{ "uniprot_canonical_ac": "P08134-1", "uniprot_ac": "P08134", "uniprot_id": "RHOC_HUMAN", "mass": { "chemical_mass": 22006.0, "monoisotopic_mass": 22006.0 }, "refseq": { "ac": "NP_001036143", "name": "rho-related GTP-binding protein RhoC precursor", "summary": "This gene encodes a member of the Rho family of small GTPases, which cycle between inactive GDP-bound and active GTP-bound states and function as molecular switches in signal transduction cascades. Rho proteins promote reorganization of the actin cytoskeleton and regulate cell shape, attachment, and motility. The protein encoded by this gene is prenylated at its C-terminus, and localizes to the cytoplasm and plasma membrane. It is thought to be important in cell locomotion. Overexpression of this gene is associated with tumor cell proliferation and metastasis. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Jul 2008].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001036143" }, "gene_names": [ { "name": "RHOC", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P08134", "id": "P08134" }, { "name": "ARH9; ARHC; H9; RHOH9", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001036143", "id": "NP_001036143" }, { "name": "ARH9", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P08134", "id": "P08134" }, { "name": "ARHC", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P08134", "id": "P08134" }, { "name": "RHOC", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001036143", "id": "NP_001036143" } ], "protein_names": [ { "name": "Rho-related GTP-binding protein RhoC", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P08134" }, { "name": "Rho cDNA clone 9", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P08134" }, { "name": "h9", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P08134" }, { "name": "oncogene RHO H9; rhoC GTPase; small GTP binding protein RhoC; Rho-related GTP-binding protein RhoC; RAS-related homolog 9; rho cDNA clone 9; ras homolog gene family, member C; epididymis secretory sperm binding protein", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001036143", "id": "NP_001036143" }, { "name": "rho-related GTP-binding protein RhoC precursor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001036143", "id": "NP_001036143" } ], "function": [ { "annotation": "LncRNA ZFAS1 contributes to osteosarcoma progression via miR-520b and miR-520e-mediated inhibition of RHOC signaling. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_001036143", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001036143" }, { "database": "PubMed", "id": "36473367", "url": "https://glygen.org/publication/PubMed/36473367" } ] }, { "annotation": "RNF168 promotes RHOC degradation by ubiquitination to restrain gastric cancer progression via decreasing HDAC1 expression.", "evidence": [ { "database": "RefSeq", "id": "NP_001036143", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001036143" }, { "database": "PubMed", "id": "33865221", "url": "https://glygen.org/publication/PubMed/33865221" } ] }, { "annotation": "RNF168 suppresses the cancer stem cell-like traits of nonsmall cell lung cancer cells by mediating RhoC ubiquitination.", "evidence": [ { "database": "RefSeq", "id": "NP_001036143", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001036143" }, { "database": "PubMed", "id": "34873829", "url": "https://glygen.org/publication/PubMed/34873829" } ] }, { "annotation": "Regulates a signal transduction pathway linking plasma membrane receptors to the assembly of focal adhesions and actin stress fibers. Serves as a microtubule-dependent signal that is required for the myosin contractile ring formation during cell cycle cytokinesis. Regulates apical junction formation in bronchial epithelial cells.", "evidence": [ { "database": "UniProtKB", "id": "P08134", "url": "https://www.uniprot.org/uniprot/P08134#function" }, { "database": "PubMed", "id": "20974804", "url": "https://glygen.org/publication/PubMed/20974804" }, { "database": "PubMed", "id": "16236794", "url": "https://glygen.org/publication/PubMed/16236794" } ] }, { "annotation": "RhoC in association with TET2/WDR5 regulates cancer stem cells by epigenetically modifying the expression of pluripotency genes. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_001036143", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001036143" }, { "database": "PubMed", "id": "36469134", "url": "https://glygen.org/publication/PubMed/36469134" } ] }, { "annotation": "Silencing of RhoC induces macrophage M1 polarization to inhibit migration and invasion in colon cancer via regulating the PTEN/FOXO1 pathway.", "evidence": [ { "database": "RefSeq", "id": "NP_001036143", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001036143" }, { "database": "PubMed", "id": "36576072", "url": "https://glygen.org/publication/PubMed/36576072" } ] }, { "annotation": "This gene encodes a member of the Rho family of small GTPases, which cycle between inactive GDP-bound and active GTP-bound states and function as molecular switches in signal transduction cascades. Rho proteins promote reorganization of the actin cytoskeleton and regulate cell shape, attachment, and motility. The protein encoded by this gene is prenylated at its C-terminus, and localizes to the cytoplasm and plasma membrane. It is thought to be important in cell locomotion. Overexpression of this gene is associated with tumor cell proliferation and metastasis. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Jul 2008].", "evidence": [ { "database": "RefSeq", "id": "NP_001036143", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001036143" } ] } ], "disease": [], "snv": [ { "evidence": [ { "id": "rs1299248790", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1299248790" }, { "id": "rs1299248790", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1299248790" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 151, "end_pos": 151, "sequence_org": "I", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NRI->NRT).", "chr_id": "1", "chr_pos": "112701670", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "I151", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs780741469", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs780741469" }, { "id": "rs780741469", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs780741469" }, { "id": "rs780741469", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs780741469" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 86, "end_pos": 86, "sequence_org": "I", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (IDS->NDS).", "chr_id": "1", "chr_pos": "112703019", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "I86", "keywords": [ "ebi", "germline" ] } ], "mutagenesis": [], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "96.48", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000155366", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000155366" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "84.62", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000155366", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000155366" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "96.75", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000155366", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000155366" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "94.2", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000155366", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000155366" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "98.92", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000155366", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000155366" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "99.22", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000155366", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000155366" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "96.1", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000155366", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000155366" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "95.36", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000155366", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000155366" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "97.93", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000155366", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000155366" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "93.1", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000155366", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000155366" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "92.88", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000155366", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000155366" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "99.11", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000155366", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000155366" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "98.27", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000155366", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000155366" } ] } ], "expression_disease": [ { "significant": "No", "trend": "down", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "P08134", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P08134" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "P08134", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P08134" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "P08134", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P08134" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "P08134", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P08134" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "P08134", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P08134" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "P08134", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P08134" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "P08134", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P08134" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "P08134", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P08134" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "P08134", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P08134" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "P08134", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P08134" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "P08134", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P08134" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "P08134", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P08134" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P08134", "url": "https://www.uniprot.org/uniprot/P08134" } ], "common_name": "Human" } ], "gene": [ { "name": "RHOC", "url": "https://www.uniprot.org/uniprot/P08134", "locus": { "chromosome": "1", "start_pos": 112701127, "end_pos": 112707434, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000155366", "url": "https://www.ensembl.org/id/ENSG00000155366" } ] } } ], "crossref": [ { "id": "ENSG00000155366", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000155366", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "3.6.5.2", "url": "https://www.brenda-enzymes.org/enzyme.php?ecno=3.6.5.2&UniProtAcc=P08134", "database": "BRENDA", "categories": [ "Enzyme and Pathway" ] }, { "id": "cd01870", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd01870", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "CHEMBL3883318", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL3883318", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "RHOC", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=RHOC", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "389", "url": "https://www.ncbi.nlm.nih.gov/gene/389", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "669", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=669", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "P08134", "url": "https://www.ebi.ac.uk/intact/interactors/id:P08134*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR001806", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001806", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR003578", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003578", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR005225", "url": "https://www.ebi.ac.uk/interpro/entry/IPR005225", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR027417", "url": "https://www.ebi.ac.uk/interpro/entry/IPR027417", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:389", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:389", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "165380", "url": "http://www.omim.org/entry/165380", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_P08134", "url": "https://www.nextprot.org/entry/NX_P08134", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "P08134", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08134", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "TINAYEY", "url": "https://omabrowser.org/oma/group/TINAYEY/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "20499at2759", "url": "http://www.orthodb.org/?query=20499at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR24072", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24072", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR24072:SF100", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24072:SF100", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "1Z2C", "url": "https://www.rcsb.org/structure/1Z2C", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2GCN", "url": "https://www.rcsb.org/structure/2GCN", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2GCO", "url": "https://www.rcsb.org/structure/2GCO", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2GCP", "url": "https://www.rcsb.org/structure/2GCP", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00071", "url": "http://pfam.xfam.org/family/PF00071", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "P08134", "url": "https://pharos.nih.gov/targets/P08134", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_P08134", "url": "http://purl.obolibrary.org/obo/PR_P08134", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-416482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416482", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-416572", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416572", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-5625740", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625740", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-5625900", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625900", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-5627117", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5627117", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-5666185", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5666185", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9013106", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013106", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001036143", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001036143", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "E9PLA2", "url": "https://www.uniprot.org/uniprot/E9PLA2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E9PLA2-1", "url": "https://www.uniprot.org/uniprot/E9PLA2-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E9PN11", "url": "https://www.uniprot.org/uniprot/E9PN11", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E9PN11-1", "url": "https://www.uniprot.org/uniprot/E9PN11-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E9PQH6", "url": "https://www.uniprot.org/uniprot/E9PQH6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E9PQH6-1", "url": "https://www.uniprot.org/uniprot/E9PQH6-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P08134", "url": "https://www.uniprot.org/uniprot/P08134", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P08134-1", "url": "https://www.uniprot.org/uniprot/P08134-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q5JR05", "url": "https://www.uniprot.org/uniprot/Q5JR05", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q5JR05-1", "url": "https://www.uniprot.org/uniprot/Q5JR05-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q5JR06", "url": "https://www.uniprot.org/uniprot/Q5JR06", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q5JR06-1", "url": "https://www.uniprot.org/uniprot/Q5JR06-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q5JR07", "url": "https://www.uniprot.org/uniprot/Q5JR07", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q5JR07-1", "url": "https://www.uniprot.org/uniprot/Q5JR07-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q5JR08", "url": "https://www.uniprot.org/uniprot/Q5JR08", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q5JR08-1", "url": "https://www.uniprot.org/uniprot/Q5JR08-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRQDEHTRRELAKMKQEPVRSEEGRDMANRISAFGYLECSAKTKEGVREVFEMATRAGLQVRKNKRRRGCPIL", "length": 193, "header": "sp|P08134-1|RHOC_HUMAN Isoform 1 of Rho-related GTP-binding protein RhoC OS=Homo sapiens OX=9606 GN=RHOC PE=1 SV=1 CANONICAL=P08134-1" }, "isoforms": [ { "isoform_ac": "E9PLA2-1", "url": "", "sequence": { "sequence": "MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYIADIEVDGKQTGSVTWAESLCLWV", "length": 66, "header": "tr|E9PLA2-1|RHOC_HUMAN Computationally mapped isoform of Rho-related GTP-binding protein RhoC OS=Homo sapiens OX=9606 GN=RHOC PE=1 SV=1 CANONICAL=P08134-1" }, "locus": { "chromosome": "1", "start_pos": 112703799, "end_pos": 112703416, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000484280.6", "url": "https://www.ensembl.org/id/ENST00000484280.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000434310.1", "url": "https://www.ensembl.org/id/ENSP00000434310.1" } ] } }, { "isoform_ac": "E9PN11-1", "url": "", "sequence": { "sequence": "MVSISGGDLPTGLDFISAPEPALSSCSLGTSAGWSPTMAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSL", "length": 129, "header": "tr|E9PN11-1|RHOC_HUMAN Computationally mapped isoform of Rho-related GTP-binding protein RhoC OS=Homo sapiens OX=9606 GN=RHOC PE=1 SV=2 CANONICAL=P08134-1" }, "locus": { "chromosome": "1", "start_pos": 112705639, "end_pos": 112703000, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000484054.3", "url": "https://www.ensembl.org/id/ENST00000484054.3" }, { "database": "Ensembl Peptide", "id": "ENSP00000434877.2", "url": "https://www.ensembl.org/id/ENSP00000434877.2" } ] } }, { "isoform_ac": "E9PQH6-1", "url": "", "sequence": { "sequence": "MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRQDEHTRRELAKMKQEPVRSEEGRDMANRISAFGYLECSAKTKEGVRE", "length": 169, "header": "tr|E9PQH6-1|E9PQH6_HUMAN Computationally mapped isoform of Ras homolog family member C OS=Homo sapiens OX=9606 GN=RHOC PE=1 SV=1 CANONICAL=P08134-1" }, "locus": { "chromosome": "1", "start_pos": 112703799, "end_pos": 112701615, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000534717.5", "url": "https://www.ensembl.org/id/ENST00000534717.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000436240.1", "url": "https://www.ensembl.org/id/ENSP00000436240.1" } ] } }, { "isoform_ac": "P08134-1", "url": "", "sequence": { "sequence": "MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRQDEHTRRELAKMKQEPVRSEEGRDMANRISAFGYLECSAKTKEGVREVFEMATRAGLQVRKNKRRRGCPIL", "length": 193, "header": "sp|P08134-1|RHOC_HUMAN Isoform 1 of Rho-related GTP-binding protein RhoC OS=Homo sapiens OX=9606 GN=RHOC PE=1 SV=1 CANONICAL=P08134-1" }, "locus": { "chromosome": "1", "start_pos": 112703799, "end_pos": 112701543, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000339083.12", "url": "https://www.ensembl.org/id/ENST00000339083.12" }, { "database": "Ensembl Peptide", "id": "ENSP00000345236.8", "url": "https://www.ensembl.org/id/ENSP00000345236.8" } ] } }, { "isoform_ac": "Q5JR05-1", "url": "", "sequence": { "sequence": "MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRKAGTWRTGSVPLATLSAQPRPRRECGRCLRWPLGLASRSARTSVGGAVPFSEIPKAFPTCPLPSQGYRNYPPTTPAS", "length": 199, "header": "tr|Q5JR05-1|RHOC_HUMAN Computationally mapped isoform of Rho-related GTP-binding protein RhoC OS=Homo sapiens OX=9606 GN=RHOC PE=1 SV=1 CANONICAL=P08134-1" }, "locus": { "chromosome": "1", "start_pos": 112703799, "end_pos": 112701464, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000369636.6", "url": "https://www.ensembl.org/id/ENST00000369636.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000358650.2", "url": "https://www.ensembl.org/id/ENSP00000358650.2" } ] } }, { "isoform_ac": "Q5JR06-1", "url": "", "sequence": { "sequence": "MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDS", "length": 91, "header": "tr|Q5JR06-1|RHOC_HUMAN Computationally mapped isoform of Rho-related GTP-binding protein RhoC OS=Homo sapiens OX=9606 GN=RHOC PE=1 SV=8 CANONICAL=P08134-1" }, "locus": { "chromosome": "1", "start_pos": 112703799, "end_pos": 112703003, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000414971.1", "url": "https://www.ensembl.org/id/ENST00000414971.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000395791.1", "url": "https://www.ensembl.org/id/ENSP00000395791.1" } ] } }, { "isoform_ac": "Q5JR07-1", "url": "", "sequence": { "sequence": "MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRQDEHT", "length": 127, "header": "tr|Q5JR07-1|RHOC_HUMAN Computationally mapped isoform of Rho-related GTP-binding protein RhoC OS=Homo sapiens OX=9606 GN=RHOC PE=1 SV=1 CANONICAL=P08134-1" }, "locus": { "chromosome": "1", "start_pos": 112703799, "end_pos": 112702590, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000436685.6", "url": "https://www.ensembl.org/id/ENST00000436685.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000399424.2", "url": "https://www.ensembl.org/id/ENSP00000399424.2" } ] } }, { "isoform_ac": "Q5JR08-1", "url": "", "sequence": { "sequence": "MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRQDEHTRRELAKMKQEPVRSEEGRDMANRISAFGYLECSAKTKEGVREVFEMATRAGLQVRKNKRRR", "length": 188, "header": "tr|Q5JR08-1|RHOC_HUMAN Computationally mapped isoform of Rho-related GTP-binding protein RhoC OS=Homo sapiens OX=9606 GN=RHOC PE=1 SV=8 CANONICAL=P08134-1" }, "locus": { "chromosome": "1", "start_pos": 112703799, "end_pos": 112701558, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000425265.6", "url": "https://www.ensembl.org/id/ENST00000425265.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000390823.2", "url": "https://www.ensembl.org/id/ENSP00000390823.2" } ] } } ], "glycosylation": [ { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported", "site_seq": "Y", "relation": "attached", "comment": "O-linked (GlcNAc) tyrosine; by Photorhabdus PAU_02230 O-GlcNAcylation", "start_pos": 34, "start_aa": "Tyr", "end_pos": 34, "end_aa": "Tyr", "residue": "Tyr", "site_lbl": "Tyr34", "evidence": [ { "id": "P08134", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08134#ptm_processing" }, { "id": "24141704", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24141704" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "evidence": [ { "id": "P08134", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08134" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" } ] } ], "phosphorylation": [ { "start_pos": 73, "end_pos": 73, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P08134", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08134" }, { "database": "PubMed", "id": "29279389", "url": "https://glygen.org/publication/PubMed/29279389" } ], "site_lbl": "Ser73" } ], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "Cytoplasmic localization of human cdc25C during interphase requires an intact 14-3-3 binding site.", "journal": "Molecular and cellular biology", "date": "1999", "authors": "Dalal SN, Schweitzer CM, Gan J, DeCaprio JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-5625740", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625740" } ], "reference": [ { "type": "PubMed", "id": "10330186", "url": "https://glygen.org/publication/PubMed/10330186" } ] }, { "title": "Ropporin, a sperm-specific binding protein of rhophilin, that is localized in the fibrous sheath of sperm flagella.", "journal": "Journal of cell science", "date": "2000", "authors": "Fujita A, Nakamura K, Kato T, Watanabe N, Ishizaki T, Kimura K, Mizoguchi A, Narumiya S", "evidence": [ { "database": "Reactome", "id": "R-HSA-5666185", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5666185" } ], "reference": [ { "type": "PubMed", "id": "10591629", "url": "https://glygen.org/publication/PubMed/10591629" } ] }, { "title": "X-ray structure determination of human profilin II: A comparative structural analysis of human profilins.", "journal": "Journal of molecular biology", "date": "1999", "authors": "Nodelman IM, Bowman GD, Lindberg U, Schutt CE", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "10600384", "url": "https://glygen.org/publication/PubMed/10600384" } ] }, { "title": "The structural basis of Rho effector recognition revealed by the crystal structure of human RhoA complexed with the effector domain of PKN/PRK1.", "journal": "Molecular cell", "date": "1999", "authors": "Maesaki R, Ihara K, Shimizu T, Kuroda S, Kaibuchi K, Hakoshima T", "evidence": [ { "database": "Reactome", "id": "R-HSA-5625740", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625740" } ], "reference": [ { "type": "PubMed", "id": "10619026", "url": "https://glygen.org/publication/PubMed/10619026" } ] }, { "title": "Rho-associated kinase ROCK activates LIM-kinase 1 by phosphorylation at threonine 508 within the activation loop.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Ohashi K, Nagata K, Maekawa M, Ishizaki T, Narumiya S, Mizuno K", "evidence": [ { "database": "Reactome", "id": "R-HSA-416572", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416572" } ], "reference": [ { "type": "PubMed", "id": "10652353", "url": "https://glygen.org/publication/PubMed/10652353" } ] }, { "title": "Diaphanous-related formins bridge Rho GTPase and Src tyrosine kinase signaling.", "journal": "Molecular cell", "date": "2000", "authors": "Tominaga T, Sahai E, Chardin P, McCormick F, Courtneidge SA, Alberts AS", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "10678165", "url": "https://glygen.org/publication/PubMed/10678165" } ] }, { "title": "Rho GTPase control of protein kinase C-related protein kinase activation by 3-phosphoinositide-dependent protein kinase.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Flynn P, Mellor H, Casamassima A, Parker PJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5625740", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625740" } ], "reference": [ { "type": "PubMed", "id": "10753910", "url": "https://glygen.org/publication/PubMed/10753910" } ] }, { "title": "Molecular cloning, expression characterization, and mapping of a novel putative inhibitor of rho GTPase activity, RTKN, to D2S145-D2S286.", "journal": "Genomics", "date": "2000", "authors": "Fu Q, Yu L, Liu Q, Zhang J, Zhang H, Zhao S", "evidence": [ { "database": "Reactome", "id": "R-HSA-5666185", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5666185" } ], "reference": [ { "type": "PubMed", "id": "10873388", "url": "https://glygen.org/publication/PubMed/10873388" } ] }, { "title": "Phosphorylation of CPI-17, an inhibitor of myosin phosphatase, by protein kinase N.", "journal": "Biochemical and biophysical research communications", "date": "2000", "authors": "Hamaguchi T, Ito M, Feng J, Seko T, Koyama M, Machida H, Takase K, Amano M, Kaibuchi K, Hartshorne DJ, Nakano T", "evidence": [ { "database": "Reactome", "id": "R-HSA-5625740", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625740" } ], "reference": [ { "type": "PubMed", "id": "10924361", "url": "https://glygen.org/publication/PubMed/10924361" } ] }, { "title": "The PDZ protein TIP-1 interacts with the Rho effector rhotekin and is involved in Rho signaling to the serum response element.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Reynaud C, Fabre S, Jalinot P", "evidence": [ { "database": "Reactome", "id": "R-HSA-5666185", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5666185" } ], "reference": [ { "type": "PubMed", "id": "10940294", "url": "https://glygen.org/publication/PubMed/10940294" } ] }, { "title": "FRL, a novel formin-related protein, binds to Rac and regulates cell motility and survival of macrophages.", "journal": "Molecular and cellular biology", "date": "2000", "authors": "Yayoshi-Yamamoto S, Taniuchi I, Watanabe T", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "10958683", "url": "https://glygen.org/publication/PubMed/10958683" } ] }, { "title": "Specific activation of LIM kinase 2 via phosphorylation of threonine 505 by ROCK, a Rho-dependent protein kinase.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Sumi T, Matsumoto K, Nakamura T", "evidence": [ { "database": "Reactome", "id": "R-HSA-416572", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416572" } ], "reference": [ { "type": "PubMed", "id": "11018042", "url": "https://glygen.org/publication/PubMed/11018042" } ] }, { "title": "PKN delays mitotic timing by inhibition of Cdc25C: possible involvement of PKN in the regulation of cell division.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2001", "authors": "Misaki K, Mukai H, Yoshinaga C, Oishi K, Isagawa T, Takahashi M, Ohsumi K, Kishimoto T, Ono Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-5625740", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625740" } ], "reference": [ { "type": "PubMed", "id": "11134534", "url": "https://glygen.org/publication/PubMed/11134534" } ] }, { "title": "Functional role for the class IX myosin myr5 in epithelial cell infection by Shigella flexneri.", "journal": "Cellular microbiology", "date": "2000", "authors": "Graf B, Bahler M, Hilpela P, Bowe C, Adam T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013106", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013106" } ], "reference": [ { "type": "PubMed", "id": "11207612", "url": "https://glygen.org/publication/PubMed/11207612" } ] }, { "title": "Membrane blebbing during apoptosis results from caspase-mediated activation of ROCK I.", "journal": "Nature cell biology", "date": "2001", "authors": "Coleman ML, Sahai EA, Yeo M, Bosch M, Dewar A, Olson MF", "evidence": [ { "database": "Reactome", "id": "R-HSA-416482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416482" } ], "reference": [ { "type": "PubMed", "id": "11283606", "url": "https://glygen.org/publication/PubMed/11283606" } ] }, { "title": "Arachidonic acid-induced Ca2+ sensitization of smooth muscle contraction through activation of Rho-kinase.", "journal": "Pflugers Archiv : European journal of physiology", "date": "2001", "authors": "Araki S, Ito M, Kureishi Y, Feng J, Machida H, Isaka N, Amano M, Kaibuchi K, Hartshorne DJ, Nakano T", "evidence": [ { "database": "Reactome", "id": "R-HSA-416482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416482" } ], "reference": [ { "type": "PubMed", "id": "11294240", "url": "https://glygen.org/publication/PubMed/11294240" } ] }, { "title": "RGS-containing RhoGEFs: the missing link between transforming G proteins and Rho?", "journal": "Oncogene", "date": "2001", "authors": "Fukuhara S, Chikumi H, Gutkind JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-416482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416482" } ], "reference": [ { "type": "PubMed", "id": "11313914", "url": "https://glygen.org/publication/PubMed/11313914" } ] }, { "title": "Localization of human Cdc25C is regulated both by nuclear export and 14-3-3 protein binding.", "journal": "Oncogene", "date": "2001", "authors": "Graves PR, Lovly CM, Uy GL, Piwnica-Worms H", "evidence": [ { "database": "Reactome", "id": "R-HSA-5625740", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625740" } ], "reference": [ { "type": "PubMed", "id": "11313932", "url": "https://glygen.org/publication/PubMed/11313932" } ] }, { "title": "Rho-kinase--mediated contraction of isolated stress fibers.", "journal": "The Journal of cell biology", "date": "2001", "authors": "Katoh K, Kano Y, Amano M, Onishi H, Kaibuchi K, Fujiwara K", "evidence": [ { "database": "Reactome", "id": "R-HSA-5625740", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625740" } ], "reference": [ { "type": "PubMed", "id": "11331307", "url": "https://glygen.org/publication/PubMed/11331307" } ] }, { "title": "AKAP-Lbc anchors protein kinase A and nucleates Galpha 12-selective Rho-mediated stress fiber formation.", "journal": "J. Biol. Chem.", "date": "2001", "authors": "Diviani D, Soderling J, Scott JD", "evidence": [ { "database": "UniProtKB", "id": "P08134", "url": "https://www.uniprot.org/uniprot/P08134" } ], "reference": [ { "type": "PubMed", "id": "11546812", "url": "https://glygen.org/publication/PubMed/11546812" } ] }, { "title": "Competing modes of self-association in the regulatory domains of Bruton's tyrosine kinase: intramolecular contact versus asymmetric homodimerization.", "journal": "Protein science : a publication of the Protein Society", "date": "2002", "authors": "Laederach A, Cradic KW, Brazin KN, Zamoon J, Fulton DB, Huang XY, Andreotti AH", "evidence": [ { "database": "Reactome", "id": "R-HSA-416482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416482" } ], "reference": [ { "type": "PubMed", "id": "11742120", "url": "https://glygen.org/publication/PubMed/11742120" } ] }, { "title": "Diphosphorylated MRLC is required for organization of stress fibers in interphase cells and the contractile ring in dividing cells.", "journal": "Cell structure and function", "date": "2001", "authors": "Iwasaki T, Murata-Hori M, Ishitobi S, Hosoya H", "evidence": [ { "database": "Reactome", "id": "R-HSA-5625740", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625740" } ], "reference": [ { "type": "PubMed", "id": "11942626", "url": "https://glygen.org/publication/PubMed/11942626" } ] }, { "title": "Guanine nucleotide exchange factors for Rho GTPases: turning on the switch.", "journal": "Genes & development", "date": "2002", "authors": "Schmidt A, Hall A", "evidence": [ { "database": "Reactome", "id": "R-HSA-416482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416482" } ], "reference": [ { "type": "PubMed", "id": "12101119", "url": "https://glygen.org/publication/PubMed/12101119" } ] }, { "title": "Plexin-B1 directly interacts with PDZ-RhoGEF/LARG to regulate RhoA and growth cone morphology.", "journal": "Neuron", "date": "2002", "authors": "Swiercz JM, Kuner R, Behrens J, Offermanns S", "evidence": [ { "database": "Reactome", "id": "R-HSA-416482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416482" } ], "reference": [ { "type": "PubMed", "id": "12123608", "url": "https://glygen.org/publication/PubMed/12123608" } ] }, { "title": "Rho-kinase contributes to diphosphorylation of myosin II regulatory light chain in nonmuscle cells.", "journal": "Oncogene", "date": "2002", "authors": "Ueda K, Murata-Hori M, Tatsuka M, Hosoya H", "evidence": [ { "database": "Reactome", "id": "R-HSA-416572", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416572" } ], "reference": [ { "type": "PubMed", "id": "12185584", "url": "https://glygen.org/publication/PubMed/12185584" } ] }, { "title": "The semaphorin receptor plexin-B1 signals through a direct interaction with the Rho-specific nucleotide exchange factor, LARG.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2002", "authors": "Aurandt J, Vikis HG, Gutkind JS, Ahn N, Guan KL", "evidence": [ { "database": "Reactome", "id": "R-HSA-416572", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416572" } ], "reference": [ { "type": "PubMed", "id": "12196628", "url": "https://glygen.org/publication/PubMed/12196628" } ] }, { "title": "Interaction of plexin-B1 with PDZ domain-containing Rho guanine nucleotide exchange factors.", "journal": "Biochemical and biophysical research communications", "date": "2002", "authors": "Hirotani M, Ohoka Y, Yamamoto T, Nirasawa H, Furuyama T, Kogo M, Matsuya T, Inagaki S", "evidence": [ { "database": "Reactome", "id": "R-HSA-416572", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416572" } ], "reference": [ { "type": "PubMed", "id": "12220504", "url": "https://glygen.org/publication/PubMed/12220504" } ] }, { "title": "The RhoA-binding protein, rhophilin-2, regulates actin cytoskeleton organization.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Peck JW, Oberst M, Bouker KB, Bowden E, Burbelo PD", "evidence": [ { "database": "Reactome", "id": "R-HSA-5666185", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5666185" } ], "reference": [ { "type": "PubMed", "id": "12221077", "url": "https://glygen.org/publication/PubMed/12221077" } ] }, { "title": "XPLN, a guanine nucleotide exchange factor for RhoA and RhoB, but not RhoC.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Arthur WT, Ellerbroek SM, Der CJ, Burridge K, Wennerberg K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013106", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013106" } ], "reference": [ { "type": "PubMed", "id": "12221096", "url": "https://glygen.org/publication/PubMed/12221096" } ] }, { "title": "The diaphanous-related formin mDia1 controls serum response factor activity through its effects on actin polymerization.", "journal": "Molecular biology of the cell", "date": "2002", "authors": "Copeland JW, Treisman R", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "12429848", "url": "https://glygen.org/publication/PubMed/12429848" } ] }, { "title": "Galpha(12/13) mediates alpha(1)-adrenergic receptor-induced cardiac hypertrophy.", "journal": "Circulation research", "date": "2002", "authors": "Maruyama Y, Nishida M, Sugimoto Y, Tanabe S, Turner JH, Kozasa T, Wada T, Nagao T, Kurose H", "evidence": [ { "database": "Reactome", "id": "R-HSA-416482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416482" } ], "reference": [ { "type": "PubMed", "id": "12433842", "url": "https://glygen.org/publication/PubMed/12433842" } ] }, { "title": "Identification and characterization of a novel activated RhoB binding protein containing a PDZ domain whose expression is specifically modulated in thyroid cells by cAMP.", "journal": "European journal of biochemistry", "date": "2002", "authors": "Mircescu H, Steuve S, Savonet V, Degraef C, Mellor H, Dumont JE, Maenhaut C, Pirson I", "evidence": [ { "database": "Reactome", "id": "R-HSA-5666185", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5666185" } ], "reference": [ { "type": "PubMed", "id": "12473120", "url": "https://glygen.org/publication/PubMed/12473120" } ] }, { "title": "Galpha 12 activates Rho GTPase through tyrosine-phosphorylated leukemia-associated RhoGEF.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2003", "authors": "Suzuki N, Nakamura S, Mano H, Kozasa T", "evidence": [ { "database": "Reactome", "id": "R-HSA-416482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416482" } ], "reference": [ { "type": "PubMed", "id": "12515866", "url": "https://glygen.org/publication/PubMed/12515866" } ] }, { "title": "RhoD regulates endosome dynamics through Diaphanous-related Formin and Src tyrosine kinase.", "journal": "Nature cell biology", "date": "2003", "authors": "Gasman S, Kalaidzidis Y, Zerial M", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "12577064", "url": "https://glygen.org/publication/PubMed/12577064" } ] }, { "title": "Direct interaction of Rnd1 with Plexin-B1 regulates PDZ-RhoGEF-mediated Rho activation by Plexin-B1 and induces cell contraction in COS-7 cells.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Oinuma I, Katoh H, Harada A, Negishi M", "evidence": [ { "database": "Reactome", "id": "R-HSA-416572", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416572" } ], "reference": [ { "type": "PubMed", "id": "12730235", "url": "https://glygen.org/publication/PubMed/12730235" } ] }, { "title": "Actin dynamics control SRF activity by regulation of its coactivator MAL.", "journal": "Cell", "date": "2003", "authors": "Miralles F, Posern G, Zaromytidou AI, Treisman R", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "12732141", "url": "https://glygen.org/publication/PubMed/12732141" } ] }, { "title": "Hyperosmotic-induced protein kinase N 1 activation in a vesicular compartment is dependent upon Rac1 and 3-phosphoinositide-dependent kinase 1.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Torbett NE, Casamassima A, Parker PJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5625740", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625740" } ], "reference": [ { "type": "PubMed", "id": "12783890", "url": "https://glygen.org/publication/PubMed/12783890" } ] }, { "title": "Citron kinase, a Rho-dependent kinase, induces di-phosphorylation of regulatory light chain of myosin II.", "journal": "Molecular biology of the cell", "date": "2003", "authors": "Yamashiro S, Totsukawa G, Yamakita Y, Sasaki Y, Madaule P, Ishizaki T, Narumiya S, Matsumura F", "evidence": [ { "database": "Reactome", "id": "R-HSA-5625900", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625900" } ], "reference": [ { "type": "PubMed", "id": "12802051", "url": "https://glygen.org/publication/PubMed/12802051" } ] }, { "title": "A role for VASP in RhoA-Diaphanous signalling to actin dynamics and SRF activity.", "journal": "The EMBO journal", "date": "2003", "authors": "Grosse R, Copeland JW, Newsome TP, Way M, Treisman R", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "12805219", "url": "https://glygen.org/publication/PubMed/12805219" } ] }, { "title": "Molecular dissection of the interaction between the small G proteins Rac1 and RhoA and protein kinase C-related kinase 1 (PRK1).", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Owen D, Lowe PN, Nietlispach D, Brosnan CE, Chirgadze DY, Parker PJ, Blundell TL, Mott HR", "evidence": [ { "database": "Reactome", "id": "R-HSA-5625740", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625740" } ], "reference": [ { "type": "PubMed", "id": "14514689", "url": "https://glygen.org/publication/PubMed/14514689" } ] }, { "title": "Association of CPI-17 with protein kinase C and casein kinase I.", "journal": "Biochemical and biophysical research communications", "date": "2004", "authors": "Zemlickova E, Johannes FJ, Aitken A, Dubois T", "evidence": [ { "database": "Reactome", "id": "R-HSA-5625740", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625740" } ], "reference": [ { "type": "PubMed", "id": "15003508", "url": "https://glygen.org/publication/PubMed/15003508" } ] }, { "title": "Crystal structures of a Formin Homology-2 domain reveal a tethered dimer architecture.", "journal": "Cell", "date": "2004", "authors": "Xu Y, Moseley JB, Sagot I, Poy F, Pellman D, Goode BL, Eck MJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "15006353", "url": "https://glygen.org/publication/PubMed/15006353" } ] }, { "title": "Cdc42 and mDia3 regulate microtubule attachment to kinetochores.", "journal": "Nature", "date": "2004", "authors": "Yasuda S, Oceguera-Yanez F, Kato T, Okamoto M, Yonemura S, Terada Y, Ishizaki T, Narumiya S", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "15085137", "url": "https://glygen.org/publication/PubMed/15085137" } ] }, { "title": "Scambio, a novel guanine nucleotide exchange factor for Rho.", "journal": "Molecular cancer", "date": "2004", "authors": "Curtis C, Hemmeryckx B, Haataja L, Senadheera D, Groffen J, Heisterkamp N", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013106", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013106" } ], "reference": [ { "type": "PubMed", "id": "15107133", "url": "https://glygen.org/publication/PubMed/15107133" } ] }, { "title": "Phosphoprotein inhibitor CPI-17 specificity depends on allosteric regulation of protein phosphatase-1 by regulatory subunits.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2004", "authors": "Eto M, Kitazawa T, Brautigan DL", "evidence": [ { "database": "Reactome", "id": "R-HSA-5625740", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625740" } ], "reference": [ { "type": "PubMed", "id": "15184667", "url": "https://glygen.org/publication/PubMed/15184667" } ] }, { "title": "Plexin-B1/RhoGEF-mediated RhoA activation involves the receptor tyrosine kinase ErbB-2.", "journal": "The Journal of cell biology", "date": "2004", "authors": "Swiercz JM, Kuner R, Offermanns S", "evidence": [ { "database": "Reactome", "id": "R-HSA-416572", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416572" } ], "reference": [ { "type": "PubMed", "id": "15210733", "url": "https://glygen.org/publication/PubMed/15210733" } ] }, { "title": "Formin is a processive motor that requires profilin to accelerate actin assembly and associated ATP hydrolysis.", "journal": "Cell", "date": "2004", "authors": "Romero S, Le Clainche C, Didry D, Egile C, Pantaloni D, Carlier MF", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "15507212", "url": "https://glygen.org/publication/PubMed/15507212" } ] }, { "title": "Direct cleavage of ROCK II by granzyme B induces target cell membrane blebbing in a caspase-independent manner.", "journal": "The Journal of experimental medicine", "date": "2005", "authors": "Sebbagh M, Hamelin J, Bertoglio J, Solary E, Breard J", "evidence": [ { "database": "Reactome", "id": "R-HSA-416482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416482" } ], "reference": [ { "type": "PubMed", "id": "15699075", "url": "https://glygen.org/publication/PubMed/15699075" } ] }, { "title": "Receptors coupled to heterotrimeric G proteins of the G12 family.", "journal": "Trends in pharmacological sciences", "date": "2005", "authors": "Riobo NA, Manning DR", "evidence": [ { "database": "Reactome", "id": "R-HSA-416482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416482" } ], "reference": [ { "type": "PubMed", "id": "15749160", "url": "https://glygen.org/publication/PubMed/15749160" } ] }, { "title": "Normal thyroid structure and function in rhophilin 2-deficient mice.", "journal": "Molecular and cellular biology", "date": "2005", "authors": "Behrends J, Clement S, Pajak B, Pohl V, Maenhaut C, Dumont JE, Schurmans S", "evidence": [ { "database": "Reactome", "id": "R-HSA-5666185", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5666185" } ], "reference": [ { "type": "PubMed", "id": "15767687", "url": "https://glygen.org/publication/PubMed/15767687" } ] }, { "title": "Involvement of protein kinase PKN1 in G2/M delay caused by arsenite.", "journal": "Molecular carcinogenesis", "date": "2005", "authors": "Isagawa T, Takahashi M, Kato T Jr, Mukai H, Ono Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-5625740", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625740" } ], "reference": [ { "type": "PubMed", "id": "15791647", "url": "https://glygen.org/publication/PubMed/15791647" } ] }, { "title": "Structural and mechanistic insights into the interaction between Rho and mammalian Dia.", "journal": "Nature", "date": "2005", "authors": "Rose R, Weyand M, Lammers M, Ishizaki T, Ahmadian MR, Wittinghofer A", "evidence": [ { "database": "UniProtKB", "id": "P08134", "url": "https://www.uniprot.org/uniprot/P08134" }, { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "15864301", "url": "https://glygen.org/publication/PubMed/15864301" } ] }, { "title": "Structural basis of Rho GTPase-mediated activation of the formin mDia1.", "journal": "Molecular cell", "date": "2005", "authors": "Otomo T, Otomo C, Tomchick DR, Machius M, Rosen MK", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "15866170", "url": "https://glygen.org/publication/PubMed/15866170" } ] }, { "title": "RhoB regulates endosome transport by promoting actin assembly on endosomal membranes through Dia1.", "journal": "Journal of cell science", "date": "2005", "authors": "Fernandez-Borja M, Janssen L, Verwoerd D, Hordijk P, Neefjes J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "15944396", "url": "https://glygen.org/publication/PubMed/15944396" } ] }, { "title": "The GAPs, GEFs, and GDIs of heterotrimeric G-protein alpha subunits.", "journal": "International journal of biological sciences", "date": "2005", "authors": "Siderovski DP, Willard FS", "evidence": [ { "database": "Reactome", "id": "R-HSA-416482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416482" } ], "reference": [ { "type": "PubMed", "id": "15951850", "url": "https://glygen.org/publication/PubMed/15951850" } ] }, { "title": "GrinchGEF--a novel Rho-specific guanine nucleotide exchange factor.", "journal": "Biochemical and biophysical research communications", "date": "2005", "authors": "Winkler S, Mohl M, Wieland T, Lutz S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013106", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013106" } ], "reference": [ { "type": "PubMed", "id": "16112081", "url": "https://glygen.org/publication/PubMed/16112081" } ] }, { "title": "Targeting and clustering citron to synapses.", "journal": "Molecular and cellular neurosciences", "date": "2006", "authors": "Zhang W, Benson DL", "evidence": [ { "database": "Reactome", "id": "R-HSA-5625900", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625900" } ], "reference": [ { "type": "PubMed", "id": "16202622", "url": "https://glygen.org/publication/PubMed/16202622" } ] }, { "title": "Rho GTPases: biochemistry and biology.", "journal": "Annual review of cell and developmental biology", "date": "2005", "authors": "Jaffe AB, Hall A", "evidence": [ { "database": "Reactome", "id": "R-HSA-416482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416482" } ], "reference": [ { "type": "PubMed", "id": "16212495", "url": "https://glygen.org/publication/PubMed/16212495" } ] }, { "title": "Regulation of LIM-kinase 1 and cofilin in thrombin-stimulated platelets.", "journal": "Blood", "date": "2006", "authors": "Pandey D, Goyal P, Bamburg JR, Siess W", "evidence": [ { "database": "Reactome", "id": "R-HSA-416572", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416572" } ], "reference": [ { "type": "PubMed", "id": "16219803", "url": "https://glygen.org/publication/PubMed/16219803" } ] }, { "title": "Dissecting the role of Rho-mediated signaling in contractile ring formation.", "journal": "Molecular biology of the cell", "date": "2006-01", "authors": "Kamijo Keiju, Ohara Naoya, Abe Mitsuhiro, Uchimura Takashi, Hosoya Hiroshi, Lee Jae-Seon, Miki Toru", "evidence": [ { "database": "UniProtKB", "id": "P08134", "url": "https://www.uniprot.org/uniprot/P08134" } ], "reference": [ { "type": "PubMed", "id": "16236794", "url": "https://glygen.org/publication/PubMed/16236794" } ] }, { "title": "The regulation of mDia1 by autoinhibition and its release by Rho*GTP.", "journal": "The EMBO journal", "date": "2005", "authors": "Lammers M, Rose R, Scrima A, Wittinghofer A", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "16292343", "url": "https://glygen.org/publication/PubMed/16292343" } ] }, { "title": "KIF14 and citron kinase act together to promote efficient cytokinesis.", "journal": "The Journal of cell biology", "date": "2006", "authors": "Gruneberg U, Neef R, Li X, Chan EH, Chalamalasetty RB, Nigg EA, Barr FA", "evidence": [ { "database": "Reactome", "id": "R-HSA-5625900", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625900" } ], "reference": [ { "type": "PubMed", "id": "16431929", "url": "https://glygen.org/publication/PubMed/16431929" } ] }, { "title": "Control of the assembly of ATP- and ADP-actin by formins and profilin.", "journal": "Cell", "date": "2006", "authors": "Kovar DR, Harris ES, Mahaffy R, Higgs HN, Pollard TD", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "16439214", "url": "https://glygen.org/publication/PubMed/16439214" } ] }, { "title": "The human CENP-A centromeric nucleosome-associated complex.", "journal": "Nature cell biology", "date": "2006", "authors": "Foltz DR, Jansen LE, Black BE, Bailey AO, Yates JR 3rd, Cleveland DW", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "16622419", "url": "https://glygen.org/publication/PubMed/16622419" } ] }, { "title": "The CENP-H-I complex is required for the efficient incorporation of newly synthesized CENP-A into centromeres.", "journal": "Nature cell biology", "date": "2006", "authors": "Okada M, Cheeseman IM, Hori T, Okawa K, McLeod IX, Yates JR 3rd, Desai A, Fukagawa T", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "16622420", "url": "https://glygen.org/publication/PubMed/16622420" } ] }, { "title": "Inactivation of Rho GTPases by p190 RhoGAP reduces human pancreatic cancer cell invasion and metastasis.", "journal": "Cancer science", "date": "2006", "authors": "Kusama T, Mukai M, Endo H, Ishikawa O, Tatsuta M, Nakamura H, Inoue M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013106", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013106" } ], "reference": [ { "type": "PubMed", "id": "16776779", "url": "https://glygen.org/publication/PubMed/16776779" } ] }, { "title": "The effect of missense mutations in the RhoGAP-homology domain on ocrl1 function.", "journal": "Molecular genetics and metabolism", "date": "2006", "authors": "Lichter-Konecki U, Farber LW, Cronin JS, Suchy SF, Nussbaum RL", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013106", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013106" } ], "reference": [ { "type": "PubMed", "id": "16777452", "url": "https://glygen.org/publication/PubMed/16777452" } ] }, { "title": "Gef10--the third member of a Rho-specific guanine nucleotide exchange factor subfamily with unusual protein architecture.", "journal": "Naunyn-Schmiedeberg's archives of pharmacology", "date": "2006", "authors": "Mohl M, Winkler S, Wieland T, Lutz S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013106", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013106" } ], "reference": [ { "type": "PubMed", "id": "16896804", "url": "https://glygen.org/publication/PubMed/16896804" } ] }, { "title": "Structural basis of function in heterotrimeric G proteins.", "journal": "Quarterly reviews of biophysics", "date": "2006", "authors": "Oldham WM, Hamm HE", "evidence": [ { "database": "Reactome", "id": "R-HSA-416482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416482" } ], "reference": [ { "type": "PubMed", "id": "16923326", "url": "https://glygen.org/publication/PubMed/16923326" } ] }, { "title": "Autoinhibition regulates cellular localization and actin assembly activity of the diaphanous-related formins FRLalpha and mDia1.", "journal": "The Journal of cell biology", "date": "2006", "authors": "Seth A, Otomo C, Rosen MK", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "16943183", "url": "https://glygen.org/publication/PubMed/16943183" } ] }, { "title": "Identification of a cell polarity-related protein, Lin-7B, as a binding partner for a Rho effector, Rhotekin, and their possible interaction in neurons.", "journal": "Neuroscience research", "date": "2006", "authors": "Sudo K, Ito H, Iwamoto I, Morishita R, Asano T, Nagata K", "evidence": [ { "database": "Reactome", "id": "R-HSA-5666185", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5666185" } ], "reference": [ { "type": "PubMed", "id": "16979770", "url": "https://glygen.org/publication/PubMed/16979770" } ] }, { "title": "Mapping the assembly pathways that specify formation of the trilaminar kinetochore plates in human cells.", "journal": "The Journal of cell biology", "date": "2006", "authors": "Liu ST, Rattner JB, Jablonski SA, Yen TJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "17030981", "url": "https://glygen.org/publication/PubMed/17030981" } ] }, { "title": "ARAP2 effects on the actin cytoskeleton are dependent on Arf6-specific GTPase-activating-protein activity and binding to RhoA-GTP.", "journal": "Journal of cell science", "date": "2006", "authors": "Yoon HY, Miura K, Cuthbert EJ, Davis KK, Ahvazi B, Casanova JE, Randazzo PA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013106", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013106" } ], "reference": [ { "type": "PubMed", "id": "17077126", "url": "https://glygen.org/publication/PubMed/17077126" } ] }, { "title": "The conserved KMN network constitutes the core microtubule-binding site of the kinetochore.", "journal": "Cell", "date": "2006", "authors": "Cheeseman IM, Chappie JS, Wilson-Kubalek EM, Desai A", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "17129783", "url": "https://glygen.org/publication/PubMed/17129783" } ] }, { "title": "Regulation of myosin II dynamics by phosphorylation and dephosphorylation of its light chain in epithelial cells.", "journal": "Molecular biology of the cell", "date": "2007", "authors": "Watanabe T, Hosoya H, Yonemura S", "evidence": [ { "database": "Reactome", "id": "R-HSA-416572", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416572" } ], "reference": [ { "type": "PubMed", "id": "17151359", "url": "https://glygen.org/publication/PubMed/17151359" } ] }, { "title": "RhoB and the mammalian Diaphanous-related formin mDia2 in endosome trafficking.", "journal": "Experimental cell research", "date": "2007", "authors": "Wallar BJ, Deward AD, Resau JH, Alberts AS", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "17198702", "url": "https://glygen.org/publication/PubMed/17198702" } ] }, { "title": "Up-regulation of myometrial RHO effector proteins (PKN1 and DIAPH1) and CPI-17 (PPP1R14A) phosphorylation in human pregnancy is associated with increased GTP-RHOA in spontaneous preterm labor.", "journal": "Biology of reproduction", "date": "2007", "authors": "Lartey J, Smith M, Pawade J, Strachan B, Mellor H, Lopez Bernal A", "evidence": [ { "database": "Reactome", "id": "R-HSA-5625740", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625740" } ], "reference": [ { "type": "PubMed", "id": "17301291", "url": "https://glygen.org/publication/PubMed/17301291" } ] }, { "title": "Profilin-actin complexes directly elongate actin filaments at the barbed end.", "journal": "Biochemistry", "date": "1992", "authors": "Pring M, Weber A, Bubb MR", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "1737036", "url": "https://glygen.org/publication/PubMed/1737036" } ] }, { "title": "A role of the Lowe syndrome protein OCRL in early steps of the endocytic pathway.", "journal": "Developmental cell", "date": "2007", "authors": "Erdmann KS, Mao Y, McCrea HJ, Zoncu R, Lee S, Paradise S, Modregger J, Biemesderfer D, Toomre D, De Camilli P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013106", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013106" } ], "reference": [ { "type": "PubMed", "id": "17765681", "url": "https://glygen.org/publication/PubMed/17765681" } ] }, { "title": "DLC-1 suppresses non-small cell lung cancer growth and invasion by RhoGAP-dependent and independent mechanisms.", "journal": "Molecular carcinogenesis", "date": "2008", "authors": "Healy KD, Hodgson L, Kim TY, Shutes A, Maddileti S, Juliano RL, Hahn KM, Harden TK, Bang YJ, Der CJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013106", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013106" } ], "reference": [ { "type": "PubMed", "id": "17932950", "url": "https://glygen.org/publication/PubMed/17932950" } ] }, { "title": "High-resolution structural analysis of mammalian profilin 2a complex formation with two physiological ligands: the formin homology 1 domain of mDia1 and the proline-rich domain of VASP.", "journal": "Journal of molecular biology", "date": "2008", "authors": "Kursula P, Kursula I, Massimi M, Song YH, Downer J, Stanley WA, Witke W, Wilmanns M", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "18001770", "url": "https://glygen.org/publication/PubMed/18001770" } ] }, { "title": "The Rac1 polybasic region is required for interaction with its effector PRK1.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Modha R, Campbell LJ, Nietlispach D, Buhecha HR, Owen D, Mott HR", "evidence": [ { "database": "Reactome", "id": "R-HSA-5625740", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625740" } ], "reference": [ { "type": "PubMed", "id": "18006505", "url": "https://glygen.org/publication/PubMed/18006505" } ] }, { "title": "ErbB-2 and met reciprocally regulate cellular signaling via plexin-B1.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Swiercz JM, Worzfeld T, Offermanns S", "evidence": [ { "database": "Reactome", "id": "R-HSA-416572", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416572" } ], "reference": [ { "type": "PubMed", "id": "18025083", "url": "https://glygen.org/publication/PubMed/18025083" } ] }, { "title": "Molecular architecture of the kinetochore-microtubule interface.", "journal": "Nature reviews. Molecular cell biology", "date": "2008", "authors": "Cheeseman IM, Desai A", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "18097444", "url": "https://glygen.org/publication/PubMed/18097444" } ] }, { "title": "Biochemical characterization of the Rho GTPase-regulated actin assembly by diaphanous-related formins, mDia1 and Daam1, in platelets.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Higashi T, Ikeda T, Shirakawa R, Kondo H, Kawato M, Horiguchi M, Okuda T, Okawa K, Fukai S, Nureki O, Kita T, Horiuchi H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013106", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013106" } ], "reference": [ { "type": "PubMed", "id": "18218625", "url": "https://glygen.org/publication/PubMed/18218625" } ] }, { "title": "Thromboxane A2: physiology/pathophysiology, cellular signal transduction and pharmacology.", "journal": "Pharmacology & therapeutics", "date": "2008", "authors": "Nakahata N", "evidence": [ { "database": "Reactome", "id": "R-HSA-416482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416482" } ], "reference": [ { "type": "PubMed", "id": "18374420", "url": "https://glygen.org/publication/PubMed/18374420" } ] }, { "title": "Dissociation of heterotrimeric g proteins in cells.", "journal": "Science signaling", "date": "2008", "authors": "Lambert NA", "evidence": [ { "database": "Reactome", "id": "R-HSA-416482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416482" } ], "reference": [ { "type": "PubMed", "id": "18577758", "url": "https://glygen.org/publication/PubMed/18577758" } ] }, { "title": "Clustering of VASP actively drives processive, WH2 domain-mediated actin filament elongation.", "journal": "The EMBO journal", "date": "2008", "authors": "Breitsprecher D, Kiesewetter AK, Linkner J, Urbanke C, Resch GP, Small JV, Faix J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "18923426", "url": "https://glygen.org/publication/PubMed/18923426" } ] }, { "title": "Regulation and physiological functions of G12/13-mediated signaling pathways.", "journal": "Neuro-Signals", "date": "2009", "authors": "Suzuki N, Hajicek N, Kozasa T", "evidence": [ { "database": "Reactome", "id": "R-HSA-416482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416482" } ], "reference": [ { "type": "PubMed", "id": "19212140", "url": "https://glygen.org/publication/PubMed/19212140" } ] }, { "title": "SCAI acts as a suppressor of cancer cell invasion through the transcriptional control of beta1-integrin.", "journal": "Nature cell biology", "date": "2009", "authors": "Brandt DT, Baarlink C, Kitzing TM, Kremmer E, Ivaska J, Nollau P, Grosse R", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "19350017", "url": "https://glygen.org/publication/PubMed/19350017" } ] }, { "title": "Regulation of immature dendritic cell migration by RhoA guanine nucleotide exchange factor Arhgef5.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Wang Z, Kumamoto Y, Wang P, Gan X, Lehmann D, Smrcka AV, Cohn L, Iwasaki A, Li L, Wu D", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013106", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013106" } ], "reference": [ { "type": "PubMed", "id": "19713215", "url": "https://glygen.org/publication/PubMed/19713215" } ] }, { "title": "Regulation of the interaction between protein kinase C-related protein kinase 2 (PRK2) and its upstream kinase, 3-phosphoinositide-dependent protein kinase 1 (PDK1).", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Dettori R, Sonzogni S, Meyer L, Lopez-Garcia LA, Morrice NA, Zeuzem S, Engel M, Piiper A, Neimanis S, Frodin M, Biondi RM", "evidence": [ { "database": "Reactome", "id": "R-HSA-5625740", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625740" } ], "reference": [ { "type": "PubMed", "id": "19723632", "url": "https://glygen.org/publication/PubMed/19723632" } ] }, { "title": "Formin-like 1 (FMNL1) is regulated by N-terminal myristoylation and induces polarized membrane blebbing.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Han Y, Eppinger E, Schuster IG, Weigand LU, Liang X, Kremmer E, Peschel C, Krackhardt AM", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "19815554", "url": "https://glygen.org/publication/PubMed/19815554" } ] }, { "title": "[PI3-kinase mediates activity of RhoA and interaction of RhoA with mDia1 in thrombin-induced platelet aggregation].", "journal": "Zhongguo shi yan xue ye xue za zhi", "date": "2009", "authors": "Gao GX, Dong HJ, Gu HT, Gao Y, Pan YZ, Yang Y, Chen XQ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "20030946", "url": "https://glygen.org/publication/PubMed/20030946" } ] }, { "title": "Formin-like 2 drives amoeboid invasive cell motility downstream of RhoC.", "journal": "Oncogene", "date": "2010", "authors": "Kitzing TM, Wang Y, Pertz O, Copeland JW, Grosse R", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "20101212", "url": "https://glygen.org/publication/PubMed/20101212" } ] }, { "title": "Regulation of Rho GTPase crosstalk, degradation and activity by RhoGDI1.", "journal": "Nat. Cell Biol.", "date": "2010", "authors": "Boulter E, Garcia-Mata R, Guilluy C, Dubash A, Rossi G, Brennwald PJ, Burridge K", "evidence": [ { "database": "UniProtKB", "id": "P08134", "url": "https://www.uniprot.org/uniprot/P08134" }, { "database": "Reactome", "id": "R-HSA-9013106", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013106" } ], "reference": [ { "type": "PubMed", "id": "20400958", "url": "https://glygen.org/publication/PubMed/20400958" } ] }, { "title": "RhoA and DIAPH1 mediate adrenocorticotropin-stimulated cortisol biosynthesis by regulating mitochondrial trafficking.", "journal": "Endocrinology", "date": "2010", "authors": "Li D, Sewer MB", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "20591975", "url": "https://glygen.org/publication/PubMed/20591975" } ] }, { "title": "The Rho target PRK2 regulates apical junction formation in human bronchial epithelial cells.", "journal": "Molecular and cellular biology", "date": "2011", "authors": "Wallace SW, Magalhaes A, Hall A", "evidence": [ { "database": "UniProtKB", "id": "P08134", "url": "https://www.uniprot.org/uniprot/P08134" } ], "reference": [ { "type": "PubMed", "id": "20974804", "url": "https://glygen.org/publication/PubMed/20974804" } ] }, { "title": "Bi-modal regulation of a formin by srGAP2.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Mason FM, Heimsath EG, Higgs HN, Soderling SH", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "21148482", "url": "https://glygen.org/publication/PubMed/21148482" } ] }, { "title": "Mutational analysis reveals a single binding interface between RhoA and its effector, PRK1.", "journal": "Biochemistry", "date": "2011", "authors": "Hutchinson CL, Lowe PN, McLaughlin SH, Mott HR, Owen D", "evidence": [ { "database": "Reactome", "id": "R-HSA-5625740", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625740" } ], "reference": [ { "type": "PubMed", "id": "21351730", "url": "https://glygen.org/publication/PubMed/21351730" } ] }, { "title": "Aurora B regulates formin mDia3 in achieving metaphase chromosome alignment.", "journal": "Developmental cell", "date": "2011", "authors": "Cheng L, Zhang J, Ahmad S, Rozier L, Yu H, Deng H, Mao Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "21397845", "url": "https://glygen.org/publication/PubMed/21397845" } ] }, { "title": "Mechanistic insights into specificity, activity, and regulatory elements of the regulator of G-protein signaling (RGS)-containing Rho-specific guanine nucleotide exchange factors (GEFs) p115, PDZ-RhoGEF (PRG), and leukemia-associated RhoGEF (LARG).", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Jaiswal M, Gremer L, Dvorsky R, Haeusler LC, Cirstea IC, Uhlenbrock K, Ahmadian MR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013106", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013106" } ], "reference": [ { "type": "PubMed", "id": "21454492", "url": "https://glygen.org/publication/PubMed/21454492" } ] }, { "title": "RhoA and RhoC have distinct roles in migration and invasion by acting through different targets.", "journal": "The Journal of cell biology", "date": "2011", "authors": "Vega FM, Fruhwirth G, Ng T, Ridley AJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "21576392", "url": "https://glygen.org/publication/PubMed/21576392" } ] }, { "title": "Site recognition and substrate screens for PKN family proteins.", "journal": "The Biochemical journal", "date": "2011", "authors": "Collazos A, Michael N, Whelan RD, Kelly G, Mellor H, Pang LC, Totty N, Parker PJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5625740", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625740" } ], "reference": [ { "type": "PubMed", "id": "21749319", "url": "https://glygen.org/publication/PubMed/21749319" } ] }, { "title": "RhoGDIalpha-dependent balance between RhoA and RhoC is a key regulator of cancer cell tumorigenesis.", "journal": "Molecular biology of the cell", "date": "2011", "authors": "Giang Ho TT, Stultiens A, Dubail J, Lapiere CM, Nusgens BV, Colige AC, Deroanne CF", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013106", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013106" } ], "reference": [ { "type": "PubMed", "id": "21757538", "url": "https://glygen.org/publication/PubMed/21757538" } ] }, { "title": "Dynamic remodeling of the actin cytoskeleton by FMNL1gamma is required for structural maintenance of the Golgi complex.", "journal": "Journal of cell science", "date": "2011", "authors": "Colon-Franco JM, Gomez TS, Billadeau DD", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "21868368", "url": "https://glygen.org/publication/PubMed/21868368" } ] }, { "title": "The C terminus of formin FMNL3 accelerates actin polymerization and contains a WH2 domain-like sequence that binds both monomers and filament barbed ends.", "journal": "The Journal of biological chemistry", "date": "2012", "authors": "Heimsath EG Jr, Higgs HN", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "22094460", "url": "https://glygen.org/publication/PubMed/22094460" } ] }, { "title": "The formin FMNL3 is a cytoskeletal regulator of angiogenesis.", "journal": "Journal of cell science", "date": "2012", "authors": "Hetheridge C, Scott AN, Swain RK, Copeland JW, Higgs HN, Bicknell R, Mellor H", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "22275430", "url": "https://glygen.org/publication/PubMed/22275430" } ] }, { "title": "p27(Kip1) controls cytokinesis via the regulation of citron kinase activation.", "journal": "The Journal of clinical investigation", "date": "2012", "authors": "Serres MP, Kossatz U, Chi Y, Roberts JM, Malek NP, Besson A", "evidence": [ { "database": "Reactome", "id": "R-HSA-5625900", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625900" } ], "reference": [ { "type": "PubMed", "id": "22293177", "url": "https://glygen.org/publication/PubMed/22293177" } ] }, { "title": "FMNL2 drives actin-based protrusion and migration downstream of Cdc42.", "journal": "Current biology : CB", "date": "2012", "authors": "Block J, Breitsprecher D, Kuhn S, Winterhoff M, Kage F, Geffers R, Duwe P, Rohn JL, Baum B, Brakebusch C, Geyer M, Stradal TE, Faix J, Rottner K", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "22608513", "url": "https://glygen.org/publication/PubMed/22608513" } ] }, { "title": "Activation of p115-RhoGEF requires direct association of Galpha13 and the Dbl homology domain.", "journal": "The Journal of biological chemistry", "date": "2012", "authors": "Chen Z, Guo L, Hadas J, Gutowski S, Sprang SR, Sternweis PC", "evidence": [ { "database": "Reactome", "id": "R-HSA-416482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416482" } ], "reference": [ { "type": "PubMed", "id": "22661716", "url": "https://glygen.org/publication/PubMed/22661716" } ] }, { "title": "Divergence of Rho residue 43 impacts GEF activity.", "journal": "Small GTPases", "date": "2012", "authors": "Sloan CM, Quinn CV, Peters JP, Farley J, Goetzinger C, Wernli M, DeMali KA, Ellerbroek SM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013106", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013106" }, { "database": "Entrez", "id": "389", "url": "https://www.ncbi.nlm.nih.gov/gene/389" } ], "reference": [ { "type": "PubMed", "id": "22673745", "url": "https://glygen.org/publication/PubMed/22673745" } ] }, { "title": "Protein N-myristoylation is required for cellular morphological changes induced by two formin family proteins, FMNL2 and FMNL3.", "journal": "Bioscience, biotechnology, and biochemistry", "date": "2012", "authors": "Moriya K, Yamamoto T, Takamitsu E, Matsunaga Y, Kimoto M, Fukushige D, Kimoto C, Suzuki T, Utsumi T", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "22790947", "url": "https://glygen.org/publication/PubMed/22790947" } ] }, { "title": "Identification of a novel actin-binding domain within the Rho guanine nucleotide exchange factor TEM4.", "journal": "PloS one", "date": "2012", "authors": "Mitin N, Rossman KL, Der CJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013106", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013106" } ], "reference": [ { "type": "PubMed", "id": "22911862", "url": "https://glygen.org/publication/PubMed/22911862" } ] }, { "title": "Rho isoform-specific interaction with IQGAP1 promotes breast cancer cell proliferation and migration.", "journal": "The Journal of biological chemistry", "date": "2012", "authors": "Casteel DE, Turner S, Schwappacher R, Rangaswami H, Su-Yuo J, Zhuang S, Boss GR, Pilz RB", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013106", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013106" } ], "reference": [ { "type": "PubMed", "id": "22992742", "url": "https://glygen.org/publication/PubMed/22992742" } ] }, { "title": "ARHGAP21 is a RhoGAP for RhoA and RhoC with a role in proliferation and migration of prostate adenocarcinoma cells.", "journal": "Biochimica et biophysica acta", "date": "2013", "authors": "Lazarini M, Traina F, Machado-Neto JA, Barcellos KS, Moreira YB, Brandao MM, Verjovski-Almeida S, Ridley AJ, Saad ST", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013106", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013106" } ], "reference": [ { "type": "PubMed", "id": "23200924", "url": "https://glygen.org/publication/PubMed/23200924" } ] }, { "title": "FMNL3 FH2-actin structure gives insight into formin-mediated actin nucleation and elongation.", "journal": "Nature structural & molecular biology", "date": "2013", "authors": "Thompson ME, Heimsath EG, Gauvin TJ, Higgs HN, Kull FJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "23222643", "url": "https://glygen.org/publication/PubMed/23222643" } ] }, { "title": "Deciphering the molecular and functional basis of Dbl family proteins: a novel systematic approach toward classification of selective activation of the Rho family proteins.", "journal": "The Journal of biological chemistry", "date": "2013", "authors": "Jaiswal M, Dvorsky R, Ahmadian MR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013106", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013106" } ], "reference": [ { "type": "PubMed", "id": "23255595", "url": "https://glygen.org/publication/PubMed/23255595" } ] }, { "title": "Citron kinase mediates transition from constriction to abscission through its coiled-coil domain.", "journal": "Journal of cell science", "date": "2013", "authors": "Watanabe S, De Zan T, Ishizaki T, Narumiya S", "evidence": [ { "database": "Reactome", "id": "R-HSA-5625900", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625900" } ], "reference": [ { "type": "PubMed", "id": "23444367", "url": "https://glygen.org/publication/PubMed/23444367" } ] }, { "title": "Citron kinase controls a molecular network required for midbody formation in cytokinesis.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2013", "authors": "Bassi ZI, Audusseau M, Riparbelli MG, Callaini G, D'Avino PP", "evidence": [ { "database": "Reactome", "id": "R-HSA-5625900", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625900" } ], "reference": [ { "type": "PubMed", "id": "23716662", "url": "https://glygen.org/publication/PubMed/23716662" } ] }, { "title": "FMNL1 promotes proliferation and migration of leukemia cells.", "journal": "Journal of leukocyte biology", "date": "2013", "authors": "Favaro P, Traina F, Machado-Neto JA, Lazarini M, Lopes MR, Pereira JK, Costa FF, Infante E, Ridley AJ, Saad ST", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "23801653", "url": "https://glygen.org/publication/PubMed/23801653" } ] }, { "title": "Differential binding of RhoA, RhoB, and RhoC to protein kinase C-related kinase (PRK) isoforms PRK1, PRK2, and PRK3: PRKs have the highest affinity for RhoB.", "journal": "Biochemistry", "date": "2013", "authors": "Hutchinson CL, Lowe PN, McLaughlin SH, Mott HR, Owen D", "evidence": [ { "database": "Reactome", "id": "R-HSA-5625740", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625740" } ], "reference": [ { "type": "PubMed", "id": "24128008", "url": "https://glygen.org/publication/PubMed/24128008" } ] }, { "title": "A bacterial toxin catalyzing tyrosine glycosylation of Rho and deamidation of Gq and Gi proteins.", "journal": "Nature structural & molecular biology", "date": "2013", "authors": "Jank T, Bogdanovic X, Wirth C, Haaf E, Spoerner M, Bohmer KE, Steinemann M, Orth JH, Kalbitzer HR, Warscheid B, Hunte C, Aktories K", "evidence": [ { "database": "UniProtKB", "id": "P08134", "url": "https://www.uniprot.org/uniprot/P08134#ptm_processing" }, { "database": "UniProtKB", "id": "P08134", "url": "https://www.uniprot.org/uniprot/P08134" } ], "reference": [ { "type": "PubMed", "id": "24141704", "url": "https://glygen.org/publication/PubMed/24141704" } ] }, { "title": "Haemorrhagic toxin and lethal toxin from Clostridium sordellii strain vpi9048: molecular characterization and comparative analysis of substrate specificity of the large clostridial glucosylating toxins.", "journal": "Cellular microbiology", "date": "2014", "authors": "Genth H, Pauillac S, Schelle I, Bouvet P, Bouchier C, Varela-Chavez C, Just I, Popoff MR", "evidence": [ { "database": "UniProtKB", "id": "P08134", "url": "https://www.uniprot.org/uniprot/P08134" } ], "reference": [ { "type": "PubMed", "id": "24905543", "url": "https://glygen.org/publication/PubMed/24905543" } ] }, { "title": "Formins as effector proteins of Rho GTPases.", "journal": "Small GTPases", "date": "2014", "authors": "Kuhn S, Geyer M", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "24914801", "url": "https://glygen.org/publication/PubMed/24914801" } ] }, { "title": "Ripasudil: first global approval.", "journal": "Drugs", "date": "2014", "authors": "Garnock-Jones KP", "evidence": [ { "database": "Reactome", "id": "R-HSA-416482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416482" } ], "reference": [ { "type": "PubMed", "id": "25414122", "url": "https://glygen.org/publication/PubMed/25414122" } ] }, { "title": "ARHGAP18: an endogenous inhibitor of angiogenesis, limiting tip formation and stabilizing junctions.", "journal": "Small GTPases", "date": "2014", "authors": "Chang GH, Lay AJ, Ting KK, Zhao Y, Coleman PR, Powter EE, Formaz-Preston A, Jolly CJ, Bower NI, Hogan BM, Rinkwitz S, Becker TS, Vadas MA, Gamble JR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013106", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013106" } ], "reference": [ { "type": "PubMed", "id": "25425145", "url": "https://glygen.org/publication/PubMed/25425145" } ] }, { "title": "Discovery of the ROCK inhibitor netarsudil for the treatment of open-angle glaucoma.", "journal": "Bioorganic & medicinal chemistry letters", "date": "2016", "authors": "Sturdivant JM, Royalty SM, Lin CW, Moore LA, Yingling JD, Laethem CL, Sherman B, Heintzelman GR, Kopczynski CC, deLong MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-416482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416482" } ], "reference": [ { "type": "PubMed", "id": "27072905", "url": "https://glygen.org/publication/PubMed/27072905" } ] }, { "title": "Deciphering the Molecular and Functional Basis of RHOGAP Family Proteins: A SYSTEMATIC APPROACH TOWARD SELECTIVE INACTIVATION OF RHO FAMILY PROTEINS.", "journal": "The Journal of biological chemistry", "date": "2016", "authors": "Amin E, Jaiswal M, Derewenda U, Reis K, Nouri K, Koessmeier KT, Aspenstrom P, Somlyo AV, Dvorsky R, Ahmadian MR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013106", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013106" } ], "reference": [ { "type": "PubMed", "id": "27481945", "url": "https://glygen.org/publication/PubMed/27481945" } ] }, { "title": "RHO binding to FAM65A regulates Golgi reorientation during cell migration.", "journal": "J. Cell Sci.", "date": "2016", "authors": "Mardakheh FK, Self A, Marshall CJ", "evidence": [ { "database": "UniProtKB", "id": "P08134", "url": "https://www.uniprot.org/uniprot/P08134" } ], "reference": [ { "type": "PubMed", "id": "27807006", "url": "https://glygen.org/publication/PubMed/27807006" } ] }, { "title": "RSK2 drives cell motility by serine phosphorylation of LARG and activation of Rho GTPases.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2018", "authors": "Shi GX, Yang WS, Jin L, Matter ML, Ramos JW", "evidence": [ { "database": "iPTMnet", "id": "P08134", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08134" } ], "reference": [ { "type": "PubMed", "id": "29279389", "url": "https://glygen.org/publication/PubMed/29279389" } ] }, { "title": "Effects of phosphorylation of light chain residues threonine 18 and serine 19 on the properties and conformation of smooth muscle myosin.", "journal": "The Journal of biological chemistry", "date": "1988", "authors": "Ikebe M, Koretz J, Hartshorne DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-416572", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416572" } ], "reference": [ { "type": "PubMed", "id": "2966156", "url": "https://glygen.org/publication/PubMed/2966156" } ] }, { "title": "Rho Kinase Inhibitors as a Novel Treatment for Glaucoma and Ocular Hypertension.", "journal": "Ophthalmology", "date": "2018", "authors": "Tanna AP, Johnson M", "evidence": [ { "database": "Reactome", "id": "R-HSA-416482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416482" } ], "reference": [ { "type": "PubMed", "id": "30007591", "url": "https://glygen.org/publication/PubMed/30007591" } ] }, { "title": "A triarylphosphine-trimethylpiperidine reagent for the one-step derivatization and enrichment of protein post-translational modifications and identification by mass spectrometry.", "journal": "Chemical communications (Cambridge, England)", "date": "2018", "authors": "Huo B, Zhang W, Zhao X, Dong H, Yu Y, Wang J, Qian X, Qin W", "evidence": [ { "database": "O-GlcNAc Database", "id": "P08134", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08134" } ], "reference": [ { "type": "PubMed", "id": "30379171", "url": "https://glygen.org/publication/PubMed/30379171" } ] }, { "title": "Mapping the proximity interaction network of the Rho-family GTPases reveals signalling pathways and regulatory mechanisms.", "journal": "Nature cell biology", "date": "2020", "authors": "Bagci H, Sriskandarajah N, Robert A, Boulais J, Elkholi IE, Tran V, Lin ZY, Thibault MP, Dube N, Faubert D, Hipfner DR, Gingras AC, Cote JF", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013106", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013106" } ], "reference": [ { "type": "PubMed", "id": "31871319", "url": "https://glygen.org/publication/PubMed/31871319" } ] }, { "title": "Coding sequence of human rho cDNAs clone 6 and clone 9.", "journal": "Nucleic Acids Res.", "date": "1988", "authors": "Chardin P, Madaule P, Tavitian A", "evidence": [ { "database": "UniProtKB", "id": "P08134", "url": "https://www.uniprot.org/uniprot/P08134" } ], "reference": [ { "type": "PubMed", "id": "3283705", "url": "https://glygen.org/publication/PubMed/3283705" } ] }, { "title": "Proteomic profiling and genome-wide mapping of O-GlcNAc chromatin-associated proteins reveal an O-GlcNAc-regulated genotoxic stress response.", "journal": "Nature communications", "date": "2020", "authors": "Liu Y, Chen Q, Zhang N, Zhang K, Dou T, Cao Y, Liu Y, Li K, Hao X, Xie X, Li W, Ren Y, Zhang J", "evidence": [ { "database": "O-GlcNAc Database", "id": "P08134", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08134" } ], "reference": [ { "type": "PubMed", "id": "33214551", "url": "https://glygen.org/publication/PubMed/33214551" } ] }, { "title": "RNF168 promotes RHOC degradation by ubiquitination to restrain gastric cancer progression via decreasing HDAC1 expression.", "journal": "Biochemical and biophysical research communications", "date": "2021", "authors": "Xu Y, Feng Y, Sun Z, Li Q", "evidence": [ { "database": "RefSeq", "id": "NP_001036143", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001036143" } ], "reference": [ { "type": "PubMed", "id": "33865221", "url": "https://glygen.org/publication/PubMed/33865221" } ] }, { "title": "RNF168 suppresses the cancer stem cell-like traits of nonsmall cell lung cancer cells by mediating RhoC ubiquitination.", "journal": "Environmental toxicology", "date": "2022", "authors": "Rong G, Pan Z, Ding M, Wang L", "evidence": [ { "database": "RefSeq", "id": "NP_001036143", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001036143" } ], "reference": [ { "type": "PubMed", "id": "34873829", "url": "https://glygen.org/publication/PubMed/34873829" } ] }, { "title": "RhoC in association with TET2/WDR5 regulates cancer stem cells by epigenetically modifying the expression of pluripotency genes.", "journal": "Cellular and molecular life sciences : CMLS", "date": "2022-12-05", "authors": "Thomas Pavana, Srivastava Sweta, Udayashankara Avinash H, Damodaran Samyuktha, Yadav Lokendra, Mathew Boby, Suresh Srinag Bangalore, Mandal Amit Kumar, Srikantia Nirmala", "evidence": [ { "database": "RefSeq", "id": "NP_001036143", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001036143" } ], "reference": [ { "type": "PubMed", "id": "36469134", "url": "https://glygen.org/publication/PubMed/36469134" } ] }, { "title": "LncRNA ZFAS1 contributes to osteosarcoma progression via miR-520b and miR-520e-mediated inhibition of RHOC signaling.", "journal": "Clinics (Sao Paulo, Brazil)", "date": "2023", "authors": "Liu Xiaofeng, Wang Mingyang, Zhang Liwen, Huang Lei", "evidence": [ { "database": "RefSeq", "id": "NP_001036143", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001036143" } ], "reference": [ { "type": "PubMed", "id": "36473367", "url": "https://glygen.org/publication/PubMed/36473367" } ] }, { "title": "Silencing of RhoC induces macrophage M1 polarization to inhibit migration and invasion in colon cancer via regulating thePTEN/FOXO1 pathway.", "journal": "International journal of experimental pathology", "date": "2022-12-28", "authors": "Yang Bin, Wang Lihua, Tian Zhiying", "evidence": [ { "database": "RefSeq", "id": "NP_001036143", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001036143" } ], "reference": [ { "type": "PubMed", "id": "36576072", "url": "https://glygen.org/publication/PubMed/36576072" } ] }, { "title": "Phosphorylation of smooth muscle myosin at two distinct sites by myosin light chain kinase.", "journal": "The Journal of biological chemistry", "date": "1985", "authors": "Ikebe M, Hartshorne DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-416572", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416572" } ], "reference": [ { "type": "PubMed", "id": "3839510", "url": "https://glygen.org/publication/PubMed/3839510" } ] }, { "title": "Direct involvement of the small GTP-binding protein Rho in lbc oncogene function.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Zheng Y, Olson MF, Hall A, Cerione RA, Toksoz D", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013106", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013106" } ], "reference": [ { "type": "PubMed", "id": "7721814", "url": "https://glygen.org/publication/PubMed/7721814" } ] }, { "title": "Mechanism of GTP hydrolysis by G-protein alpha subunits.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1994", "authors": "Kleuss C, Raw AS, Lee E, Sprang SR, Gilman AG", "evidence": [ { "database": "Reactome", "id": "R-HSA-416482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416482" } ], "reference": [ { "type": "PubMed", "id": "7937899", "url": "https://glygen.org/publication/PubMed/7937899" } ] }, { "title": "A novel partner for the GTP-bound forms of rho and rac.", "journal": "FEBS letters", "date": "1995", "authors": "Madaule P, Furuyashiki T, Reid T, Ishizaki T, Watanabe G, Morii N, Narumiya S", "evidence": [ { "database": "Reactome", "id": "R-HSA-5625900", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625900" } ], "reference": [ { "type": "PubMed", "id": "8543060", "url": "https://glygen.org/publication/PubMed/8543060" } ] }, { "title": "Protein kinase N (PKN) and PKN-related protein rhophilin as targets of small GTPase Rho.", "journal": "Science (New York, N.Y.)", "date": "1996", "authors": "Watanabe G, Saito Y, Madaule P, Ishizaki T, Fujisawa K, Morii N, Mukai H, Ono Y, Kakizuka A, Narumiya S", "evidence": [ { "database": "Reactome", "id": "R-HSA-5666185", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5666185" } ], "reference": [ { "type": "PubMed", "id": "8571126", "url": "https://glygen.org/publication/PubMed/8571126" } ] }, { "title": "The small GTP-binding protein Rho binds to and activates a 160 kDa Ser/Thr protein kinase homologous to myotonic dystrophy kinase.", "journal": "The EMBO journal", "date": "1996", "authors": "Ishizaki T, Maekawa M, Fujisawa K, Okawa K, Iwamatsu A, Fujita A, Watanabe N, Saito Y, Kakizuka A, Morii N, Narumiya S", "evidence": [ { "database": "Reactome", "id": "R-HSA-416482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416482" } ], "reference": [ { "type": "PubMed", "id": "8617235", "url": "https://glygen.org/publication/PubMed/8617235" } ] }, { "title": "Regulation of myosin phosphatase by Rho and Rho-associated kinase (Rho-kinase)", "journal": "Science (New York, N.Y.)", "date": "1996", "authors": "Kimura K, Ito M, Amano M, Chihara K, Fukata Y, Nakafuku M, Yamamori B, Feng J, Nakano T, Okawa K, Iwamatsu A, Kaibuchi K", "evidence": [ { "database": "Reactome", "id": "R-HSA-5625740", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625740" } ], "reference": [ { "type": "PubMed", "id": "8662509", "url": "https://glygen.org/publication/PubMed/8662509" } ] }, { "title": "Rhotekin, a new putative target for Rho bearing homology to a serine/threonine kinase, PKN, and rhophilin in the rho-binding domain.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Reid T, Furuyashiki T, Ishizaki T, Watanabe G, Watanabe N, Fujisawa K, Morii N, Madaule P, Narumiya S", "evidence": [ { "database": "Reactome", "id": "R-HSA-5666185", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5666185" } ], "reference": [ { "type": "PubMed", "id": "8662891", "url": "https://glygen.org/publication/PubMed/8662891" } ] }, { "title": "Phosphorylation and activation of myosin by Rho-associated kinase (Rho-kinase).", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Amano M, Ito M, Kimura K, Fukata Y, Chihara K, Nakano T, Matsuura Y, Kaibuchi K", "evidence": [ { "database": "Reactome", "id": "R-HSA-416572", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416572" } ], "reference": [ { "type": "PubMed", "id": "8702756", "url": "https://glygen.org/publication/PubMed/8702756" } ] }, { "title": "Rho proteins are localized with different membrane compartments involved in vesicular trafficking in anterior pituitary cells.", "journal": "Molecular and cellular endocrinology", "date": "1996", "authors": "Cussac D, Leblanc P, L'Heritier A, Bertoglio J, Lang P, Kordon C, Enjalbert A, Saltarelli D", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013106", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013106" } ], "reference": [ { "type": "PubMed", "id": "8807639", "url": "https://glygen.org/publication/PubMed/8807639" } ] }, { "title": "The p160 RhoA-binding kinase ROK alpha is a member of a kinase family and is involved in the reorganization of the cytoskeleton.", "journal": "Mol. Cell. Biol.", "date": "1996", "authors": "Leung T, Chen XQ, Manser E, Lim L", "evidence": [ { "database": "UniProtKB", "id": "P08134", "url": "https://www.uniprot.org/uniprot/P08134" }, { "database": "Reactome", "id": "R-HSA-416482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416482" } ], "reference": [ { "type": "PubMed", "id": "8816443", "url": "https://glygen.org/publication/PubMed/8816443" } ] }, { "title": "RhoGDI-3 is a new GDP dissociation inhibitor (GDI). Identification of a non-cytosolic GDI protein interacting with the small GTP-binding proteins RhoB and RhoG.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Zalcman G, Closson V, Camonis J, Honore N, Rousseau-Merck MF, Tavitian A, Olofsson B", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013106", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013106" } ], "reference": [ { "type": "PubMed", "id": "8939998", "url": "https://glygen.org/publication/PubMed/8939998" } ] }, { "title": "Mitotic and G2 checkpoint control: regulation of 14-3-3 protein binding by phosphorylation of Cdc25C on serine-216.", "journal": "Science (New York, N.Y.)", "date": "1997", "authors": "Peng CY, Graves PR, Thoma RS, Wu Z, Shaw AS, Piwnica-Worms H", "evidence": [ { "database": "Reactome", "id": "R-HSA-5625740", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625740" } ], "reference": [ { "type": "PubMed", "id": "9278512", "url": "https://glygen.org/publication/PubMed/9278512" } ] }, { "title": "Rho GTPases and signaling networks.", "journal": "Genes & development", "date": "1997", "authors": "Van Aelst L, D'Souza-Schorey C", "evidence": [ { "database": "Reactome", "id": "R-HSA-416482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416482" } ], "reference": [ { "type": "PubMed", "id": "9308960", "url": "https://glygen.org/publication/PubMed/9308960" } ] }, { "title": "Regulation of myosin phosphatase through phosphorylation of the myosin-binding subunit in platelet activation.", "journal": "Blood", "date": "1997", "authors": "Nakai K, Suzuki Y, Kihira H, Wada H, Fujioka M, Ito M, Nakano T, Kaibuchi K, Shiku H, Nishikawa M", "evidence": [ { "database": "Reactome", "id": "R-HSA-5625740", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625740" } ], "reference": [ { "type": "PubMed", "id": "9354661", "url": "https://glygen.org/publication/PubMed/9354661" } ] }, { "title": "The role of profilin in actin polymerization and nucleotide exchange.", "journal": "Biochemistry", "date": "1998", "authors": "Korenbaum E, Nordberg P, Bjorkegren-Sjogren C, Schutt CE, Lindberg U, Karlsson R", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "9649308", "url": "https://glygen.org/publication/PubMed/9649308" } ] }, { "title": "Citron rho-interacting kinase, a novel tissue-specific ser/thr kinase encompassing the Rho-Rac-binding protein Citron.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Di Cunto F, Calautti E, Hsiao J, Ong L, Topley G, Turco E, Dotto GP", "evidence": [ { "database": "Reactome", "id": "R-HSA-5625900", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625900" } ], "reference": [ { "type": "PubMed", "id": "9792683", "url": "https://glygen.org/publication/PubMed/9792683" } ] }, { "title": "The G protein G alpha12 stimulates Bruton's tyrosine kinase and a rasGAP through a conserved PH/BM domain.", "journal": "Nature", "date": "1998", "authors": "Jiang Y, Ma W, Wan Y, Kozasa T, Hattori S, Huang XY", "evidence": [ { "database": "Reactome", "id": "R-HSA-416482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416482" } ], "reference": [ { "type": "PubMed", "id": "9796816", "url": "https://glygen.org/publication/PubMed/9796816" } ] }, { "title": "Citron binds to PSD-95 at glutamatergic synapses on inhibitory neurons in the hippocampus.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "date": "1999", "authors": "Zhang W, Vazquez L, Apperson M, Kennedy MB", "evidence": [ { "database": "Reactome", "id": "R-HSA-5625900", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625900" } ], "reference": [ { "type": "PubMed", "id": "9870942", "url": "https://glygen.org/publication/PubMed/9870942" } ] }, { "title": "Citron, a Rho-target, interacts with PSD-95/SAP-90 at glutamatergic synapses in the thalamus.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "date": "1999", "authors": "Furuyashiki T, Fujisawa K, Fujita A, Madaule P, Uchino S, Mishina M, Bito H, Narumiya S", "evidence": [ { "database": "Reactome", "id": "R-HSA-5625900", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625900" } ], "reference": [ { "type": "PubMed", "id": "9870943", "url": "https://glygen.org/publication/PubMed/9870943" } ] }, { "title": "A human homologue of the checkpoint kinase Cds1 directly inhibits Cdc25 phosphatase.", "journal": "Current biology : CB", "date": "1999", "authors": "Blasina A, de Weyer IV, Laus MC, Luyten WH, Parker AE, McGowan CH", "evidence": [ { "database": "Reactome", "id": "R-HSA-5625740", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625740" } ], "reference": [ { "type": "PubMed", "id": "9889122", "url": "https://glygen.org/publication/PubMed/9889122" } ] }, { "title": "Loop 6 of RhoA confers specificity for effector binding, stress fiber formation, and cellular transformation.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Zong H, Raman N, Mickelson-Young LA, Atkinson SJ, Quilliam LA", "evidence": [ { "database": "Reactome", "id": "R-HSA-5625740", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625740" } ], "reference": [ { "type": "PubMed", "id": "9988689", "url": "https://glygen.org/publication/PubMed/9988689" } ] } ], "pathway": [ { "id": "hsa:389", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:389", "resource": "KEGG Pathway" }, { "id": "R-HSA-416482", "name": "G alpha (12/13) signalling events", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416482", "resource": "Reactome", "description": "G alpha (12/13) signalling events" }, { "id": "R-HSA-416572", "name": "Sema4D induced cell migration and growth-cone collapse", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416572", "resource": "Reactome", "description": "Sema4D induced cell migration and growth-cone collapse" }, { "id": "R-HSA-5625740", "name": "RHO GTPases activate PKNs", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625740", "resource": "Reactome", "description": "RHO GTPases activate PKNs" }, { "id": "R-HSA-5625900", "name": "RHO GTPases activate CIT", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625900", "resource": "Reactome", "description": "RHO GTPases activate CIT" }, { "id": "R-HSA-5627117", "name": "RHO GTPases Activate ROCKs", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5627117", "resource": "Reactome", "description": "RHO GTPases Activate ROCKs" }, { "id": "R-HSA-5663220", "name": "RHO GTPases Activate Formins", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220", "resource": "Reactome", "description": "RHO GTPases Activate Formins" }, { "id": "R-HSA-5666185", "name": "RHO GTPases Activate Rhotekin and Rhophilins", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5666185", "resource": "Reactome", "description": "RHO GTPases Activate Rhotekin and Rhophilins" }, { "id": "R-HSA-9013106", "name": "RHOC GTPase cycle", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013106", "resource": "Reactome", "description": "RHOC GTPase cycle" } ], "orthologs": [ { "uniprot_canonical_ac": "A0A8I6AN62-1", "protein_name": "Ras homolog family member C", "gene_name": "Rhoc", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MATIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRQDEHTRRELAKMKQEPVRSEEGRDMANRISAFGYLECSAKTKEGVRENSRNLWGTAHWHAWEAALRSRVRRHALSTATSGAELLHSTY", "length": 210 }, "evidence": [ { "id": "45920504", "url": "http://www.informatics.jax.org/homology/45920504", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q62159-1", "protein_name": "Rho-related GTP-binding protein RhoC", "gene_name": "Rhoc", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRQDEHTRRELAKMKQEPVRSEEGRDMANRISAFGYLECSAKTKEGVREVFEMATRAGLQVRKNKRRRGCPIL", "length": 193 }, "evidence": [ { "id": "45920504", "url": "http://www.informatics.jax.org/homology/45920504", "database": "MGI" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 3, "go_terms": [ { "name": "GTPase activity", "id": "GO:0003924", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003924", "evidence": [ { "database": "UniProtKB", "id": "P08134", "url": "https://www.uniprot.org/uniprot/P08134" } ], "pmid": "" }, { "name": "GTP binding", "id": "GO:0005525", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005525", "evidence": [ { "database": "UniProtKB", "id": "P08134", "url": "https://www.uniprot.org/uniprot/P08134" } ], "pmid": "" }, { "name": "protein kinase binding", "id": "GO:0019901", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019901", "evidence": [ { "database": "UniProtKB", "id": "P08134", "url": "https://www.uniprot.org/uniprot/P08134" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 12, "go_terms": [ { "name": "small GTPase mediated signal transduction", "id": "GO:0007264", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007264", "evidence": [ { "database": "UniProtKB", "id": "P08134", "url": "https://www.uniprot.org/uniprot/P08134" } ], "pmid": "" }, { "name": "skeletal muscle satellite cell migration", "id": "GO:1902766", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1902766", "evidence": [ { "database": "UniProtKB", "id": "P08134", "url": "https://www.uniprot.org/uniprot/P08134" } ], "pmid": "" }, { "name": "wound healing, spreading of cells", "id": "GO:0044319", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0044319", "evidence": [ { "database": "UniProtKB", "id": "P08134", "url": "https://www.uniprot.org/uniprot/P08134" } ], "pmid": "" }, { "name": "apical junction assembly", "id": "GO:0043297", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043297", "evidence": [ { "database": "UniProtKB", "id": "P08134", "url": "https://www.uniprot.org/uniprot/P08134" } ], "pmid": "" }, { "name": "actin filament organization", "id": "GO:0007015", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007015", "evidence": [ { "database": "UniProtKB", "id": "P08134", "url": "https://www.uniprot.org/uniprot/P08134" } ], "pmid": "" }, { "name": "signal transduction", "id": "GO:0007165", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007165", "evidence": [ { "database": "UniProtKB", "id": "P08134", "url": "https://www.uniprot.org/uniprot/P08134" } ], "pmid": "" }, { "name": "positive regulation of cell migration", "id": "GO:0030335", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030335", "evidence": [ { "database": "UniProtKB", "id": "P08134", "url": "https://www.uniprot.org/uniprot/P08134" } ], "pmid": "" }, { "name": "positive regulation of protein-containing complex assembly", "id": "GO:0031334", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031334", "evidence": [ { "database": "UniProtKB", "id": "P08134", "url": "https://www.uniprot.org/uniprot/P08134" } ], "pmid": "" }, { "name": "positive regulation of canonical NF-kappaB signal transduction", "id": "GO:0043123", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043123", "evidence": [ { "database": "UniProtKB", "id": "P08134", "url": "https://www.uniprot.org/uniprot/P08134" } ], "pmid": "" }, { "name": "positive regulation of stress fiber assembly", "id": "GO:0051496", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051496", "evidence": [ { "database": "UniProtKB", "id": "P08134", "url": "https://www.uniprot.org/uniprot/P08134" } ], "pmid": "" }, { "name": "mitotic cytokinesis", "id": "GO:0000281", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000281", "evidence": [ { "database": "UniProtKB", "id": "P08134", "url": "https://www.uniprot.org/uniprot/P08134" } ], "pmid": "" }, { "name": "positive regulation of lipase activity", "id": "GO:0060193", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060193", "evidence": [ { "database": "UniProtKB", "id": "P08134", "url": "https://www.uniprot.org/uniprot/P08134" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 8, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "P08134", "url": "https://www.uniprot.org/uniprot/P08134" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "P08134", "url": "https://www.uniprot.org/uniprot/P08134" } ], "pmid": "" }, { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "P08134", "url": "https://www.uniprot.org/uniprot/P08134" } ], "pmid": "" }, { "name": "extracellular exosome", "id": "GO:0070062", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070062", "evidence": [ { "database": "UniProtKB", "id": "P08134", "url": "https://www.uniprot.org/uniprot/P08134" } ], "pmid": "" }, { "name": "endoplasmic reticulum membrane", "id": "GO:0005789", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005789", "evidence": [ { "database": "UniProtKB", "id": "P08134", "url": "https://www.uniprot.org/uniprot/P08134" } ], "pmid": "" }, { "name": "neuron projection", "id": "GO:0043005", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043005", "evidence": [ { "database": "UniProtKB", "id": "P08134", "url": "https://www.uniprot.org/uniprot/P08134" } ], "pmid": "" }, { "name": "cleavage furrow", "id": "GO:0032154", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032154", "evidence": [ { "database": "UniProtKB", "id": "P08134", "url": "https://www.uniprot.org/uniprot/P08134" } ], "pmid": "" }, { "name": "stereocilium", "id": "GO:0032420", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032420", "evidence": [ { "database": "UniProtKB", "id": "P08134", "url": "https://www.uniprot.org/uniprot/P08134" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [ { "annotation": "(Microbial infection) Glucosylated at Thr-37 by C.difficile toxins TcdA and TcdB in the colonic epithelium (PubMed:24905543). Monoglucosylation completely prevents the recognition of the downstream effector, blocking the GTPases in their inactive form, leading to actin cytoskeleton disruption (PubMed:24905543).", "evidence": [ { "database": "UniProtKB", "id": "P08134", "url": "https://www.uniprot.org/uniprot/P08134" }, { "database": "PubMed", "id": "24905543", "url": "https://glygen.org/publication/PubMed/24905543" } ] }, { "annotation": "(Microbial infection) Glycosylated at Tyr-34 by Photorhabdus asymbiotica toxin PAU_02230. Mono-O-GlcNAcylation by PAU_02230 inhibits downstream signaling by an impaired interaction with diverse regulator and effector proteins of Rho and leads to actin disassembly.", "evidence": [ { "database": "UniProtKB", "id": "P08134", "url": "https://www.uniprot.org/uniprot/P08134" }, { "database": "PubMed", "id": "24141704", "url": "https://glygen.org/publication/PubMed/24141704" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [ 34 ], "snv_sites": [ 86, 151 ], "glycation_sites": [], "phosphorylation_sites": [ 73 ], "sequon_annotation_sites": [] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 2 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 164 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }