 signal transduction.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Gray P, Dunne A, Brikos C, Jefferies CA, Doyle SL, O'Neill LA", "evidence": [ { "database": "Reactome", "id": "R-HSA-166058", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166058" } ], "reference": [ { "type": "PubMed", "id": "16439361", "url": "https://glygen.org/publication/PubMed/16439361" } ] }, { "title": "Meningococcal porin PorB binds to TLR2 and requires TLR1 for signaling.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2006", "authors": "Massari P, Visintin A, Gunawardana J, Halmen KA, King CA, Golenbock DT, Wetzler LM", "evidence": [ { "database": "Reactome", "id": "R-HSA-168179", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-168179" } ], "reference": [ { "type": "PubMed", "id": "16455995", "url": "https://glygen.org/publication/PubMed/16455995" } ] }, { "title": "Endocytic pathways regulate Toll-like receptor 4 signaling and link innate and adaptive immunity.", "journal": "The EMBO journal", "date": "2006", "authors": "Husebye H, Halaas O, Stenmark H, Tunheim G, Sandanger O, Bogen B, Brech A, Latz E, Espevik T", "evidence": [ { "database": "Reactome", "id": "R-HSA-166016", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166016" } ], "reference": [ { "type": "PubMed", "id": "16467847", "url": "https://glygen.org/publication/PubMed/16467847" } ] }, { "title": "Sensing of Lys 63-linked polyubiquitination by NEMO is a key event in NF-kappaB activation [corrected].", "journal": "Nature cell biology", "date": "2006", "authors": "Wu CJ, Conze DB, Li T, Srinivasula SM, Ashwell JD", "evidence": [ { "database": "Reactome", "id": "R-HSA-937041", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-937041" } ], "reference": [ { "type": "PubMed", "id": "16547522", "url": "https://glygen.org/publication/PubMed/16547522" } ] }, { "title": "Activation of IKK by TNFalpha requires site-specific ubiquitination of RIP1 and polyubiquitin binding by NEMO.", "journal": "Molecular cell", "date": "2006", "authors": "Ea CK, Deng L, Xia ZP, Pineda G, Chen ZJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-937041", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-937041" } ], "reference": [ { "type": "PubMed", "id": "16603398", "url": "https://glygen.org/publication/PubMed/16603398" } ] }, { "title": "Phosphoinositide-mediated adaptor recruitment controls Toll-like receptor signaling.", "journal": "Cell", "date": "2006", "authors": "Kagan JC, Medzhitov R", "evidence": [ { "database": "Reactome", "id": "R-HSA-166016", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166016" } ], "reference": [ { "type": "PubMed", "id": "16751103", "url": "https://glygen.org/publication/PubMed/16751103" } ] }, { "title": "Surfactant protein A directly interacts with TLR4 and MD-2 and regulates inflammatory cellular response. Importance of supratrimeric oligomerization.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Yamada C, Sano H, Shimizu T, Mitsuzawa H, Nishitani C, Himi T, Kuroki Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-5686938", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5686938" } ], "reference": [ { "type": "PubMed", "id": "16754682", "url": "https://glygen.org/publication/PubMed/16754682" } ] }, { "title": "Trif-related adapter molecule is phosphorylated by PKC{epsilon} during Toll-like receptor 4 signaling.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2006", "authors": "McGettrick AF, Brint EK, Palsson-McDermott EM, Rowe DC, Golenbock DT, Gay NJ, Fitzgerald KA, O'Neill LA", "evidence": [ { "database": "Reactome", "id": "R-HSA-166016", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166016" } ], "reference": [ { "type": "PubMed", "id": "16757566", "url": "https://glygen.org/publication/PubMed/16757566" } ] }, { "title": "Human pulmonary surfactant protein D binds the extracellular domains of Toll-like receptors 2 and 4 through the carbohydrate recognition domain by a mechanism different from its binding to phosphatidylinositol and lipopolysaccharide.", "journal": "Biochemistry", "date": "2006", "authors": "Ohya M, Nishitani C, Sano H, Yamada C, Mitsuzawa H, Shimizu T, Saito T, Smith K, Crouch E, Kuroki Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-5686938", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5686938" } ], "reference": [ { "type": "PubMed", "id": "16834340", "url": "https://glygen.org/publication/PubMed/16834340" } ] }, { "title": "The extracellular release of HMGB1 during apoptotic cell death.", "journal": "American journal of physiology. Cell physiology", "date": "2006", "authors": "Bell CW, Jiang W, Reich CF 3rd, Pisetsky DS", "evidence": [ { "database": "Reactome", "id": "R-HSA-5686938", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5686938" } ], "reference": [ { "type": "PubMed", "id": "16855214", "url": "https://glygen.org/publication/PubMed/16855214" } ] }, { "title": "HMGB1 signals through toll-like receptor (TLR) 4 and TLR2.", "journal": "Shock (Augusta, Ga.)", "date": "2006", "authors": "Yu M, Wang H, Ding A, Golenbock DT, Latz E, Czura CJ, Fenton MJ, Tracey KJ, Yang H", "evidence": [ { "database": "Reactome", "id": "R-HSA-5686938", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5686938" } ], "reference": [ { "type": "PubMed", "id": "16878026", "url": "https://glygen.org/publication/PubMed/16878026" } ] }, { "title": "Membrane sorting of toll-like receptor (TLR)-2/6 and TLR2/1 heterodimers at the cell surface determines heterotypic associations with CD36 and intracellular targeting.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Triantafilou M, Gamper FG, Haston RM, Mouratis MA, Morath S, Hartung T, Triantafilou K", "evidence": [ { "database": "UniProtKB", "id": "P08571", "url": "https://www.uniprot.org/uniprot/P08571" }, { "database": "Reactome", "id": "R-HSA-168188", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-168188" } ], "reference": [ { "type": "PubMed", "id": "16880211", "url": "https://glygen.org/publication/PubMed/16880211" } ] }, { "title": "The human adaptor SARM negatively regulates adaptor protein TRIF-dependent Toll-like receptor signaling.", "journal": "Nature immunology", "date": "2006", "authors": "Carty M, Goodbody R, Schroder M, Stack J, Moynagh PN, Bowie AG", "evidence": [ { "database": "Reactome", "id": "R-HSA-166166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166166" } ], "reference": [ { "type": "PubMed", "id": "16964262", "url": "https://glygen.org/publication/PubMed/16964262" } ] }, { "title": "CD14, a receptor for complexes of lipopolysaccharide (LPS) and LPS binding protein.", "journal": "Science (New York, N.Y.)", "date": "1990-09-21", "authors": "Wright S D, Ramos R A, Tobias P S, Ulevitch R J, Mathison J C", "evidence": [ { "database": "UniProtKB", "id": "P08571", "url": "https://www.uniprot.org/uniprot/P08571" } ], "reference": [ { "type": "PubMed", "id": "1698311", "url": "https://glygen.org/publication/PubMed/1698311" } ] }, { "title": "Regulation and function of IKK and IKK-related kinases.", "journal": "Science's STKE : signal transduction knowledge environment", "date": "2006", "authors": "Hacker H, Karin M", "evidence": [ { "database": "Reactome", "id": "R-HSA-936964", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-936964" } ], "reference": [ { "type": "PubMed", "id": "17047224", "url": "https://glygen.org/publication/PubMed/17047224" } ] }, { "title": "Site-specific Lys-63-linked tumor necrosis factor receptor-associated factor 6 auto-ubiquitination is a critical determinant of I kappa B kinase activation.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Lamothe B, Besse A, Campos AD, Webster WK, Wu H, Darnay BG", "evidence": [ { "database": "Reactome", "id": "R-HSA-937072", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-937072" } ], "reference": [ { "type": "PubMed", "id": "17135271", "url": "https://glygen.org/publication/PubMed/17135271" } ] }, { "title": "Regulation of IRAK-4 kinase activity via autophosphorylation within its activation loop.", "journal": "Biochemical and biophysical research communications", "date": "2007", "authors": "Cheng H, Addona T, Keshishian H, Dahlstrand E, Lu C, Dorsch M, Li Z, Wang A, Ocain TD, Li P, Parsons TF, Jaffee B, Xu Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-166058", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166058" } ], "reference": [ { "type": "PubMed", "id": "17141195", "url": "https://glygen.org/publication/PubMed/17141195" } ] }, { "title": "SHP-2 phosphatase negatively regulates the TRIF adaptor protein-dependent type I interferon and proinflammatory cytokine production.", "journal": "Immunity", "date": "2006", "authors": "An H, Zhao W, Hou J, Zhang Y, Xie Y, Zheng Y, Xu H, Qian C, Zhou J, Yu Y, Liu S, Feng G, Cao X", "evidence": [ { "database": "Reactome", "id": "R-HSA-936964", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-936964" } ], "reference": [ { "type": "PubMed", "id": "17157040", "url": "https://glygen.org/publication/PubMed/17157040" } ] }, { "title": "Essential role of IRAK-4 protein and its kinase activity in Toll-like receptor-mediated immune responses but not in TCR signaling.", "journal": "The Journal of experimental medicine", "date": "2007", "authors": "Kawagoe T, Sato S, Jung A, Yamamoto M, Matsui K, Kato H, Uematsu S, Takeuchi O, Akira S", "evidence": [ { "database": "Reactome", "id": "R-HSA-166058", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166058" } ], "reference": [ { "type": "PubMed", "id": "17485511", "url": "https://glygen.org/publication/PubMed/17485511" } ] }, { "title": "Ubiquitin-mediated activation of TAK1 and IKK.", "journal": "Oncogene", "date": "2007", "authors": "Adhikari A, Xu M, Chen ZJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-937072", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-937072" } ], "reference": [ { "type": "PubMed", "id": "17496917", "url": "https://glygen.org/publication/PubMed/17496917" } ] }, { "title": "Interferon regulatory factor 3 is regulated by a dual phosphorylation-dependent switch.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Panne D, McWhirter SM, Maniatis T, Harrison SC", "evidence": [ { "database": "Reactome", "id": "R-HSA-936964", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-936964" } ], "reference": [ { "type": "PubMed", "id": "17526488", "url": "https://glygen.org/publication/PubMed/17526488" } ] }, { "title": "A dimer of the Toll-like receptor 4 cytoplasmic domain provides a specific scaffold for the recruitment of signalling adaptor proteins.", "journal": "PloS one", "date": "2007", "authors": "Nunez Miguel R, Wong J, Westoll JF, Brooks HJ, O'Neill LA, Gay NJ, Bryant CE, Monie TP", "evidence": [ { "database": "Reactome", "id": "R-HSA-166058", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166058" } ], "reference": [ { "type": "PubMed", "id": "17726518", "url": "https://glygen.org/publication/PubMed/17726518" } ] }, { "title": "Mrp8 and Mrp14 are endogenous activators of Toll-like receptor 4, promoting lethal, endotoxin-induced shock.", "journal": "Nature medicine", "date": "2007", "authors": "Vogl T, Tenbrock K, Ludwig S, Leukert N, Ehrhardt C, van Zoelen MA, Nacken W, Foell D, van der Poll T, Sorg C, Roth J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5686938", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5686938" } ], "reference": [ { "type": "PubMed", "id": "17767165", "url": "https://glygen.org/publication/PubMed/17767165" } ] }, { "title": "Lipopolysaccharide-mediated interferon regulatory factor activation involves TBK1-IKKepsilon-dependent Lys(63)-linked polyubiquitination and phosphorylation of TANK/I-TRAF.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Gatot JS, Gioia R, Chau TL, Patrascu F, Warnier M, Close P, Chapelle JP, Muraille E, Brown K, Siebenlist U, Piette J, Dejardin E, Chariot A", "evidence": [ { "database": "Reactome", "id": "R-HSA-936964", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-936964" } ], "reference": [ { "type": "PubMed", "id": "17823124", "url": "https://glygen.org/publication/PubMed/17823124" } ] }, { "title": "IRAK-2 participates in multiple toll-like receptor signaling pathways to NFkappaB via activation of TRAF6 ubiquitination.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Keating SE, Maloney GM, Moran EM, Bowie AG", "evidence": [ { "database": "Reactome", "id": "R-HSA-166058", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166058" } ], "reference": [ { "type": "PubMed", "id": "17878161", "url": "https://glygen.org/publication/PubMed/17878161" } ] }, { "title": "TLR9 activation induces normal neutrophil responses in a child with IRAK-4 deficiency: involvement of the direct PI3K pathway.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2007", "authors": "Hoarau C, Gerard B, Lescanne E, Henry D, Francois S, Lacapere JJ, El Benna J, Dang PM, Grandchamp B, Lebranchu Y, Gougerot-Pocidalo MA, Elbim C", "evidence": [ { "database": "Reactome", "id": "R-HSA-5603041", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5603041" } ], "reference": [ { "type": "PubMed", "id": "17878374", "url": "https://glygen.org/publication/PubMed/17878374" } ] }, { "title": "IRAK1: a critical signaling mediator of innate immunity.", "journal": "Cellular signalling", "date": "2008", "authors": "Gottipati S, Rao NL, Fung-Leung WP", "evidence": [ { "database": "Reactome", "id": "R-HSA-166058", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166058" } ], "reference": [ { "type": "PubMed", "id": "17890055", "url": "https://glygen.org/publication/PubMed/17890055" } ] }, { "title": "Selective predisposition to bacterial infections in IRAK-4-deficient children: IRAK-4-dependent TLRs are otherwise redundant in protective immunity.", "journal": "The Journal of experimental medicine", "date": "2007", "authors": "Ku CL, von Bernuth H, Picard C, Zhang SY, Chang HH, Yang K, Chrabieh M, Issekutz AC, Cunningham CK, Gallin J, Holland SM, Roifman C, Ehl S, Smart J, Tang M, Barrat FJ, Levy O, McDonald D, Day-Good NK, Miller R, Takada H, Hara T, Al-Hajjar S, Al-Ghonaium A, Speert D, Sanlaville D, Li X, Geissmann F, Vivier E, Marodi L, Garty BZ, Chapel H, Rodriguez-Gallego C, Bossuyt X, Abel L, Puel A, Casanova JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-5603041", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5603041" } ], "reference": [ { "type": "PubMed", "id": "17893200", "url": "https://glygen.org/publication/PubMed/17893200" } ] }, { "title": "Tyrosine phosphorylation of MyD88 adapter-like (Mal) is critical for signal transduction and blocked in endotoxin tolerance.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Piao W, Song C, Chen H, Wahl LM, Fitzgerald KA, O'Neill LA, Medvedev AE", "evidence": [ { "database": "Reactome", "id": "R-HSA-166058", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166058" } ], "reference": [ { "type": "PubMed", "id": "18070880", "url": "https://glygen.org/publication/PubMed/18070880" } ] }, { "title": "TRAF6 distinctively mediates MyD88- and IRAK-1-induced activation of NF-kappaB.", "journal": "Journal of leukocyte biology", "date": "2008", "authors": "Muroi M, Tanamoto K", "evidence": [ { "database": "Reactome", "id": "R-HSA-166058", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166058" } ], "reference": [ { "type": "PubMed", "id": "18070982", "url": "https://glygen.org/publication/PubMed/18070982" } ] }, { "title": "The proinflammatory cytokine response to Chlamydia trachomatis elementary bodies in human macrophages is partly mediated by a lipoprotein, the macrophage infectivity potentiator, through TLR2/TLR1/TLR6 and CD14.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2008", "authors": "Bas S, Neff L, Vuillet M, Spenato U, Seya T, Matsumoto M, Gabay C", "evidence": [ { "database": "Reactome", "id": "R-HSA-168188", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-168188" } ], "reference": [ { "type": "PubMed", "id": "18178856", "url": "https://glygen.org/publication/PubMed/18178856" } ] }, { "title": "Roles for LPS-dependent interaction and relocation of TLR4 and TRAM in TRIF-signaling.", "journal": "Biochemical and biophysical research communications", "date": "2008", "authors": "Tanimura N, Saitoh S, Matsumoto F, Akashi-Takamura S, Miyake K", "evidence": [ { "database": "Reactome", "id": "R-HSA-166016", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166016" } ], "reference": [ { "type": "PubMed", "id": "18222170", "url": "https://glygen.org/publication/PubMed/18222170" } ] }, { "title": "Peptidoglycan and lipopolysaccharide activate PLCgamma2, leading to enhanced cytokine production in macrophages and dendritic cells.", "journal": "Genes to cells : devoted to molecular & cellular mechanisms", "date": "2008", "authors": "Aki D, Minoda Y, Yoshida H, Watanabe S, Yoshida R, Takaesu G, Chinen T, Inaba T, Hikida M, Kurosaki T, Saeki K, Yoshimura A", "evidence": [ { "database": "Reactome", "id": "R-HSA-166016", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166016" } ], "reference": [ { "type": "PubMed", "id": "18233961", "url": "https://glygen.org/publication/PubMed/18233961" } ] }, { "title": "TRAM couples endocytosis of Toll-like receptor 4 to the induction of interferon-beta.", "journal": "Nature immunology", "date": "2008", "authors": "Kagan JC, Su T, Horng T, Chow A, Akira S, Medzhitov R", "evidence": [ { "database": "Reactome", "id": "R-HSA-166016", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166016" } ], "reference": [ { "type": "PubMed", "id": "18297073", "url": "https://glygen.org/publication/PubMed/18297073" } ] }, { "title": "High mobility group box 1 protein binding to lipopolysaccharide facilitates transfer of lipopolysaccharide to CD14 and enhances lipopolysaccharide-mediated TNF-alpha production in human monocytes.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2008", "authors": "Youn JH, Oh YJ, Kim ES, Choi JE, Shin JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-5686938", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5686938" } ], "reference": [ { "type": "PubMed", "id": "18354232", "url": "https://glygen.org/publication/PubMed/18354232" } ] }, { "title": "Structural basis of toll-like receptor 3 signaling with double-stranded RNA.", "journal": "Science (New York, N.Y.)", "date": "2008", "authors": "Liu L, Botos I, Wang Y, Leonard JN, Shiloach J, Segal DM, Davies DR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833110", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833110" } ], "reference": [ { "type": "PubMed", "id": "18420935", "url": "https://glygen.org/publication/PubMed/18420935" } ] }, { "title": "Sequential control of Toll-like receptor-dependent responses by IRAK1 and IRAK2.", "journal": "Nature immunology", "date": "2008", "authors": "Kawagoe T, Sato S, Matsushita K, Kato H, Matsui K, Kumagai Y, Saitoh T, Kawai T, Takeuchi O, Akira S", "evidence": [ { "database": "Reactome", "id": "R-HSA-166058", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166058" } ], "reference": [ { "type": "PubMed", "id": "18438411", "url": "https://glygen.org/publication/PubMed/18438411" } ] }, { "title": "Oxidized phospholipid inhibition of toll-like receptor (TLR) signaling is restricted to TLR2 and TLR4: roles for CD14, LPS-binding protein, and MD2 as targets for specificity of inhibition.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Erridge C, Kennedy S, Spickett CM, Webb DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5686938", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5686938" } ], "reference": [ { "type": "PubMed", "id": "18559343", "url": "https://glygen.org/publication/PubMed/18559343" } ] }, { "title": "Pyogenic bacterial infections in humans with MyD88 deficiency.", "journal": "Science (New York, N.Y.)", "date": "2008", "authors": "von Bernuth H, Picard C, Jin Z, Pankla R, Xiao H, Ku CL, Chrabieh M, Mustapha IB, Ghandil P, Camcioglu Y, Vasconcelos J, Sirvent N, Guedes M, Vitor AB, Herrero-Mata MJ, Arostegui JI, Rodrigo C, Alsina L, Ruiz-Ortiz E, Juan M, Fortuny C, Yague J, Anton J, Pascal M, Chang HH, Janniere L, Rose Y, Garty BZ, Chapel H, Issekutz A, Marodi L, Rodriguez-Gallego C, Banchereau J, Abel L, Li X, Chaussabel D, Puel A, Casanova JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-5602498", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5602498" } ], "reference": [ { "type": "PubMed", "id": "18669862", "url": "https://glygen.org/publication/PubMed/18669862" } ] }, { "title": "Phosphorylation of SNAP-23 by IkappaB kinase 2 regulates mast cell degranulation.", "journal": "Cell", "date": "2008", "authors": "Suzuki K, Verma IM", "evidence": [ { "database": "Reactome", "id": "R-HSA-1236974", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1236974" } ], "reference": [ { "type": "PubMed", "id": "18692471", "url": "https://glygen.org/publication/PubMed/18692471" } ] }, { "title": "Natural selection in the TLR-related genes in the course of primate evolution.", "journal": "Immunogenetics", "date": "2008", "authors": "Nakajima Toshiaki, Ohtani Hitoshi, Satta Yoko, Uno Yasuhiro, Akari Hirofumi, Ishida Takafumi, Kimura Akinori", "evidence": [ { "database": "UniProtKB", "id": "P08571", "url": "https://www.uniprot.org/uniprot/P08571" } ], "reference": [ { "type": "PubMed", "id": "18810425", "url": "https://glygen.org/publication/PubMed/18810425" } ] }, { "title": "Assembly of oligomeric death domain complexes during Toll receptor signaling.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Moncrieffe MC, Grossmann JG, Gay NJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-166058", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166058" } ], "reference": [ { "type": "PubMed", "id": "18829464", "url": "https://glygen.org/publication/PubMed/18829464" } ] }, { "title": "Pulmonary surfactant protein D inhibits lipopolysaccharide (LPS)-induced inflammatory cell responses by altering LPS binding to its receptors.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Yamazoe M, Nishitani C, Takahashi M, Katoh T, Ariki S, Shimizu T, Mitsuzawa H, Sawada K, Voelker DR, Takahashi H, Kuroki Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-5686938", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5686938" } ], "reference": [ { "type": "PubMed", "id": "18990700", "url": "https://glygen.org/publication/PubMed/18990700" } ] }, { "title": "Multi-hit inhibition of circulating and cell-associated components of the toll-like receptor 4 pathway by oxidized phospholipids.", "journal": "Arteriosclerosis, thrombosis, and vascular biology", "date": "2009", "authors": "von Schlieffen E, Oskolkova OV, Schabbauer G, Gruber F, Bluml S, Genest M, Kadl A, Marsik C, Knapp S, Chow J, Leitinger N, Binder BR, Bochkov VN", "evidence": [ { "database": "Reactome", "id": "R-HSA-5686938", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5686938" } ], "reference": [ { "type": "PubMed", "id": "19112167", "url": "https://glygen.org/publication/PubMed/19112167" } ] }, { "title": "Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.", "journal": "Journal of proteome research", "date": "2009", "authors": "Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H", "evidence": [ { "database": "UniProtKB", "id": "P08571", "url": "https://www.uniprot.org/uniprot/P08571#ptm_processing" }, { "database": "UniProtKB", "id": "P08571", "url": "https://www.uniprot.org/uniprot/P08571" } ], "reference": [ { "type": "PubMed", "id": "19159218", "url": "https://glygen.org/publication/PubMed/19159218" } ] }, { "title": "MHC molecules and microbial antigen processing in phagosomes.", "journal": "Current opinion in immunology", "date": "2009", "authors": "Ramachandra L, Simmons D, Harding CV", "evidence": [ { "database": "Reactome", "id": "R-HSA-1236974", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1236974" } ], "reference": [ { "type": "PubMed", "id": "19217269", "url": "https://glygen.org/publication/PubMed/19217269" } ] }, { "title": "Interleukin-1 receptor-associated kinase 2 is critical for lipopolysaccharide-mediated post-transcriptional control.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Wan Y, Xiao H, Affolter J, Kim TW, Bulek K, Chaudhuri S, Carlson D, Hamilton T, Mazumder B, Stark GR, Thomas J, Li X", "evidence": [ { "database": "Reactome", "id": "R-HSA-166058", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166058" } ], "reference": [ { "type": "PubMed", "id": "19224918", "url": "https://glygen.org/publication/PubMed/19224918" } ] }, { "title": "Structural and biochemical studies on procaspase-8: new insights on initiator caspase activation.", "journal": "Structure (London, England : 1993)", "date": "2009", "authors": "Keller N, Mares J, Zerbe O, Grutter MG", "evidence": [ { "database": "Reactome", "id": "R-HSA-140534", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140534" } ], "reference": [ { "type": "PubMed", "id": "19278658", "url": "https://glygen.org/publication/PubMed/19278658" } ] }, { "title": "Tube Is an IRAK-4 homolog in a Toll pathway adapted for development and immunity.", "journal": "Journal of innate immunity", "date": "2009", "authors": "Towb P, Sun H, Wasserman SA", "evidence": [ { "database": "Reactome", "id": "R-HSA-166058", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166058" } ], "reference": [ { "type": "PubMed", "id": "19498957", "url": "https://glygen.org/publication/PubMed/19498957" } ] }, { "title": "Structural basis for the multiple interactions of the MyD88 TIR domain in TLR4 signaling.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2009", "authors": "Ohnishi H, Tochio H, Kato Z, Orii KE, Li A, Kimura T, Hiroaki H, Kondo N, Shirakawa M", "evidence": [ { "database": "Reactome", "id": "R-HSA-5602498", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5602498" } ], "reference": [ { "type": "PubMed", "id": "19506249", "url": "https://glygen.org/publication/PubMed/19506249" } ] }, { "title": "A TIR domain variant of MyD88 adapter-like (Mal)/TIRAP results in loss of MyD88 binding and reduced TLR2/TLR4 signaling.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Nagpal K, Plantinga TS, Wong J, Monks BG, Gay NJ, Netea MG, Fitzgerald KA, Golenbock DT", "evidence": [ { "database": "Reactome", "id": "R-HSA-166058", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166058" } ], "reference": [ { "type": "PubMed", "id": "19509286", "url": "https://glygen.org/publication/PubMed/19509286" } ] }, { "title": "An oligomeric signaling platform formed by the Toll-like receptor signal transducers MyD88 and IRAK-4.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Motshwene PG, Moncrieffe MC, Grossmann JG, Kao C, Ayaluru M, Sandercock AM, Robinson CV, Latz E, Gay NJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-166058", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166058" } ], "reference": [ { "type": "PubMed", "id": "19592493", "url": "https://glygen.org/publication/PubMed/19592493" } ] }, { "title": "MyD88 adapter-like (Mal)/TIRAP interaction with TRAF6 is critical for TLR2- and TLR4-mediated NF-kappaB proinflammatory responses.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Verstak B, Nagpal K, Bottomley SP, Golenbock DT, Hertzog PJ, Mansell A", "evidence": [ { "database": "Reactome", "id": "R-HSA-166058", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166058" } ], "reference": [ { "type": "PubMed", "id": "19592497", "url": "https://glygen.org/publication/PubMed/19592497" } ] }, { "title": "Endotoxin tolerance dysregulates MyD88- and Toll/IL-1R domain-containing adapter inducing IFN-beta-dependent pathways and increases expression of negative regulators of TLR signaling.", "journal": "Journal of leukocyte biology", "date": "2009", "authors": "Piao W, Song C, Chen H, Diaz MA, Wahl LM, Fitzgerald KA, Li L, Medvedev AE", "evidence": [ { "database": "Reactome", "id": "R-HSA-166166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166166" } ], "reference": [ { "type": "PubMed", "id": "19656901", "url": "https://glygen.org/publication/PubMed/19656901" } ] }, { "title": "Direct activation of protein kinases by unanchored polyubiquitin chains.", "journal": "Nature", "date": "2009", "authors": "Xia ZP, Sun L, Chen X, Pineda G, Jiang X, Adhikari A, Zeng W, Chen ZJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-937072", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-937072" } ], "reference": [ { "type": "PubMed", "id": "19675569", "url": "https://glygen.org/publication/PubMed/19675569" } ] }, { "title": "Enrichment of glycopeptides for glycan structure and attachment site identification.", "journal": "Nature methods", "date": "2009", "authors": "Nilsson J, Ruetschi U, Halim A, Hesse C, Carlsohn E, Brinkmalm G, Larson G", "evidence": [ { "database": "UniProtKB", "id": "P08571", "url": "https://www.uniprot.org/uniprot/P08571#ptm_processing" }, { "database": "UniProtKB", "id": "P08571", "url": "https://www.uniprot.org/uniprot/P08571" }, { "database": "GlyConnect", "id": "774", "url": "https://glyconnect.expasy.org/browser/proteins/774" } ], "reference": [ { "type": "PubMed", "id": "19838169", "url": "https://glygen.org/publication/PubMed/19838169" } ] }, { "title": "Different modes of ubiquitination of the adaptor TRAF3 selectively activate the expression of type I interferons and proinflammatory cytokines.", "journal": "Nature immunology", "date": "2010", "authors": "Tseng PH, Matsuzawa A, Zhang W, Mino T, Vignali DA, Karin M", "evidence": [ { "database": "Reactome", "id": "R-HSA-936964", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-936964" } ], "reference": [ { "type": "PubMed", "id": "19898473", "url": "https://glygen.org/publication/PubMed/19898473" } ] }, { "title": "CD36 ligands promote sterile inflammation through assembly of a Toll-like receptor 4 and 6 heterodimer.", "journal": "Nature immunology", "date": "2010", "authors": "Stewart CR, Stuart LM, Wilkinson K, van Gils JM, Deng J, Halle A, Rayner KJ, Boyer L, Zhong R, Frazier WA, Lacy-Hulbert A, El Khoury J, Golenbock DT, Moore KJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5686938", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5686938" } ], "reference": [ { "type": "PubMed", "id": "20037584", "url": "https://glygen.org/publication/PubMed/20037584" } ] }, { "title": "Direct binding of TRAF2 and TRAF6 to TICAM-1/TRIF adaptor participates in activation of the Toll-like receptor 3/4 pathway.", "journal": "Molecular immunology", "date": "2010", "authors": "Sasai M, Tatematsu M, Oshiumi H, Funami K, Matsumoto M, Hatakeyama S, Seya T", "evidence": [ { "database": "Reactome", "id": "R-HSA-937072", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-937072" } ], "reference": [ { "type": "PubMed", "id": "20047764", "url": "https://glygen.org/publication/PubMed/20047764" } ] }, { "title": "Lipopolysaccharide-binding protein-mediated Toll-like receptor 4 dimerization enables rapid signal transduction against lipopolysaccharide stimulation on membrane-associated CD14-expressing cells.", "journal": "International immunology", "date": "2010-04", "authors": "Tsukamoto Hiroki, Fukudome Kenji, Takao Shoko, Tsuneyoshi Naoko, Kimoto Masao", "evidence": [ { "database": "UniProtKB", "id": "P08571", "url": "https://www.uniprot.org/uniprot/P08571" } ], "reference": [ { "type": "PubMed", "id": "20133493", "url": "https://glygen.org/publication/PubMed/20133493" } ] }, { "title": "Inducible dimerization and inducible cleavage reveal a requirement for both processes in caspase-8 activation.", "journal": "The Journal of biological chemistry", "date": "2010", "authors": "Oberst A, Pop C, Tremblay AG, Blais V, Denault JB, Salvesen GS, Green DR", "evidence": [ { "database": "Reactome", "id": "R-HSA-140534", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140534" } ], "reference": [ { "type": "PubMed", "id": "20308068", "url": "https://glygen.org/publication/PubMed/20308068" } ] }, { "title": "Respiratory syncytial virus-mediated NF-kappa B p65 phosphorylation at serine 536 is dependent on RIG-I, TRAF6, and IKK beta.", "journal": "Journal of virology", "date": "2010", "authors": "Yoboua F, Martel A, Duval A, Mukawera E, Grandvaux N", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833110", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833110" } ], "reference": [ { "type": "PubMed", "id": "20410276", "url": "https://glygen.org/publication/PubMed/20410276" } ] }, { "title": "The Toll-like receptor 4 ligands Mrp8 and Mrp14 are crucial in the development of autoreactive CD8+ T cells.", "journal": "Nature medicine", "date": "2010", "authors": "Loser K, Vogl T, Voskort M, Lueken A, Kupas V, Nacken W, Klenner L, Kuhn A, Foell D, Sorokin L, Luger TA, Roth J, Beissert S", "evidence": [ { "database": "Reactome", "id": "R-HSA-5686938", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5686938" } ], "reference": [ { "type": "PubMed", "id": "20473308", "url": "https://glygen.org/publication/PubMed/20473308" } ] }, { "title": "Helical assembly in the MyD88-IRAK4-IRAK2 complex in TLR/IL-1R signalling.", "journal": "Nature", "date": "2010", "authors": "Lin SC, Lo YC, Wu H", "evidence": [ { "database": "Reactome", "id": "R-HSA-166058", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166058" } ], "reference": [ { "type": "PubMed", "id": "20485341", "url": "https://glygen.org/publication/PubMed/20485341" } ] }, { "title": "Two human MYD88 variants, S34Y and R98C, interfere with MyD88-IRAK4-myddosome assembly.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "George J, Motshwene PG, Wang H, Kubarenko AV, Rautanen A, Mills TC, Hill AV, Gay NJ, Weber AN", "evidence": [ { "database": "Reactome", "id": "R-HSA-5602498", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5602498" } ], "reference": [ { "type": "PubMed", "id": "20966070", "url": "https://glygen.org/publication/PubMed/20966070" } ] }, { "title": "Human interleukin-1 receptor-associated kinase-2 is essential for Toll-like receptor-mediated transcriptional and post-transcriptional regulation of tumor necrosis factor alpha.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Flannery SM, Keating SE, Szymak J, Bowie AG", "evidence": [ { "database": "Reactome", "id": "R-HSA-166058", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166058" } ], "reference": [ { "type": "PubMed", "id": "21606490", "url": "https://glygen.org/publication/PubMed/21606490" } ] }, { "title": "The Ripoptosome, a signaling platform that assembles in response to genotoxic stress and loss of IAPs.", "journal": "Molecular cell", "date": "2011", "authors": "Tenev T, Bianchi K, Darding M, Broemer M, Langlais C, Wallberg F, Zachariou A, Lopez J, MacFarlane M, Cain K, Meier P", "evidence": [ { "database": "Reactome", "id": "R-HSA-2562578", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2562578" } ], "reference": [ { "type": "PubMed", "id": "21737329", "url": "https://glygen.org/publication/PubMed/21737329" } ] }, { "title": "cIAPs block Ripoptosome formation, a RIP1/caspase-8 containing intracellular cell death complex differentially regulated by cFLIP isoforms.", "journal": "Molecular cell", "date": "2011", "authors": "Feoktistova M, Geserick P, Kellert B, Dimitrova DP, Langlais C, Hupe M, Cain K, MacFarlane M, Hacker G, Leverkus M", "evidence": [ { "database": "Reactome", "id": "R-HSA-2562578", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2562578" } ], "reference": [ { "type": "PubMed", "id": "21737330", "url": "https://glygen.org/publication/PubMed/21737330" } ] }, { "title": "High mobility group box protein 1 in complex with lipopolysaccharide or IL-1 promotes an increased inflammatory phenotype in synovial fibroblasts.", "journal": "Arthritis research & therapy", "date": "2011", "authors": "Wahamaa H, Schierbeck H, Hreggvidsdottir HS, Palmblad K, Aveberger AC, Andersson U, Harris HE", "evidence": [ { "database": "Reactome", "id": "R-HSA-5686938", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5686938" } ], "reference": [ { "type": "PubMed", "id": "21871094", "url": "https://glygen.org/publication/PubMed/21871094" } ] }, { "title": "cIAP1/2 are direct E3 ligases conjugating diverse types of ubiquitin chains to receptor interacting proteins kinases 1 to 4 (RIP1-4).", "journal": "PloS one", "date": "2011", "authors": "Bertrand MJ, Lippens S, Staes A, Gilbert B, Roelandt R, De Medts J, Gevaert K, Declercq W, Vandenabeele P", "evidence": [ { "database": "Reactome", "id": "R-HSA-937041", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-937041" } ], "reference": [ { "type": "PubMed", "id": "21931591", "url": "https://glygen.org/publication/PubMed/21931591" } ] }, { "title": "CD14 controls the LPS-induced endocytosis of Toll-like receptor 4.", "journal": "Cell", "date": "2011", "authors": "Zanoni I, Ostuni R, Marek LR, Barresi S, Barbalat R, Barton GM, Granucci F, Kagan JC", "evidence": [ { "database": "Reactome", "id": "R-HSA-166016", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166016" } ], "reference": [ { "type": "PubMed", "id": "22078883", "url": "https://glygen.org/publication/PubMed/22078883" } ] }, { "title": "Respiratory syncytial virus glycoprotein G interacts with DC-SIGN and L-SIGN to activate ERK1 and ERK2.", "journal": "Journal of virology", "date": "2012-02", "authors": "Johnson Teresa R, McLellan Jason S, Graham Barney S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833110", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833110" } ], "reference": [ { "type": "PubMed", "id": "22090124", "url": "https://glygen.org/publication/PubMed/22090124" } ] }, { "title": "Toll-like receptors activate programmed necrosis in macrophages through a receptor-interacting kinase-3-mediated pathway.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2011", "authors": "He S, Liang Y, Shao F, Wang X", "evidence": [ { "database": "Reactome", "id": "R-HSA-2562578", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2562578" } ], "reference": [ { "type": "PubMed", "id": "22123964", "url": "https://glygen.org/publication/PubMed/22123964" } ] }, { "title": "Sec22b regulates phagosomal maturation and antigen crosspresentation by dendritic cells.", "journal": "Cell", "date": "2011", "authors": "Cebrian I, Visentin G, Blanchard N, Jouve M, Bobard A, Moita C, Enninga J, Moita LF, Amigorena S, Savina A", "evidence": [ { "database": "Reactome", "id": "R-HSA-1236974", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1236974" } ], "reference": [ { "type": "PubMed", "id": "22153078", "url": "https://glygen.org/publication/PubMed/22153078" } ] }, { "title": "Phospholipase Cgamma-2 and intracellular calcium are required for lipopolysaccharide-induced Toll-like receptor 4 (TLR4) endocytosis and interferon regulatory factor 3 (IRF3) activation.", "journal": "The Journal of biological chemistry", "date": "2012", "authors": "Chiang CY, Veckman V, Limmer K, David M", "evidence": [ { "database": "Reactome", "id": "R-HSA-166016", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166016" } ], "reference": [ { "type": "PubMed", "id": "22158869", "url": "https://glygen.org/publication/PubMed/22158869" } ] }, { "title": "Follistatin-related protein/follistatin-like 1 evokes an innate immune response via CD14 and toll-like receptor 4.", "journal": "FEBS letters", "date": "2012-02-17", "authors": "Murakami Kosaku, Tanaka Masao, Usui Takashi, Kawabata Daisuke, Shiomi Aoi, Iguchi-Hashimoto Mikiko, Shimizu Masakazu, Yukawa Naoichiro, Yoshifuji Hajime, Nojima Takaki, Ohmura Koichiro, Fujii Takao, Umehara Hisanori, Mimori Tsuneyo", "evidence": [ { "database": "UniProtKB", "id": "P08571", "url": "https://www.uniprot.org/uniprot/P08571" } ], "reference": [ { "type": "PubMed", "id": "22265692", "url": "https://glygen.org/publication/PubMed/22265692" } ] }, { "title": "The extracellular release of DNA and HMGB1 from Jurkat T cells during in vitro necrotic cell death.", "journal": "Innate immunity", "date": "2012", "authors": "Beyer C, Stearns NA, Giessl A, Distler JH, Schett G, Pisetsky DS", "evidence": [ { "database": "Reactome", "id": "R-HSA-5686938", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5686938" } ], "reference": [ { "type": "PubMed", "id": "22344226", "url": "https://glygen.org/publication/PubMed/22344226" } ] }, { "title": "Bruton's tyrosine kinase phosphorylates Toll-like receptor 3 to initiate antiviral response.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2012", "authors": "Lee KG, Xu S, Kang ZH, Huo J, Huang M, Liu D, Takeuchi O, Akira S, Lam KP", "evidence": [ { "database": "Reactome", "id": "R-HSA-166058", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166058" } ], "reference": [ { "type": "PubMed", "id": "22454496", "url": "https://glygen.org/publication/PubMed/22454496" } ] }, { "title": "Pro-inflammatory S100A8 and S100A9 proteins: self-assembly into multifunctional native and amyloid complexes.", "journal": "International journal of molecular sciences", "date": "2012", "authors": "Vogl T, Gharibyan AL, Morozova-Roche LA", "evidence": [ { "database": "Reactome", "id": "R-HSA-5686938", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5686938" } ], "reference": [ { "type": "PubMed", "id": "22489132", "url": "https://glygen.org/publication/PubMed/22489132" } ] }, { "title": "Quantification of the N-glycosylated secretome by super-SILAC during breast cancer progression and in human blood samples.", "journal": "Molecular & cellular proteomics : MCP", "date": "2013", "authors": "Boersema PJ, Geiger T, Wisniewski JR, Mann M", "evidence": [ { "database": "GlyGen", "id": "GLY_000143", "url": "https://data.glygen.org/GLY_000143" } ], "reference": [ { "type": "PubMed", "id": "23090970", "url": "https://glygen.org/publication/PubMed/23090970" } ] }, { "title": "The crystal structure of human soluble CD14 reveals a bent solenoid with a hydrophobic amino-terminal pocket.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2013-02-01", "authors": "Kelley Stacy L, Lukk Tiit, Nair Satish K, Tapping Richard I", "evidence": [ { "database": "UniProtKB", "id": "P08571", "url": "https://www.uniprot.org/uniprot/P08571" } ], "reference": [ { "type": "PubMed", "id": "23264655", "url": "https://glygen.org/publication/PubMed/23264655" } ] }, { "title": "The many faces of HMGB1: molecular structure-functional activity in inflammation, apoptosis, and chemotaxis.", "journal": "Journal of leukocyte biology", "date": "2013", "authors": "Yang H, Antoine DJ, Andersson U, Tracey KJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5686938", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5686938" } ], "reference": [ { "type": "PubMed", "id": "23446148", "url": "https://glygen.org/publication/PubMed/23446148" } ] }, { "title": "Crystal structure and mechanism of activation of TANK-binding kinase 1.", "journal": "Cell reports", "date": "2013", "authors": "Larabi A, Devos JM, Ng SL, Nanao MH, Round A, Maniatis T, Panne D", "evidence": [ { "database": "Reactome", "id": "R-HSA-936964", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-936964" } ], "reference": [ { "type": "PubMed", "id": "23453971", "url": "https://glygen.org/publication/PubMed/23453971" } ] }, { "title": "IkappaB kinase phosphorylation of SNAP-23 controls platelet secretion.", "journal": "Blood", "date": "2013", "authors": "Karim ZA, Zhang J, Banerjee M, Chicka MC, Al Hawas R, Hamilton TR, Roche PA, Whiteheart SW", "evidence": [ { "database": "Reactome", "id": "R-HSA-1236974", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1236974" } ], "reference": [ { "type": "PubMed", "id": "23613522", "url": "https://glygen.org/publication/PubMed/23613522" } ] }, { "title": "Proteome profiling of human neutrophil granule subsets, secretory vesicles, and cell membrane: correlation with transcriptome profiling of neutrophil precursors.", "journal": "Journal of leukocyte biology", "date": "2013", "authors": "Rorvig S, Ostergaard O, Heegaard NH, Borregaard N", "evidence": [ { "database": "Reactome", "id": "R-HSA-6798695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6798695" } ], "reference": [ { "type": "PubMed", "id": "23650620", "url": "https://glygen.org/publication/PubMed/23650620" } ] }, { "title": "CD14 and TLR4 mediate cytokine release promoted by electronegative LDL in monocytes.", "journal": "Atherosclerosis", "date": "2013-08", "authors": "Estruch Montserrat, Bancells Cristina, Beloki Lorea, Sanchez-Quesada Jose Luis, Ord\u00f3\u00f1ez-Llanos Jordi, Benitez Sonia", "evidence": [ { "database": "UniProtKB", "id": "P08571", "url": "https://www.uniprot.org/uniprot/P08571" } ], "reference": [ { "type": "PubMed", "id": "23880187", "url": "https://glygen.org/publication/PubMed/23880187" } ] }, { "title": "N-linked glycosylation enrichment for in-depth cell surface proteomics of diffuse large B-cell lymphoma subtypes.", "journal": "Molecular & cellular proteomics : MCP", "date": "2014", "authors": "Deeb SJ, Cox J, Schmidt-Supprian M, Mann M", "evidence": [ { "database": "GlyGen", "id": "GLY_000143", "url": "https://data.glygen.org/GLY_000143" } ], "reference": [ { "type": "PubMed", "id": "24190977", "url": "https://glygen.org/publication/PubMed/24190977" } ] }, { "title": "Functional assessment of the mutational effects of human IRAK4 and MyD88 genes.", "journal": "Molecular immunology", "date": "2014", "authors": "Yamamoto T, Tsutsumi N, Tochio H, Ohnishi H, Kubota K, Kato Z, Shirakawa M, Kondo N", "evidence": [ { "database": "Reactome", "id": "R-HSA-5603041", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5603041" } ], "reference": [ { "type": "PubMed", "id": "24316379", "url": "https://glygen.org/publication/PubMed/24316379" } ] }, { "title": "Nucleotide sequence of the gene encoding the monocyte differentiation antigen, CD14.", "journal": "Nucleic Acids Res.", "date": "1988", "authors": "Ferrero E, Goyert SM", "evidence": [ { "database": "UniProtKB", "id": "P08571", "url": "https://www.uniprot.org/uniprot/P08571" } ], "reference": [ { "type": "PubMed", "id": "2453848", "url": "https://glygen.org/publication/PubMed/2453848" } ] }, { "title": "CR3 (CD11b/CD18) expresses one binding site for Arg-Gly-Asp-containing peptides and a second site for bacterial lipopolysaccharide.", "journal": "The Journal of experimental medicine", "date": "1989", "authors": "Wright SD, Levin SM, Jong MT, Chad Z, Kabbash LG", "evidence": [ { "database": "Reactome", "id": "R-HSA-166016", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166016" } ], "reference": [ { "type": "PubMed", "id": "2462607", "url": "https://glygen.org/publication/PubMed/2462607" } ] }, { "title": "Monocyte antigen CD14 is a phospholipid anchored membrane protein.", "journal": "Blood", "date": "1989", "authors": "Simmons DL, Tan S, Tenen DG, Nicholson-Weller A, Seed B", "evidence": [ { "database": "UniProtKB", "id": "P08571", "url": "https://www.uniprot.org/uniprot/P08571" } ], "reference": [ { "type": "PubMed", "id": "2462937", "url": "https://glygen.org/publication/PubMed/2462937" } ] }, { "title": "Mouse and human CD14 (myeloid cell-specific leucine-rich glycoprotein) primary structure deduced from cDNA clones.", "journal": "Biochim. Biophys. Acta", "date": "1989", "authors": "Setoguchi M, Nasu N, Yoshida S, Higuchi Y, Akizuki S, Yamamoto S", "evidence": [ { "database": "UniProtKB", "id": "P08571", "url": "https://www.uniprot.org/uniprot/P08571" } ], "reference": [ { "type": "PubMed", "id": "2472171", "url": "https://glygen.org/publication/PubMed/2472171" } ] }, { "title": "Lipopolysaccharide (LPS) binding protein opsonizes LPS-bearing particles for recognition by a novel receptor on macrophages.", "journal": "The Journal of experimental medicine", "date": "1989", "authors": "Wright SD, Tobias PS, Ulevitch RJ, Ramos RA", "evidence": [ { "database": "Reactome", "id": "R-HSA-166016", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166016" } ], "reference": [ { "type": "PubMed", "id": "2477488", "url": "https://glygen.org/publication/PubMed/2477488" } ] }, { "title": "S100A1 is released from ischemic cardiomyocytes and signals myocardial damage via Toll-like receptor 4.", "journal": "EMBO molecular medicine", "date": "2014", "authors": "Rohde D, Schon C, Boerries M, Didrihsone I, Ritterhoff J, Kubatzky KF, Volkers M, Herzog N, Mahler M, Tsoporis JN, Parker TG, Linke B, Giannitsis E, Gao E, Peppel K, Katus HA, Most P", "evidence": [ { "database": "Reactome", "id": "R-HSA-5686938", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5686938" } ], "reference": [ { "type": "PubMed", "id": "24833748", "url": "https://glygen.org/publication/PubMed/24833748" } ] }, { "title": "TLR signals induce phagosomal MHC-I delivery from the endosomal recycling compartment to allow cross-presentation.", "journal": "Cell", "date": "2014", "authors": "Nair-Gupta P, Baccarini A, Tung N, Seyffer F, Florey O, Huang Y, Banerjee M, Overholtzer M, Roche PA, Tampe R, Brown BD, Amsen D, Whiteheart SW, Blander JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-1236974", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1236974" } ], "reference": [ { "type": "PubMed", "id": "25083866", "url": "https://glygen.org/publication/PubMed/25083866" } ] }, { "title": "27-Hydroxycholesterol up-regulates CD14 and predisposes monocytic cells to superproduction of CCL2 in response to lipopolysaccharide.", "journal": "Biochim. Biophys. Acta", "date": "2015", "authors": "Kim Sun-Mi, Kim Bo-Young, Eo Seong-Kug, Kim Chi-Dae, Kim Koanhoi", "evidence": [ { "database": "UniProtKB", "id": "P08571", "url": "https://www.uniprot.org/uniprot/P08571" } ], "reference": [ { "type": "PubMed", "id": "25497142", "url": "https://glygen.org/publication/PubMed/25497142" } ] }, { "title": "Phosphatase PTPN4 preferentially inhibits TRIF-dependent TLR4 pathway by dephosphorylating TRAM.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2015", "authors": "Huai W, Song H, Wang L, Li B, Zhao J, Han L, Gao C, Jiang G, Zhang L, Zhao W", "evidence": [ { "database": "Reactome", "id": "R-HSA-166016", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166016" } ], "reference": [ { "type": "PubMed", "id": "25825441", "url": "https://glygen.org/publication/PubMed/25825441" } ] }, { "title": "Interaction between human BAP31 and respiratory syncytial virus small hydrophobic (SH) protein.", "journal": "Virology", "date": "2015-08", "authors": "Li Yan, Jain Neeraj, Limpanawat Suweeraya, To Janet, Quistgaard Esben M, Nordlund Par, Thanabalu Thirumaran, Torres Jaume", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833110", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833110" } ], "reference": [ { "type": "PubMed", "id": "25854864", "url": "https://glygen.org/publication/PubMed/25854864" } ] }, { "title": "Role of S100A1 in hypoxia-induced inflammatory response in cardiomyocytes via TLR4/ROS/NF-kappaB pathway.", "journal": "The Journal of pharmacy and pharmacology", "date": "2015", "authors": "Yu J, Lu Y, Li Y, Xiao L, Xing Y, Li Y, Wu L", "evidence": [ { "database": "Reactome", "id": "R-HSA-5686938", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5686938" } ], "reference": [ { "type": "PubMed", "id": "25880347", "url": "https://glygen.org/publication/PubMed/25880347" } ] }, { "title": "SP-R210 (Myo18A) isoforms as intrinsic modulators of macrophage priming and activation.", "journal": "PLoS ONE", "date": "2015", "authors": "Yang L, Carrillo M, Wu YM, DiAngelo SL, Silveyra P, Umstead TM, Halstead ES, Davies ML, Hu S, Floros J, McCormack FX, Christensen ND, Chroneos ZC", "evidence": [ { "database": "UniProtKB", "id": "P08571", "url": "https://www.uniprot.org/uniprot/P08571" } ], "reference": [ { "type": "PubMed", "id": "25965346", "url": "https://glygen.org/publication/PubMed/25965346" } ] }, { "title": "Structural relationship between the soluble and membrane-bound forms of human monocyte surface glycoprotein CD14.", "journal": "Mol. Immunol.", "date": "1989", "authors": "Bazil V, Baudys M, Hilgert I, Stefanov\u00e1 I, Low M G, Zbrozek J, Horejs\u00ed V", "evidence": [ { "database": "UniProtKB", "id": "P08571", "url": "https://www.uniprot.org/uniprot/P08571" } ], "reference": [ { "type": "PubMed", "id": "2779588", "url": "https://glygen.org/publication/PubMed/2779588" } ] }, { "title": "Respiratory syncytial virus prolifically infects N2a neuronal cells, leading to TLR4 and nucleolin protein modulations and RSV F protein co-localization with TLR4 and nucleolin.", "journal": "Journal of biomedical science", "date": "2018", "authors": "Yuan X, Hu T, He H, Qiu H, Wu X, Chen J, Wang M, Chen C, Huang S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9820960", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9820960" } ], "reference": [ { "type": "PubMed", "id": "29427996", "url": "https://glygen.org/publication/PubMed/29427996" } ] }, { "title": "Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and alpha-1B-Glycoprotein.", "journal": "Analytical chemistry", "date": "2018", "authors": "Sun S, Hu Y, Jia L, Eshghi ST, Liu Y, Shah P, Zhang H", "evidence": [ { "database": "UniCarbKB", "id": "P08571", "url": "" }, { "database": "GlyConnect", "id": "774", "url": "https://glyconnect.expasy.org/browser/proteins/774" } ], "reference": [ { "type": "PubMed", "id": "29671580", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "title": "Reanalysis of Global Proteomic and Phosphoproteomic Data Identified a Large Number of Glycopeptides.", "journal": "Analytical chemistry", "date": "2018", "authors": "Hu Y, Shah P, Clark DJ, Ao M, Zhang H", "evidence": [ { "database": "GlyConnect", "id": "774", "url": "https://glyconnect.expasy.org/browser/proteins/774" } ], "reference": [ { "type": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "title": "Mapping the O-glycoproteome using site-specific extraction of O-linked glycopeptides (EXoO).", "journal": "Molecular systems biology", "date": "2018", "authors": "Yang W, Ao M, Hu Y, Li QK, Zhang H", "evidence": [ { "database": "UniCarbKB", "id": "P08571", "url": "" } ], "reference": [ { "type": "PubMed", "id": "30459171", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "title": "Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes.", "journal": "Journal of proteome research", "date": "2020", "authors": "Zhu J, Lin YH, Dingess KA, Mank M, Stahl B, Heck AJR", "evidence": [ { "database": "GlyConnect", "id": "774", "url": "https://glyconnect.expasy.org/browser/proteins/774" } ], "reference": [ { "type": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "title": "The monocyte differentiation antigen, CD14, is anchored to the cell membrane by a phosphatidylinositol linkage.", "journal": "J. Immunol.", "date": "1988", "authors": "Haziot A, Chen S, Ferrero E, Low MG, Silber R, Goyert SM", "evidence": [ { "database": "UniProtKB", "id": "P08571", "url": "https://www.uniprot.org/uniprot/P08571" } ], "reference": [ { "type": "PubMed", "id": "3385210", "url": "https://glygen.org/publication/PubMed/3385210" } ] }, { "title": "Adhesion-promoting receptors on human macrophages recognize Escherichia coli by binding to lipopolysaccharide.", "journal": "The Journal of experimental medicine", "date": "1986", "authors": "Wright SD, Jong MT", "evidence": [ { "database": "Reactome", "id": "R-HSA-166016", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166016" } ], "reference": [ { "type": "PubMed", "id": "3537192", "url": "https://glygen.org/publication/PubMed/3537192" } ] }, { "title": "An Unexpected Encounter: Respiratory Syncytial Virus Nonstructural Protein 1 Interacts with Mediator Subunit MED25.", "journal": "Journal of virology", "date": "2022-10-12", "authors": "Van Royen Tessa, Sedeyn Koen, Moschonas George D, Toussaint Wendy, Vuylsteke Marnik, Van Haver Delphi, Impens Francis, Eyckerman Sven, Lemmens Irma, Tavernier Jan, Schepens Bert, Saelens Xavier", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833110", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833110" } ], "reference": [ { "type": "PubMed", "id": "36102648", "url": "https://glygen.org/publication/PubMed/36102648" } ] }, { "title": "Increased circulating levels of MIP-1\u03b1 and CD14 are associated with the presence of severe stenosis and hypoechoic plaques in patients with carotid atherosclerosis.", "journal": "International journal of immunopathology and pharmacology", "date": "2023", "authors": "Profumo Elisabetta, Buttari Brigitta, Tosti Maria Elena, Salvati Bruno, Capoano Raffaele, Rigan\u00f2 Rachele", "evidence": [ { "database": "RefSeq", "id": "NP_000582", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000582" } ], "reference": [ { "type": "PubMed", "id": "37478026", "url": "https://glygen.org/publication/PubMed/37478026" } ] }, { "title": "Multifaceted role of CD14 in innate immunity and tissue homeostasis.", "journal": "Cytokine & growth factor reviews", "date": "2023-12", "authors": "Na Kunhee, Oh Byung-Chul, Jung YunJae", "evidence": [ { "database": "RefSeq", "id": "NP_000582", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000582" } ], "reference": [ { "type": "PubMed", "id": "37661484", "url": "https://glygen.org/publication/PubMed/37661484" } ] }, { "title": "Severity of Schistosoma haematobium co-infection with malaria in school-children is potentially modulated by host CD14 gene variants.", "journal": "BMC research notes", "date": "2023-09-08", "authors": "Oboh-Imafidon Mary A, Torbit Sabrina M, Jacob Swathi, Schroeter Marissa N, Tucker Ashley R, Ojurongbe Olusola, Thomas Bolaji N", "evidence": [ { "database": "RefSeq", "id": "NP_000582", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000582" } ], "reference": [ { "type": "PubMed", "id": "37684680", "url": "https://glygen.org/publication/PubMed/37684680" } ] }, { "title": "Decreased expression of TIGIT on CD14\u2009+\u2009monocytes correlates with clinical features and laboratory parameters of patients with primary Sj\u00f6gren's syndrome.", "journal": "Clinical rheumatology", "date": "2024-01", "authors": "Zhao Ping, Peng Cheng, Chang Xin, Cheng Wei, Yang Yanhong, Shen Yu, Sun Chao, Feng Xiuyuan, Liu Cuiping, Wu Jian", "evidence": [ { "database": "RefSeq", "id": "NP_000582", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000582" } ], "reference": [ { "type": "PubMed", "id": "37749409", "url": "https://glygen.org/publication/PubMed/37749409" } ] }, { "title": "The role of CD14 and CSF1R in osteoarthritis and gastritis.", "journal": "Medicine", "date": "2023-10-27", "authors": "Zheng Meiliang, Li Zheng, Feng Yingfa, Hou Shiyang, Zhang Jie, Kang Chunbo", "evidence": [ { "database": "RefSeq", "id": "NP_000582", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000582" } ], "reference": [ { "type": "PubMed", "id": "37904379", "url": "https://glygen.org/publication/PubMed/37904379" } ] }, { "title": "CD36 is a receptor for oxidized low density lipoprotein.", "journal": "The Journal of biological chemistry", "date": "1993", "authors": "Endemann G, Stanton LW, Madden KS, Bryant CM, White RT, Protter AA", "evidence": [ { "database": "Reactome", "id": "R-HSA-5686938", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5686938" } ], "reference": [ { "type": "PubMed", "id": "7685021", "url": "https://glygen.org/publication/PubMed/7685021" } ] }, { "title": "Resistance to endotoxin shock and reduced dissemination of gram-negative bacteria in CD14-deficient mice.", "journal": "Immunity", "date": "1996", "authors": "Haziot A, Ferrero E, Kontgen F, Hijiya N, Yamamoto S, Silver J, Stewart CL, Goyert SM", "evidence": [ { "database": "UniProtKB", "id": "P08571", "url": "https://www.uniprot.org/uniprot/P08571" } ], "reference": [ { "type": "PubMed", "id": "8612135", "url": "https://glygen.org/publication/PubMed/8612135" } ] }, { "title": "Targeting of proteins to granule subsets is determined by timing and not by sorting: The specific granule protein NGAL is localized to azurophil granules when expressed in HL-60 cells.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1996", "authors": "Le Cabec V, Cowland JB, Calafat J, Borregaard N", "evidence": [ { "database": "Reactome", "id": "R-HSA-6798695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6798695" } ], "reference": [ { "type": "PubMed", "id": "8692836", "url": "https://glygen.org/publication/PubMed/8692836" } ] }, { "title": "TRAF6 is a signal transducer for interleukin-1.", "journal": "Nature", "date": "1996", "authors": "Cao Z, Xiong J, Takeuchi M, Kurama T, Goeddel DV", "evidence": [ { "database": "Reactome", "id": "R-HSA-166058", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166058" } ], "reference": [ { "type": "PubMed", "id": "8837778", "url": "https://glygen.org/publication/PubMed/8837778" } ] }, { "title": "Activation of the IkappaB alpha kinase complex by MEKK1, a kinase of the JNK pathway.", "journal": "Cell", "date": "1997", "authors": "Lee FS, Hagler J, Chen ZJ, Maniatis T", "evidence": [ { "database": "Reactome", "id": "R-HSA-166058", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166058" } ], "reference": [ { "type": "PubMed", "id": "9008162", "url": "https://glygen.org/publication/PubMed/9008162" } ] }, { "title": "MyD88: an adapter that recruits IRAK to the IL-1 receptor complex.", "journal": "Immunity", "date": "1997", "authors": "Wesche H, Henzel WJ, Shillinglaw W, Li S, Cao Z", "evidence": [ { "database": "Reactome", "id": "R-HSA-166058", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166058" } ], "reference": [ { "type": "PubMed", "id": "9430229", "url": "https://glygen.org/publication/PubMed/9430229" } ] }, { "title": "Virus-dependent phosphorylation of the IRF-3 transcription factor regulates nuclear translocation, transactivation potential, and proteasome-mediated degradation.", "journal": "Molecular and cellular biology", "date": "1998", "authors": "Lin R, Heylbroeck C, Pitha PM, Hiscott J", "evidence": [ { "database": "Reactome", "id": "R-HSA-936964", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-936964" } ], "reference": [ { "type": "PubMed", "id": "9566918", "url": "https://glygen.org/publication/PubMed/9566918" } ] }, { "title": "LPS-binding proteins and receptors.", "journal": "Journal of leukocyte biology", "date": "1998", "authors": "Fenton MJ, Golenbock DT", "evidence": [ { "database": "Reactome", "id": "R-HSA-166020", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166020" } ], "reference": [ { "type": "PubMed", "id": "9665271", "url": "https://glygen.org/publication/PubMed/9665271" } ] }, { "title": "Tumor necrosis factor receptor-associated factors (TRAFs)--a family of adapter proteins that regulates life and death.", "journal": "Genes & development", "date": "1998", "authors": "Arch RH, Gedrich RW, Thompson CB", "evidence": [ { "database": "Reactome", "id": "R-HSA-937072", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-937072" } ], "reference": [ { "type": "PubMed", "id": "9744859", "url": "https://glygen.org/publication/PubMed/9744859" } ] } ], "pathway": [ { "id": "hsa:929", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:929", "resource": "KEGG Pathway" }, { "id": "R-HSA-1236974", "name": "ER-Phagosome pathway", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1236974", "resource": "Reactome", "description": "ER-Phagosome pathway" }, { "id": "R-HSA-140534", "name": "Caspase activation via Death Receptors in the presence of ligand", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140534", "resource": "Reactome", "description": "Caspase activation via Death Receptors in the presence of ligand" }, { "id": "R-HSA-166016", "name": "Toll Like Receptor 4 (TLR4) Cascade", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166016", "resource": "Reactome", "description": "Toll Like Receptor 4 (TLR4) Cascade" }, { "id": "R-HSA-166020", "name": "Transfer of LPS from LBP carrier to CD14", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166020", "resource": "Reactome", "description": "Transfer of LPS from LBP carrier to CD14" }, { "id": "R-HSA-166058", "name": "MyD88:MAL(TIRAP) cascade initiated on plasma membrane", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166058", "resource": "Reactome", "description": "MyD88:MAL(TIRAP) cascade initiated on plasma membrane" }, { "id": "R-HSA-166166", "name": "MyD88-independent TLR4 cascade", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166166", "resource": "Reactome", "description": "MyD88-independent TLR4 cascade" }, { "id": "R-HSA-168179", "name": "Toll Like Receptor TLR1:TLR2 Cascade", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-168179", "resource": "Reactome", "description": "Toll Like Receptor TLR1:TLR2 Cascade" }, { "id": "R-HSA-168188", "name": "Toll Like Receptor TLR6:TLR2 Cascade", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-168188", "resource": "Reactome", "description": "Toll Like Receptor TLR6:TLR2 Cascade" }, { "id": "R-HSA-2562578", "name": "TRIF-mediated programmed cell death", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2562578", "resource": "Reactome", "description": "TRIF-mediated programmed cell death" }, { "id": "R-HSA-5602498", "name": "MyD88 deficiency (TLR2/4)", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5602498", "resource": "Reactome", "description": "MyD88 deficiency (TLR2/4)" }, { "id": "R-HSA-5603041", "name": "IRAK4 deficiency (TLR2/4)", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5603041", "resource": "Reactome", "description": "IRAK4 deficiency (TLR2/4)" }, { "id": "R-HSA-5686938", "name": "Regulation of TLR by endogenous ligand", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5686938", "resource": "Reactome", "description": "Regulation of TLR by endogenous ligand" }, { "id": "R-HSA-6798695", "name": "Neutrophil degranulation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6798695", "resource": "Reactome", "description": "Neutrophil degranulation" }, { "id": "R-HSA-936964", "name": "Activation of IRF3, IRF7 mediated by TBK1, IKBKE", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-936964", "resource": "Reactome", "description": "Activation of IRF3, IRF7 mediated by TBK1, IKBKE" }, { "id": "R-HSA-937041", "name": "IKK complex recruitment mediated by RIP1", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-937041", "resource": "Reactome", "description": "IKK complex recruitment mediated by RIP1" }, { "id": "R-HSA-937072", "name": "TRAF6-mediated induction of TAK1 complex within TLR4 complex", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-937072", "resource": "Reactome", "description": "TRAF6-mediated induction of TAK1 complex within TLR4 complex" }, { "id": "R-HSA-975163", "name": "IRAK2 mediated activation of TAK1 complex upon TLR7/8 or 9 stimulation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975163", "resource": "Reactome", "description": "IRAK2 mediated activation of TAK1 complex upon TLR7/8 or 9 stimulation" }, { "id": "R-HSA-9820960", "name": "Respiratory syncytial virus (RSV) attachment and entry", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9820960", "resource": "Reactome", "description": "Respiratory syncytial virus (RSV) attachment and entry" }, { "id": "R-HSA-9833110", "name": "RSV-host interactions", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833110", "resource": "Reactome", "description": "RSV-host interactions" } ], "orthologs": [ { "uniprot_canonical_ac": "P10810-1", "protein_name": "Monocyte differentiation antigen CD14", "gene_name": "Cd14", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MERVLGLLLLLLVHASPAPPEPCELDEESCSCNFSDPKPDWSSAFNCLGAADVELYGGGRSLEYLLKRVDTEADLGQFTDIIKSLSLKRLTVRAARIPSRILFGALRVLGISGLQELTLENLEVTGTAPPPLLEATGPDLNILNLRNVSWATRDAWLAELQQWLKPGLKVLSIAQAHSLNFSCEQVRVFPALSTLDLSDNPELGERGLISALCPLKFPTLQVLALRNAGMETPSGVCSALAAARVQLQGLDLSHNSLRDAAGAPSCDWPSQLNSLNLSFTGLKQVPKGLPAKLSVLDLSYNRLDRNPSPDELPQVGNLSLKGNPFLDSESHSEKFNSGVVTAGAPSSQAVALSGTLALLLGDRLFV", "length": 366 }, "evidence": [ { "id": "45933267", "url": "http://www.informatics.jax.org/homology/45933267", "database": "MGI" }, { "id": "P08571", "url": "https://omabrowser.org/oma/group/P08571/", "database": "OMA" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q63691-1", "protein_name": "Monocyte differentiation antigen CD14", "gene_name": "Cd14", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MKLMLGLLLLPLTLVHASPATPEPCELDQDEESVRCYCNFSDPQPNWSSAFLCAGAEDVEFYGGGRSLEYLLKRVDTEANLGQYTDIIRSLPLKRLTVRSARVPTQILFGTLRVLGYSGLRELTLENLEVTGTALSPLLDATGPDLNTLSLRNVSWATTDTWLAELQQWLKPGLKVLSIAQAHSLNFSCKQVGVFPALATLDLSDNPELGEKGLISALCPHKFPTLQVLALRNAGMETTSGVCSALAAARVPLQALDLSHNSLRDTAGTPSCDWPSQLNSLNLSFTGLEHVPKGLPAKLSVLDLSYNRLDRKPRPEELPEVGSLSLTGNPFLHSESQSEAYNSGVVIATALSPGSAGLSGTLALLLGHRLFV", "length": 372 }, "evidence": [ { "id": "45933267", "url": "http://www.informatics.jax.org/homology/45933267", "database": "MGI" }, { "id": "P08571", "url": "https://omabrowser.org/oma/group/P08571/", "database": "OMA" } ], "common_name": "Rat" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 10, "go_terms": [ { "name": "extracellular region", "id": "GO:0005576", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576", "evidence": [ { "database": "UniProtKB", "id": "P08571", "url": "https://www.uniprot.org/uniprot/P08571" } ], "pmid": "" }, { "name": "Golgi apparatus", "id": "GO:0005794", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005794", "evidence": [ { "database": "UniProtKB", "id": "P08571", "url": "https://www.uniprot.org/uniprot/P08571" } ], "pmid": "" }, { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "P08571", "url": "https://www.uniprot.org/uniprot/P08571" } ], "pmid": "" }, { "name": "membrane raft", "id": "GO:0045121", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045121", "evidence": [ { "database": "UniProtKB", "id": "P08571", "url": "https://www.uniprot.org/uniprot/P08571" } ], "pmid": "" }, { "name": "extracellular space", "id": "GO:0005615", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005615", "evidence": [ { "database": "UniProtKB", "id": "P08571", "url": "https://www.uniprot.org/uniprot/P08571" } ], "pmid": "" }, { "name": "extracellular exosome", "id": "GO:0070062", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070062", "evidence": [ { "database": "UniProtKB", "id": "P08571", "url": "https://www.uniprot.org/uniprot/P08571" } ], "pmid": "" }, { "name": "external side of plasma membrane", "id": "GO:0009897", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009897", "evidence": [ { "database": "UniProtKB", "id": "P08571", "url": "https://www.uniprot.org/uniprot/P08571" } ], "pmid": "" }, { "name": "secretory granule membrane", "id": "GO:0030667", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030667", "evidence": [ { "database": "UniProtKB", "id": "P08571", "url": "https://www.uniprot.org/uniprot/P08571" } ], "pmid": "" }, { "name": "endosome membrane", "id": "GO:0010008", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010008", "evidence": [ { "database": "UniProtKB", "id": "P08571", "url": "https://www.uniprot.org/uniprot/P08571" } ], "pmid": "" }, { "name": "lipopolysaccharide receptor complex", "id": "GO:0046696", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046696", "evidence": [ { "database": "UniProtKB", "id": "P08571", "url": "https://www.uniprot.org/uniprot/P08571" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 25, "go_terms": [ { "name": "inflammatory response", "id": "GO:0006954", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006954", "evidence": [ { "database": "UniProtKB", "id": "P08571", "url": "https://www.uniprot.org/uniprot/P08571" } ], "pmid": "" }, { "name": "cell surface receptor signaling pathway", "id": "GO:0007166", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007166", "evidence": [ { "database": "UniProtKB", "id": "P08571", "url": "https://www.uniprot.org/uniprot/P08571" } ], "pmid": "" }, { "name": "response to tumor necrosis factor", "id": "GO:0034612", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034612", "evidence": [ { "database": "UniProtKB", "id": "P08571", "url": "https://www.uniprot.org/uniprot/P08571" } ], "pmid": "" }, { "name": "innate immune response", "id": "GO:0045087", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045087", "evidence": [ { "database": "UniProtKB", "id": "P08571", "url": "https://www.uniprot.org/uniprot/P08571" } ], "pmid": "" }, { "name": "response to ethanol", "id": "GO:0045471", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045471", "evidence": [ { "database": "UniProtKB", "id": "P08571", "url": "https://www.uniprot.org/uniprot/P08571" } ], "pmid": "" }, { "name": "phagocytosis", "id": "GO:0006909", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006909", "evidence": [ { "database": "UniProtKB", "id": "P08571", "url": "https://www.uniprot.org/uniprot/P08571" } ], "pmid": "" }, { "name": "apoptotic process", "id": "GO:0006915", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006915", "evidence": [ { "database": "UniProtKB", "id": "P08571", "url": "https://www.uniprot.org/uniprot/P08571" } ], "pmid": "" }, { "name": "cellular response to lipopolysaccharide", "id": "GO:0071222", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071222", "evidence": [ { "database": "UniProtKB", "id": "P08571", "url": "https://www.uniprot.org/uniprot/P08571" } ], "pmid": "" }, { "name": "positive regulation of cytokine production", "id": "GO:0001819", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001819", "evidence": [ { "database": "UniProtKB", "id": "P08571", "url": "https://www.uniprot.org/uniprot/P08571" } ], "pmid": "" }, { "name": "receptor-mediated endocytosis", "id": "GO:0006898", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006898", "evidence": [ { "database": "UniProtKB", "id": "P08571", "url": "https://www.uniprot.org/uniprot/P08571" } ], "pmid": "" }, { "name": "positive regulation of tumor necrosis factor production", "id": "GO:0032760", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032760", "evidence": [ { "database": "UniProtKB", "id": "P08571", "url": "https://www.uniprot.org/uniprot/P08571" } ], "pmid": "" }, { "name": "positive regulation of type II interferon production", "id": "GO:0032729", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032729", "evidence": [ { "database": "UniProtKB", "id": "P08571", "url": "https://www.uniprot.org/uniprot/P08571" } ], "pmid": "" }, { "name": "response to electrical stimulus", "id": "GO:0051602", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051602", "evidence": [ { "database": "UniProtKB", "id": "P08571", "url": "https://www.uniprot.org/uniprot/P08571" } ], "pmid": "" }, { "name": "positive regulation of interleukin-8 production", "id": "GO:0032757", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032757", "evidence": [ { "database": "UniProtKB", "id": "P08571", "url": "https://www.uniprot.org/uniprot/P08571" } ], "pmid": "" }, { "name": "positive regulation of endocytosis", "id": "GO:0045807", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045807", "evidence": [ { "database": "UniProtKB", "id": "P08571", "url": "https://www.uniprot.org/uniprot/P08571" } ], "pmid": "" }, { "name": "positive regulation of type I interferon production", "id": "GO:0032481", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032481", "evidence": [ { "database": "UniProtKB", "id": "P08571", "url": "https://www.uniprot.org/uniprot/P08571" } ], "pmid": "" }, { "name": "cellular response to lipoteichoic acid", "id": "GO:0071223", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071223", "evidence": [ { "database": "UniProtKB", "id": "P08571", "url": "https://www.uniprot.org/uniprot/P08571" } ], "pmid": "" }, { "name": "cellular response to diacyl bacterial lipopeptide", "id": "GO:0071726", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071726", "evidence": [ { "database": "UniProtKB", "id": "P08571", "url": "https://www.uniprot.org/uniprot/P08571" } ], "pmid": "" }, { "name": "positive regulation of toll-like receptor 4 signaling pathway", "id": "GO:0034145", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034145", "evidence": [ { "database": "UniProtKB", "id": "P08571", "url": "https://www.uniprot.org/uniprot/P08571" } ], "pmid": "" }, { "name": "toll-like receptor 4 signaling pathway", "id": "GO:0034142", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034142", "evidence": [ { "database": "UniProtKB", "id": "P08571", "url": "https://www.uniprot.org/uniprot/P08571" } ], "pmid": "" }, { "name": "positive regulation of lipopolysaccharide-mediated signaling pathway", "id": "GO:0031666", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031666", "evidence": [ { "database": "UniProtKB", "id": "P08571", "url": "https://www.uniprot.org/uniprot/P08571" } ], "pmid": "" }, { "name": "response to magnesium ion", "id": "GO:0032026", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032026", "evidence": [ { "database": "UniProtKB", "id": "P08571", "url": "https://www.uniprot.org/uniprot/P08571" } ], "pmid": "" }, { "name": "cellular response to molecule of bacterial origin", "id": "GO:0071219", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071219", "evidence": [ { "database": "UniProtKB", "id": "P08571", "url": "https://www.uniprot.org/uniprot/P08571" } ], "pmid": "" }, { "name": "cellular response to triacyl bacterial lipopeptide", "id": "GO:0071727", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071727", "evidence": [ { "database": "UniProtKB", "id": "P08571", "url": "https://www.uniprot.org/uniprot/P08571" } ], "pmid": "" }, { "name": "cell surface pattern recognition receptor signaling pathway", "id": "GO:0002752", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002752", "evidence": [ { "database": "UniProtKB", "id": "P08571", "url": "https://www.uniprot.org/uniprot/P08571" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 5, "go_terms": [ { "name": "lipopolysaccharide binding", "id": "GO:0001530", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001530", "evidence": [ { "database": "UniProtKB", "id": "P08571", "url": "https://www.uniprot.org/uniprot/P08571" } ], "pmid": "" }, { "name": "lipoteichoic acid binding", "id": "GO:0070891", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070891", "evidence": [ { "database": "UniProtKB", "id": "P08571", "url": "https://www.uniprot.org/uniprot/P08571" } ], "pmid": "" }, { "name": "opsonin receptor activity", "id": "GO:0001847", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001847", "evidence": [ { "database": "UniProtKB", "id": "P08571", "url": "https://www.uniprot.org/uniprot/P08571" } ], "pmid": "" }, { "name": "peptidoglycan immune receptor activity", "id": "GO:0016019", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016019", "evidence": [ { "database": "UniProtKB", "id": "P08571", "url": "https://www.uniprot.org/uniprot/P08571" } ], "pmid": "" }, { "name": "lipopolysaccharide immune receptor activity", "id": "GO:0001875", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001875", "evidence": [ { "database": "UniProtKB", "id": "P08571", "url": "https://www.uniprot.org/uniprot/P08571" } ], "pmid": "" } ] } ] }, "pro_annotation": [ { "name": "monocyte differentiation antigen CD14 N-glycosylated 1 (human)", "definition": "A monocyte differentiation antigen CD14 (human) that has been N-glycosylated at the residue equivalent to Asn-151 of the amino acid sequence represented by UniProtKB:P08571-1, in which the glycan composition is represented by GlyTouCan:G59626AS. Example: UniProtKB:P08571-1, Asn-151, MOD:00160~GNO:G59626AS. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000054476", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054476" } ] }, { "name": "monocyte differentiation antigen CD14 O-glycosylated 1 (human)", "definition": "A monocyte differentiation antigen CD14 (human) that has been O-glycosylated at the residue equivalent to Ser-362 of the amino acid sequence represented by UniProtKB:P08571-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P08571-1, Ser-362, MOD:00002~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000054477", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054477" } ] }, { "name": "monocyte differentiation antigen CD14 O-glycosylated 2 (human)", "definition": "A monocyte differentiation antigen CD14 (human) that has been O-glycosylated at the residue equivalent to Thr-336 of the amino acid sequence represented by UniProtKB:P08571-1, in which the glycan composition is represented by GlyTouCan:G27391WQ. Example: UniProtKB:P08571-1, Thr-336, MOD:00005~GNO:G27391WQ. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000054478", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054478" } ] }, { "name": "monocyte differentiation antigen CD14 O-glycosylated 3 (human)", "definition": "A monocyte differentiation antigen CD14 (human) that has been O-glycosylated at the residue equivalent to Thr-336 of the amino acid sequence represented by UniProtKB:P08571-1, in which the glycan composition is represented by GlyTouCan:G29068FM. Example: UniProtKB:P08571-1, Thr-336, MOD:00005~GNO:G29068FM. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000054479", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054479" } ] }, { "name": "monocyte differentiation antigen CD14 O-glycosylated 4 (human)", "definition": "A monocyte differentiation antigen CD14 (human) that has been O-glycosylated at the residue equivalent to Thr-336 of the amino acid sequence represented by UniProtKB:P08571-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P08571-1, Thr-336, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000054480", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054480" } ] }, { "name": "monocyte differentiation antigen CD14 O-glycosylated 5 (human)", "definition": "A monocyte differentiation antigen CD14 (human) that has been O-glycosylated at the residue equivalent to Thr-364 of the amino acid sequence represented by UniProtKB:P08571-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P08571-1, Thr-364, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000054481", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054481" } ] } ], "site_annotation": [ { "start_pos": 151, "end_pos": 153, "annotation": "n_glycosylation_sequon" }, { "start_pos": 282, "end_pos": 284, "annotation": "n_glycosylation_sequon" }, { "start_pos": 323, "end_pos": 325, "annotation": "n_glycosylation_sequon" }, { "start_pos": 37, "end_pos": 39, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "N- and O- glycosylated. O-glycosylated with a core 1 or possibly core 8 glycan.", "evidence": [ { "database": "UniProtKB", "id": "P08571", "url": "https://www.uniprot.org/uniprot/P08571" }, { "database": "PubMed", "id": "19838169", "url": "https://glygen.org/publication/PubMed/19838169" }, { "database": "PubMed", "id": "19159218", "url": "https://glygen.org/publication/PubMed/19159218" }, { "database": "PubMed", "id": "16335952", "url": "https://glygen.org/publication/PubMed/16335952" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [ 37, 151, 282, 323 ], "o_linked_sites": [ 336, 362, 364 ], "snv_sites": [ 37, 39, 153, 267, 282, 284, 303, 325, 347, 364 ], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 151, "end_pos": 153 }, { "start_pos": 282, "end_pos": 284 }, { "start_pos": 323, "end_pos": 325 }, { "start_pos": 37, "end_pos": 39 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 43 }, { "field": "total_sites", "count": 7 }, { "field": "n_linked_glycans", "count": 32 }, { "field": "n_linked_glycan_sites", "count": 6 }, { "field": "o_linked_glycans", "count": 4 }, { "field": "o_linked_glycan_sites", "count": 4 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 4 }, { "field": "total_sites", "count": 4 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 3 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 38 }, { "field": "total_sites", "count": 5 }, { "field": "n_linked_glycans", "count": 32 }, { "field": "n_linked_glycan_sites", "count": 2 }, { "field": "o_linked_glycans", "count": 4 }, { "field": "o_linked_glycan_sites", "count": 3 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 1 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 16 }, { "field": "total_sites", "count": 10 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 6 }, { "field": "total_sites", "count": 5 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 10 }, { "field": "total_sites", "count": 7 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 183 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }